Waltz threshold =85

Waltz thresholds: 80 73.5

DisProt ID UniProt Acc Protein Organism Start
(IDR)		 End
(IDR)		 Start
(CAR)		 End
(CAR)		 CAR Length Sequence Waltz Score
DP00006P00004Cytochrome c Equus caballus (Horse) 1 104 64 71 8 TLMEYLEN 87.29
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 654 838 744 757 14 QGEAILPRISVIST 87.12
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 654 838 804 810 7 ELDIYSR 86.96
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 654 838 816 825 10 TGLEISEEIN 86.42
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 708 831 744 757 14 QGEAILPRISVIST 87.12
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 708 831 804 810 7 ELDIYSR 86.96
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 708 831 816 825 10 TGLEISEEIN 86.42
DP00015P61926cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform) Oryctolagus cuniculus (Rabbit) 1 76 4 15 12 VETTYADFIASG 87.07
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 1 164 47 57 11 ERWNFDFVTET 87.29
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 1 164 61 68 8 GDFAWERV 91.64
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 1 94 47 57 11 ERWNFDFVTET 87.29
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 1 94 61 68 8 GDFAWERV 91.64
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 9 84 47 57 11 ERWNFDFVTET 87.29
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 9 84 61 68 8 GDFAWERV 91.64
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 1 198 58 65 8 RKWNFDFQ 86.96
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 22 105 58 65 8 RKWNFDFQ 86.96
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 22 97 58 65 8 RKWNFDFQ 86.96
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 25 93 58 65 8 RKWNFDFQ 86.96
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 55 95 58 65 8 RKWNFDFQ 86.96
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 123 92 106 15 ATANIASTSGASVTE 93.65
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 210 359 246 253 8 KTEIISTN 91.97
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 210 359 300 306 7 DLVQIEQ 85.95
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 594 674 627 634 8 ASNSYAIP 86.96
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 594 674 643 650 8 TMNFISSL 91.97
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 594 674 653 669 17 DLSNISNSLPFEYPHEI 92.64
DP00024P03129Protein E7 Human papillomavirus type 16 1 40 7 13 7 TLHEYML 86.96
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 745 874 766 776 11 QGGNIVDIDFD 87.56
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 745 874 804 814 11 HGGNIIDIDFD 91.43
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 745 874 825 831 7 HTEIIEE 90.64
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 746 858 766 776 11 QGGNIVDIDFD 87.56
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 746 858 804 814 11 HGGNIIDIDFD 91.43
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 746 858 825 831 7 HTEIIEE 90.64
DP00026P06179Flagellin (Phase 1-I flagellin) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 65 1 33 33 MAQVINTNSLSLLTQNNLNKSQSALGTAIERLS 87.2
DP00026P06179Flagellin (Phase 1-I flagellin) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 65 46 59 14 AGQAIANRFTANIK 89.25
DP00027P26477Negative regulator of flagellin synthesis (Anti-sigma-28 factor) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 97 83 92 10 ADSLIREAQS 90.3
DP00027P26477Negative regulator of flagellin synthesis (Anti-sigma-28 factor) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 41 97 83 92 10 ADSLIREAQS 90.3
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 1 118 49 59 11 GTRIIYDRKFL 87.63
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 5 118 49 59 11 GTRIIYDRKFL 87.63
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 49 83 49 59 11 GTRIIYDRKFL 87.63
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 50 84 50 59 10 TRIIYDRKFL 87.63
DP00030P04150Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) Homo sapiens (Human) 77 262 81 90 10 AVSLSMGLYM 88.83
DP00030P04150Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) Homo sapiens (Human) 77 262 122 130 9 LEESIANLN 86.62
DP00030P04150Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) Homo sapiens (Human) 77 262 180 202 23 NVKLYTTDQSTFDILQDLEFSSG 88.43
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 271 299 29 IIFGIFGLTVMLFVFLFSKQQRIKMLILP 94.97
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 321 330 10 EVNTILAIHD 88.06
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 341 351 11 SWVEFIELDID 87.41
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 469 477 9 QAAHIQLSN 87.63
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 480 494 15 SLSNIDFYAQVSDIT 91.97
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 524 538 15 CQENFLMDNAYFCEA 88.47
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 562 574 13 QEDIYITTESLTT 93.11
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 604 613 10 PQGLILNATA 86.96
DP00036P22121Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) 1 195 15 22 8 NPNNILLP 86.96
DP00036P22121Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) 1 195 105 115 11 AGGVYSIGNSS 86.65
DP00037Q9Y9L0Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin) Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) 197 250 208 216 9 LDWWFCWDT 98.66
DP00037Q9Y9L0Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin) Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) 197 250 238 245 8 AKLLYEEA 88.29
DP00041P07746High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) 1 204 13 22 10 SSYAYFVQTR 96.12
DP00041P07746High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) 1 204 33 41 9 ASVNFSEFS 94.31
DP00041P07746High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) 1 204 99 106 8 SAFFIFCA 98.91
DP00047P02687Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) Bos taurus (Bovine) 1 169 84 93 10 PVVHFFKNIV 90.1
DP00047P02687Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) Bos taurus (Bovine) 1 169 148 156 9 TLSKIFKLG 90.97
DP00047P02687Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) Bos taurus (Bovine) 1 109 84 93 10 PVVHFFKNIV 90.1
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 24 39 16 VAEEIVEEETVVEETG 91.97
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 141 152 12 HLDYIGPCKYIA 86.62
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 173 180 8 VLVTLYER 87.88
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 219 235 17 FEKNYNMYIFPVHWQFG 88.59
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 276 297 22 NDKYIALEEWAGCFGIKEQDIN 88.13
DP00053P27001Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) Thermus thermophilus 1 101 5 11 7 ALAAIQN 92.98
DP00053P27001Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) Thermus thermophilus 1 101 53 67 15 ELNAIKAALEAALEA 85.28
DP00053P27001Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) Thermus thermophilus 1 84 5 11 7 ALAAIQN 92.98
DP00053P27001Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) Thermus thermophilus 1 84 53 67 15 ELNAIKAALEAALEA 85.28
DP00055P106881-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1) Rattus norvegicus (Rat) 130 202 141 147 7 LQHWIHS 87.96
DP00055P106881-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1) Rattus norvegicus (Rat) 130 202 170 176 7 KELNIQV 91.97
DP00062P19793Retinoic acid receptor RXR-alpha (Nuclear receptor subfamily 2 group B member 1) (Retinoid X receptor alpha) Homo sapiens (Human) 1 130 13 21 9 TQVNSSLTS 88.29
DP00064P03607Capsid protein (Coat protein) Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea)) 1 64 13 21 9 EIRAFVMAT 85.28
DP00064P03607Capsid protein (Coat protein) Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea)) 1 64 28 36 9 LAQAIQNTL 90.3
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 571 579 9 KIGNYVWED 92.75
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 618 624 7 GSYLIPN 86.96
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 630 638 9 YRVEFSNLP 86.96
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 741 748 8 YKVEFTTP 85.95
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 771 802 32 TTGVINGADNMTLDSGFYKTPKYNLGNYVWED 87.93
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 1017 1023 7 GDYVWYD 96.99
DP00066P27285Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus) 1 113 2 10 9 NRGFFNMLG 87.18
DP00066P27285Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus) 1 113 42 56 15 IQQLTTAVSALVIGQ 86.8
DP00067Q57733Small heat shock protein HSP16.5 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 1 32 7 22 16 FDSLFERMFKEFFATP 88.4
DP00068P60881Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) Rattus norvegicus (Rat) 1 206 125 135 11 EQMAISGGFIR 86.96
DP00068P60881Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) Rattus norvegicus (Rat) 1 206 153 161 9 VSGIIGNLR 86.29
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 140 35 41 7 EGVLYVG 97.32
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 140 84 95 12 GAGSIAAATGFV 85.95
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 103 35 41 7 EGVLYVG 97.32
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 103 84 95 12 GAGSIAAATGFV 85.95
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 102 35 41 7 EGVLYVG 97.32
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 102 84 95 12 GAGSIAAATGFV 85.95
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 61 95 84 90 7 GAGSIAA 85.95
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 9962 9970 9 EEVKIMTIT 88.52
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 9993 10013 21 KRVFIESFEEPYDELEVEPYT 86.19
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10049 10056 8 EGQEYYER 96.57
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10112 10120 9 VIEKIEKTS 87.29
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10191 10207 17 VQKEIVTEEKIHVAISK 89.02
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10429 10437 9 EGVSISVYR 85.88
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10466 10472 7 KLHIISK 89.97
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10671 10687 17 EYEEYEEYDYKEFEEYE 87.47
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10694 10707 14 QYEEYEEREYERYE 88.63
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10709 10715 7 HEEYITE 93.31
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10833 10858 26 EEVAFEEEVVTHVEEYLVEEEEEYIH 90.49
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10860 10867 8 EEEFITEE 87.63
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 11032 11041 10 EEVLFEEEIV 90.3
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 11312 11332 21 EVEEYFEEGEFHEVEEFIKLE 90
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 11348 11360 13 VIEVFEAEEVEVF 87.96
DP00074P03372Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) Homo sapiens (Human) 1 184 39 45 7 LGEVYLD 87.48
DP00074P03372Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) Homo sapiens (Human) 1 184 58 75 18 AAYEFNAAAAANAQVYGQ 94.09
DP00074P03372Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) Homo sapiens (Human) 1 184 126 136 11 QQVPYYLENEP 87.11
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1070 1105 1075 1081 7 IAEQIND 85.28
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1071 1105 1075 1081 7 IAEQIND 85.28
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1225 1236 12 NFERILLEQKLV 86.96
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1270 1277 8 SSSIFDIK 86.96
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1285 1301 17 ELSKISNKFKKISTIFD 89.4
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1356 1366 11 SDLEILDSYTD 88.63
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1406 1412 7 DDSFIED 89.3
DP00078P01100Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) Homo sapiens (Human) 216 380 235 245 11 SEEAFTLPLLN 86.62
DP00078P01100Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) Homo sapiens (Human) 216 380 295 306 12 SGSFYAADWEPL 90.97
DP00078P01100Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) Homo sapiens (Human) 216 380 337 346 10 YTSSFVFTYP 90.27
DP00079Q92731Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) Homo sapiens (Human) 1 103 27 37 11 HGSIYIPSSYV 87.72
DP00079Q92731Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) Homo sapiens (Human) 1 103 45 59 15 AMTFYSPAVMNYSIP 91.15
DP00081P51123Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230) Drosophila melanogaster (Fruit fly) 11 77 21 29 9 TGILFGNID 92.2
DP00082P39935Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 393 490 410 418 9 TVSHILNVL 88.63
DP00082P39935Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 393 490 425 433 9 EDVFSFNYP 90.78
DP00082P39935Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 393 490 446 461 16 EHVKYTYGPTFLLQFK 86.96
DP00082P39935Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 393 490 468 481 14 ADAEWVQSTASKIV 88.25
DP00083P03069General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 101 134 107 115 9 MFEYENLED 87.29
DP00084P61244Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) Homo sapiens (Human) 2 110 67 75 9 ATEYIQYMR 87.89
DP00085Q04206Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) Homo sapiens (Human) 428 551 474 480 7 FQQLLNQ 90.97
DP00085Q04206Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) Homo sapiens (Human) 428 551 533 546 14 DFSSIADMDFSALL 87.86
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 93 15 26 12 SQETFSDLWKLL 90.97
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 93 50 56 7 IEQWFTE 88.34
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 73 15 26 12 SQETFSDLWKLL 90.97
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 73 50 56 7 IEQWFTE 88.34
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 39 15 26 12 SQETFSDLWKLL 90.97
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 14 60 15 26 12 SQETFSDLWKLL 90.97
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 20 73 50 56 7 IEQWFTE 88.34
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 41 62 50 56 7 IEQWFTE 88.34
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 320 393 323 334 12 LDGEYFTLQIRG 87.51
DP00087P68336Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) 350 394 367 380 14 TRNNYGSTIEGLLD 85.52
DP00087P68336Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) 413 490 471 481 11 DDFEFEQMFTD 89.3
DP00088P0ABI8Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) Escherichia coli (strain K12) 1 51 17 46 30 VMVTIAGIILGGLALVGLITYFGKWTYLWK 92.46
DP00088P0ABI8Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) Escherichia coli (strain K12) 553 663 562 568 7 DAFWEMK 87.29
DP00088P0ABI8Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) Escherichia coli (strain K12) 553 663 591 631 41 AGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFD 92.38
DP00089P0ABJ1Cytochrome bo(3) ubiquinol oxidase subunit 2 (Cytochrome b562-o complex subunit II) (Cytochrome o ubiquinol oxidase subunit 2) (Cytochrome o subunit 2) (Oxidase bo(3) subunit 2) (Ubiquinol oxidase chain B) (Ubiquinol oxidase polypeptide II) (Ubiquinol oxidase subunit 2) Escherichia coli (strain K12) 1 26 10 21 12 LGWLSLFAGTVL 91.69
DP00091P27088DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog) Xenopus laevis (African clawed frog) 1 84 66 74 9 GGGFFIEEE 90.08
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 521 448 462 15 TVEAIEADEAIKGFS 88.09
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 468 448 462 15 TVEAIEADEAIKGFS 88.09
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 466 448 461 14 TVEAIEADEAIKGF 88.1
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 374 468 448 462 15 TVEAIEADEAIKGFS 88.09
DP00094P04177Tyrosine 3-monooxygenase (EC 1.14.16.2) (Tyrosine 3-hydroxylase) (TH) Rattus norvegicus (Rat) 1 71 38 44 7 RQSLIED 91.97
DP00100P0A6H5ATP-dependent protease ATPase subunit HslU (Heat shock protein HslU) (Unfoldase HslU) Escherichia coli (strain K12) 175 209 182 188 7 MGVEIMA 91.97
DP00104P32773Transcription initiation factor IIA large subunit (TFIIA large subunit) (TFIIA 32 kDa subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 210 240 227 233 7 DDYLISE 94.31
DP00107P69924Ribonucleoside-diphosphate reductase 1 subunit beta (EC 1.17.4.1) (Protein B2) (Protein R2) (Ribonucleotide reductase 1) Escherichia coli (strain K12) 342 376 353 363 11 EVSSYLVGQID 85.95
DP00110P40881Carbonic anhydrase (EC 4.2.1.1) Methanosarcina thermophila 1 37 4 20 17 NKQIFTILILSLSLALA 88.96
DP00111P27577Protein C-ets-1 (p54) Mus musculus (Mouse) 244 301 265 278 14 TQSWSSQSSFNSLQ 88.89
DP00116P81455Osteocalcin (Bone Gla protein) (BGP) (Gamma-carboxyglutamic acid-containing protein) Canis lupus familiaris (Dog) (Canis familiaris) 1 49 38 44 7 FQEAYQR 91.11
DP00118P05059Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor Bos taurus (Bovine) 1 449 13 21 9 AGQVIALPV 89.97
DP00118P05059Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor Bos taurus (Bovine) 1 449 36 42 7 IVEVISD 86.72
DP00118P05059Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor Bos taurus (Bovine) 1 449 65 79 15 RILSILRHQNLLKEL 87.29
DP00118P05059Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor Bos taurus (Bovine) 1 449 428 436 9 SLSAIEAEL 88.29
DP00119P10163Basic salivary proline-rich protein 4 (Salivary proline-rich protein Po) (Parotid o protein) (Salivary proline-rich protein II-1) Cleaved into: Protein N1; Glycosylated protein A; Peptide P-D (Proline-rich peptide IB-5) Homo sapiens (Human) 17 310 26 34 9 EESLFLISG 88.37
DP00120P12957Caldesmon (CDM) Gallus gallus (Chicken) 636 771 637 643 7 LEQYTSA 85.28
DP00122P15146Microtubule-associated protein 2 (MAP-2) Rattus norvegicus (Rat) 136 297 226 242 17 FAQTFGTNLEDIKQITE 89.3
DP00122P15146Microtubule-associated protein 2 (MAP-2) Rattus norvegicus (Rat) 136 297 263 269 7 KDWFIEM 97.32
DP00122P15146Microtubule-associated protein 2 (MAP-2) Rattus norvegicus (Rat) 298 467 342 349 8 APVFFQSD 91.97
DP00122P15146Microtubule-associated protein 2 (MAP-2) Rattus norvegicus (Rat) 298 467 404 410 7 VGENISG 90.64
DP00123P01730T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4) Homo sapiens (Human) 398 458 407 420 14 GLLLFIGLGIFFCV 91.14
DP00125P63292Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH) Bos taurus (Bovine) 30 60 31 41 11 YADAIFTNSYR 95.38
DP00128P40357Protein transport protein SEC9 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 401 651 556 562 7 ANNNISE 93.31
DP00128P40357Protein transport protein SEC9 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 401 651 625 633 9 RLNNIEEST 90.3
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 11 21 11 VALLLLLVLGS 87.11
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 61 67 7 LALLYHE 91.97
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 81 95 15 MEELILELAAQVLED 91.77
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 120 139 20 EDSIYVFKEDEVIEYDGEFS 87.36
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 142 153 12 TLVEFLLDVLED 87.68
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 163 172 10 ELQAFENIED 94.65
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 201 209 9 YIPFFATFD 90.19
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 219 230 12 KLNEIDFYEAFM 90.13
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 242 253 12 SEEEIVNFVEEH 95.57
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 278 286 9 HIVAFAEEA 97.99
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 292 300 9 EFLEILKSV 91.97
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 309 317 9 DLSIIWIDP 95.95
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 348 355 8 ADSVWMEM 87.29
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 375 383 9 LEGEINTED 87.29
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 300 25 41 17 GSLAIEEAMAAWSEISD 86.96
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 300 106 115 10 GLQCYYVYDH 89.3
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 300 278 287 10 NAALIQEWTP 89.5
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 230 25 41 17 GSLAIEEAMAAWSEISD 86.96
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 230 106 115 10 GLQCYYVYDH 89.3
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 229 25 41 17 GSLAIEEAMAAWSEISD 86.96
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 229 106 115 10 GLQCYYVYDH 89.3
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 50 25 41 17 GSLAIEEAMAAWSEISD 86.96
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 281 422 303 309 7 LIQEIVD 96.66
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 281 422 376 382 7 VLVASSV 85.62
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 444 632 594 600 7 TLQNTSS 85.28
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 445 632 594 600 7 TLQNTSS 85.28
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 516 632 594 600 7 TLQNTSS 85.28
DP00135P10961Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 167 98 108 11 PLGIYQTNLYG 89.54
DP00135P10961Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 260 332 268 274 7 LLEKIIR 87.29
DP00135P10961Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 260 332 308 322 15 SNNNISSSNSFFNNG 90.39
DP00136P15865Histone H1.4 (H1d) Rattus norvegicus (Rat) 31 119 40 52 13 VSELITKAVAASK 89.3
DP00141O95405Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation) Homo sapiens (Human) 663 751 676 682 7 GQFGISA 89.3
DP00146P0A7T730S ribosomal protein S18 (Small ribosomal subunit protein bS18) Escherichia coli (strain K12) 1 75 17 40 24 GVQEIDYKDIATLKNYITESGKIV 89.28
DP00152Q13426DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4) Homo sapiens (Human) 203 265 254 260 7 DDSIISS 93.65
DP00157P0CL52Cell invasion protein SipA (Effector protein SipA) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 425 512 462 468 7 QTAEIVN 86.96
DP00157P0CL52Cell invasion protein SipA (Effector protein SipA) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 446 512 462 468 7 QTAEIVN 86.96
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 732 884 751 759 9 RDNVYYYDE 96.84
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 732 884 808 818 11 EIGNFIDENLK 87.66
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 732 884 829 839 11 YDSLLVFDYEG 87.17
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 736 884 751 759 9 RDNVYYYDE 96.84
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 736 884 808 818 11 EIGNFIDENLK 87.66
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 736 884 829 839 11 YDSLLVFDYEG 87.17
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 778 884 808 818 11 EIGNFIDENLK 87.66
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 778 884 829 839 11 YDSLLVFDYEG 87.17
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 784 852 808 818 11 EIGNFIDENLK 87.66
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 784 852 829 839 11 YDSLLVFDYEG 87.17
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 812 884 829 839 11 YDSLLVFDYEG 87.17
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 13 19 7 VLESIYP 90.59
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 34 42 9 FEVAIKLEL 91.97
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 79 89 11 QEVALNDNEED 86.96
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 145 153 9 CFALISSIK 87.51
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 156 162 7 CEQWYSE 88.15
DP00164P0531860S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 106 5 23 19 SALSYAALILADSEIEISS 88.28
DP00164P0531860S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 106 37 48 12 VENIWADIFAKA 88.74
DP00164P0531860S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 106 57 65 9 LLVNFSAGA 98.33
DP00173O00273DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD) Homo sapiens (Human) 1 116 84 100 17 KFVALASNEKWAYNNSD 90.08
DP00173O00273DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD) Homo sapiens (Human) 1 116 102 111 10 GTAWISQESF 88.73
DP00174P16949Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17) Homo sapiens (Human) 1 149 19 25 7 AFELILS 98.33
DP00174P16949Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17) Homo sapiens (Human) 1 149 89 102 14 ENNNFSKMAEEKLT 86.96
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 130 15 22 8 NDELISFK 96.32
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 130 102 109 8 GYPFIMIP 86.96
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 56 15 22 8 NDELISFK 96.32
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 53 15 22 8 NDELISFK 96.32
DP00179P01094Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 68 7 15 9 KVSEIFQSS 88.48
DP00179P01094Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 2 34 7 15 9 KVSEIFQSS 88.48
DP00179P01094Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 2 32 7 15 9 KVSEIFQSS 88.48
DP00180P19972Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain) Millerozyma farinosa (Yeast) (Pichia farinosa) 146 222 201 207 7 YMIKFSL 85.28
DP00184P11473Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) Homo sapiens (Human) 16 125 32 40 9 TGFHFNAMT 91.97
DP00184P11473Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) Homo sapiens (Human) 16 125 91 97 7 KEFILTD 86.62
DP00184P11473Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) Homo sapiens (Human) 120 164 128 138 11 QQRIIAILLDA 87.17
DP00188P12359Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) Spinacia oleracea (Spinach) 85 332 207 214 8 VPFLFTIK 93.14
DP00188P12359Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) Spinacia oleracea (Spinach) 85 332 297 305 9 VIGVFQSLQ 87.29
DP00188P12359Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) Spinacia oleracea (Spinach) 85 332 317 327 11 KDVKIEGVWYA 94.5
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 63 71 9 GITIISASQ 93.65
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 109 118 10 EKLLIVVTST 86.72
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 132 138 7 HKFLFSK 91.97
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 147 163 17 AFAVFSLGDSSYEFFCQ 89.44
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 186 199 14 ADVEYQAAASEWRA 97.66
DP00192P02668Kappa-casein Cleaved into: Casoxin-C; Casoxin-6; Casoxin-A; Casoxin-B; Casoplatelin Bos taurus (Bovine) 1 21 7 16 10 LVVTILALTL 97.66
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 14 22 9 AQALIVTQT 98.33
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 32 49 18 AGTWYSLAMAASDISLLD 87.87
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 68 79 12 GDLEILLQKWEN 91.97
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 96 106 11 AVFKIDALNEN 94.98
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 117 125 9 KYLLFCMEN 94.98
DP00196P20810Calpastatin (Calpain inhibitor) (Sperm BS-17 component) Homo sapiens (Human) 137 277 186 195 10 MSSTYIEELG 86.62
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 28 60 36 55 20 DGILFIYGVILTALFLRVKF 89.11
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 52 164 68 78 11 QNQLYNELNLG 97.32
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 52 164 107 115 9 QEGLYNELQ 94.98
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 52 164 119 127 9 MAEAYSEIG 91.75
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 52 164 138 147 10 HDGLYQGLST 91.97
DP00201P02721ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) Bos taurus (Bovine) 33 108 89 97 9 TFPNFTFED 85.28
DP00201P02721ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) Bos taurus (Bovine) 84 108 89 97 9 TFPNFTFED 85.28
DP00205Q82S91Metal-binding protein SmbP Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) 1 117 13 26 14 VTALFLSMQVYASG 89.63
DP00205Q82S91Metal-binding protein SmbP Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) 1 117 102 110 9 AQEAIEHLR 94.31
DP00207P21513Ribonuclease E (RNase E) (EC 3.1.26.12) Escherichia coli (strain K12) 498 1061 840 847 8 GKVWIRYP 91.3
DP00207P21513Ribonuclease E (RNase E) (EC 3.1.26.12) Escherichia coli (strain K12) 498 1061 876 882 7 VAAAIEP 88.29
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 2 18 17 RIAVICFCLLGITCAIP 85.28
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 29 37 9 EKQLYNKYP 86.85
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 39 46 8 AVATWLNP 86.96
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 142 148 7 ATEVFTP 86.62
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 161 167 7 DSVVYGL 86.62
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 17 314 29 37 9 EKQLYNKYP 86.85
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 17 314 39 46 8 AVATWLNP 86.96
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 17 314 142 148 7 ATEVFTP 86.62
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 17 314 161 167 7 DSVVYGL 86.62
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 41 48 8 GAVFLAAC 90.3
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 64 70 7 ADINYAN 97.99
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 87 101 15 DMVKFLVENGANINQ 89.79
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 120 128 9 DIAEYLISQ 95.69
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 215 235 21 LKLLIQARYDVNIKDYDGWTP 93.3
DP00221P07476Involucrin Homo sapiens (Human) 1 585 88 103 16 QQQHWEQHEEYQKAEN 85.28
DP00221P07476Involucrin Homo sapiens (Human) 1 585 281 287 7 GQLKYLE 94.31
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 63 73 11 QASSFSFLNRA 86.62
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 122 133 12 RYELYIKNILEA 91.11
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 185 192 8 SDSVFSFG 87.21
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 316 326 11 SSFTFGSTTIE 86.96
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 415 421 7 AFNLISN 98.66
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 548 556 9 TGFKFSLPF 87.29
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 606 612 7 EVALFSQ 90.64
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 615 623 9 KLMTFNAET 87.63
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 656 664 9 GNVLLNATV 88.29
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 691 700 10 KLVTYIVKFK 92.71
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 185 192 8 SDSVFSFG 87.21
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 316 326 11 SSFTFGSTTIE 86.96
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 415 421 7 AFNLISN 98.66
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 562 720 606 612 7 EVALFSQ 90.64
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 562 720 615 623 9 KLMTFNAET 87.63
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 562 720 656 664 9 GNVLLNATV 88.29
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 562 720 691 700 10 KLVTYIVKFK 92.71
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 558 567 10 ALDIFGDLFD 87.29
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 655 671 17 VIDLFGDAFGSSASETQ 86.62
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 705 722 18 AQNNLLQPNFEAAFGTTP 86.29
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 558 567 10 ALDIFGDLFD 87.29
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 655 671 17 VIDLFGDAFGSSASETQ 86.62
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 705 722 18 AQNNLLQPNFEAAFGTTP 86.29
DP00231P14859POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) Homo sapiens (Human) 1 200 43 49 7 QAQAFLG 92.31
DP00231P14859POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) Homo sapiens (Human) 1 200 118 135 18 QQQLLLQQAQAQAQLLAA 86.21
DP00231P14859POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) Homo sapiens (Human) 1 200 149 157 9 AGATISASA 87.29
DP00231P14859POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) Homo sapiens (Human) 1 200 183 195 13 QQQNLNLQQFVLV 88.04
DP00233P14448Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Gallus gallus (Chicken) 238 504 248 256 9 AMSAFNNIK 95.65
DP00233P14448Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Gallus gallus (Chicken) 238 504 370 384 15 DLESFFTHDSVSTSS 91.55
DP00236P02686Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) Homo sapiens (Human) 134 304 219 228 10 PVVHFFKNIV 90.1
DP00236P02686Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) Homo sapiens (Human) 134 304 283 291 9 TLSKIFKLG 90.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 101 108 8 YANSYNFA 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 120 126 7 DEVSIIQ 91.3
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 176 184 9 TSVYIELGS 95.99
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 224 236 13 AACEFSETDVTNT 90.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 382 388 7 VNEWFSR 93.31
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 437 445 9 HEALICKSE 91.64
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 452 465 14 VESNIEDKIFGKTY 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 478 494 17 TENLIIGAFVTEPQIIQ 91.25
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 544 552 9 QVMNITNSG 85.62
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 596 602 7 LELNIHN 87.63
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 779 791 13 TQESISLLEVSTL 88.29
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 804 810 7 QCAAFEN 85.95
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 856 862 7 YLQNTFK 88.15
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 921 927 7 QTVNITA 86.96
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 962 968 7 ETGLITP 85.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 999 1008 10 LEENFEEHSM 89.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1022 1047 26 TVSTISRNNIRENVFKEASSSNINEV 91.77
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1054 1062 9 VGSSINEIG 87.07
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1064 1073 10 SDENIQAELG 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1125 1135 11 SPYLISDNLEQ 85.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1227 1238 12 QHLLFGKVNNIP 87.46
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1271 1277 7 SNQVILA 93.74
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1292 1299 8 SASLFSSQ 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1401 1420 20 QHNLIKLQQEMAELEAVLEQ 86.62
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1452 1458 7 KAVLTSQ 87.29
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1567 1573 7 GISLFSD 97.32
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 175 303 176 184 9 TSVYIELGS 95.99
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 175 303 224 236 13 AACEFSETDVTNT 90.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 224 236 13 AACEFSETDVTNT 90.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 382 388 7 VNEWFSR 93.31
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 437 445 9 HEALICKSE 91.64
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 452 465 14 VESNIEDKIFGKTY 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 478 493 16 TENLIIGAFVTEPQII 91.2
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 304 394 382 388 7 VNEWFSR 93.31
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 433 511 437 445 9 HEALICKSE 91.64
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 433 511 452 465 14 VESNIEDKIFGKTY 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 433 511 478 494 17 TENLIIGAFVTEPQIIQ 91.25
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 498 663 544 552 9 QVMNITNSG 85.62
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 498 663 596 602 7 LELNIHN 87.63
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 779 791 13 TQESISLLEVSTL 88.29
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 804 810 7 QCAAFEN 85.95
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 856 862 7 YLQNTFK 88.15
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 921 927 7 QTVNITA 86.96
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 962 968 7 ETGLITP 85.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 999 1008 10 LEENFEEHSM 89.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 1022 1047 26 TVSTISRNNIRENVFKEASSSNINEV 91.77
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 1054 1062 9 VGSSINEIG 87.07
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 1064 1073 10 SDENIQAELG 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 779 791 13 TQESISLLEVSTL 88.29
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 804 810 7 QCAAFEN 85.95
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 856 862 7 YLQNTFK 88.15
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 921 927 7 QTVNITA 86.96
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 962 968 7 ETGLITP 85.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 999 1008 10 LEENFEEHSM 89.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 1022 1047 26 TVSTISRNNIRENVFKEASSSNINEV 91.77
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 936 1057 962 968 7 ETGLITP 85.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 936 1057 999 1008 10 LEENFEEHSM 89.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 936 1057 1022 1047 26 TVSTISRNNIRENVFKEASSSNINEV 91.77
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 1343 1440 1401 1420 20 QHNLIKLQQEMAELEAVLEQ 86.62
DP00240P35611Alpha-adducin (Erythrocyte adducin subunit alpha) Homo sapiens (Human) 430 737 485 495 11 VPNLFVPLNTN 87.29
DP00241P35612Beta-adducin (Erythrocyte adducin subunit beta) Homo sapiens (Human) 409 726 520 526 7 LASVIAE 91.64
DP00241P35612Beta-adducin (Erythrocyte adducin subunit beta) Homo sapiens (Human) 409 726 657 663 7 TAEEILS 88.29
DP00242P0AG6330S ribosomal protein S17 (Small ribosomal subunit protein uS17) Escherichia coli (strain K12) 1 83 21 29 9 IVVAIERFV 90.08
DP00242P0AG6330S ribosomal protein S17 (Small ribosomal subunit protein uS17) Escherichia coli (strain K12) 4 83 21 29 9 IVVAIERFV 90.08
DP00245P00514cAMP-dependent protein kinase type I-alpha regulatory subunit Cleaved into: cAMP-dependent protein kinase type I-alpha regulatory subunit; N-terminally processed Bos taurus (Bovine) 91 112 100 106 7 SAEVYTE 88.15
DP00249P63315Troponin C; slow skeletal and cardiac muscles (TN-C) Bos taurus (Bovine) 103 161 108 130 23 ADGYIDLEELKIMLQATGETITE 88.63
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 44 50 7 GQSEYFD 88.87
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 53 61 9 TQMNINLYD 97.44
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 90 122 33 VGQTILSGHSTYYIYVIATAPNMFNVNDVLGAY 93.33
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 139 154 16 YSQIYGWYRVHFGVLD 91.97
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 164 174 11 RDRYYSNLDIA 86.96
DP00251O88339Epsin-1 (EPS-15-interacting protein 1) Rattus norvegicus (Rat) 144 575 238 246 9 LQMAIEESK 87.63
DP00251O88339Epsin-1 (EPS-15-interacting protein 1) Rattus norvegicus (Rat) 144 575 261 267 7 ADVFTTP 90.3
DP00256P40316Securin "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 110 8 16 9 KENNIVYTG 91.97
DP00256P40316Securin "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 110 59 65 7 NTLKYIQ 87.82
DP00256P40316Securin "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 110 96 102 7 SKSFIFP 87.63
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 167 3 17 15 LNVSFTNRNYDLDYD 86.67
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 167 19 34 16 VQPYFYCDEEENFYQQ 88.46
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 167 96 107 12 ADQLEMVTELLG 85.95
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 167 120 136 17 DDETFIKNIIIQDCMWS 89.83
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 167 148 154 7 KLASYQA 85.95
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 143 3 17 15 LNVSFTNRNYDLDYD 86.67
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 143 19 34 16 VQPYFYCDEEENFYQQ 88.46
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 143 96 107 12 ADQLEMVTELLG 85.95
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 143 120 136 17 DDETFIKNIIIQDCMWS 89.83
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 88 3 17 15 LNVSFTNRNYDLDYD 86.67
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 88 19 34 16 VQPYFYCDEEENFYQQ 88.46
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 405 416 12 GDTIISLDFGSN 91.97
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 442 450 9 KLQNINLAM 97.99
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 485 491 7 LELSFTM 85.95
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 518 524 7 EYCFYVD 96.66
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 536 543 8 VEKLFAED 86.62
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 530 698 536 543 8 VEKLFAED 86.62
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 530 698 633 641 9 EDIKILIAS 86.99
DP00269Q24298DE-cadherin (Protein shotgun) Drosophila melanogaster (Fruit fly) 1350 1507 1366 1374 9 RETIINYED 94.83
DP00269Q24298DE-cadherin (Protein shotgun) Drosophila melanogaster (Fruit fly) 1350 1507 1467 1478 12 GDLNFDYLSNFG 92.31
DP00278P08050Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein) Rattus norvegicus (Rat) 255 316 264 271 8 KYAYFNGC 97.32
DP00282Q04656Copper-transporting ATPase 1 (EC 7.2.2.8) (Copper pump 1) (Menkes disease-associated protein) Homo sapiens (Human) 1125 1176 1133 1143 11 NNWNIEDNNIK 91.7
DP00282Q04656Copper-transporting ATPase 1 (EC 7.2.2.8) (Copper pump 1) (Menkes disease-associated protein) Homo sapiens (Human) 1125 1176 1146 1171 26 SLVQIDASNEQSSTSSSMIIDAQISN 87.29
DP00284P16009Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C Enterobacteria phage T4 (Bacteriophage T4) 129 179 136 155 20 GEVGYDSSSNVIQDSNLDTA 85.89
DP00285P10388Glutenin; high molecular weight subunit DX5 Triticum aestivum (Wheat) 147 440 270 276 7 GQQGYYP 91.3
DP00285P10388Glutenin; high molecular weight subunit DX5 Triticum aestivum (Wheat) 147 440 300 306 7 GQSGYYP 86.62
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 72 80 9 SQVIFCNRS 98.33
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 85 92 8 LPVWLNFD 88.29
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 114 120 7 GHLWLFR 95.37
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 132 140 9 QTELFVPSL 91.97
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 144 158 15 GQPIFANITLPVYTL 94.58
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 67 117 72 80 9 SQVIFCNRS 98.33
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 67 117 85 92 8 LPVWLNFD 88.29
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 73 24 30 7 EEVEITR 90.64
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 73 52 61 10 LDAEFASLFD 90.77
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 58 24 30 7 EEVEITR 90.64
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 57 24 30 7 EEVEITR 90.64
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 41 73 52 61 10 LDAEFASLFD 90.77
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 51 73 52 61 10 LDAEFASLFD 90.77
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 52 73 52 61 10 LDAEFASLFD 90.77
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 113 124 12 TFKLIYSQFFPQ 87.54
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 129 139 11 TYAHFLFNAFD 94.31
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 144 159 16 GAIHFEDFVVGLSILL 87.17
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 167 177 11 LKWAFNLYDIN 89.78
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 186 196 11 EMLAIMKSIYD 87.41
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 228 239 12 GVVTIDEFLETC 96.99
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 241 251 11 KDENIMNSMQL 91.52
DP00303P02185Myoglobin Physeter macrocephalus (Sperm whale) (Physeter catodon) 1 153 27 35 9 QDILIRLFK 87.51
DP00303P02185Myoglobin Physeter macrocephalus (Sperm whale) (Physeter catodon) 1 153 67 77 11 VTVLTALGAIL 89.84
DP00303P02185Myoglobin Physeter macrocephalus (Sperm whale) (Physeter catodon) 1 153 103 117 15 KYLEFISEAIIHVLH 86.22
DP00306Q07108Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69) Homo sapiens (Human) 1 84 46 67 22 MNVVFITILIIALIALSVGQYN 91.32
DP00306Q07108Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69) Homo sapiens (Human) 1 84 70 76 7 GQYTFSM 96.32
DP00325P01099Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1) Oryctolagus cuniculus (Rabbit) 1 166 38 44 7 TLVLTSD 90.64
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 1 15 15 MKVLILACLVALALA 91.97
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 44 58 15 KIEKFQSEEQQQTED 86.62
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 154 160 7 LLQSWMH 86.62
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 201 210 10 PIQAFLLYQE 95.52
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 25 1 15 15 MKVLILACLVALALA 91.97
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 2 19 18 KTALILLSILGMACAFSM 89.17
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 35 54 20 GVFKYRPRYYLYKHAYFYPH 91.24
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 126 132 7 GLAAIQL 91.97
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 255 282 28 TTVEYEGEYEYTGANEYDNGYEIYESEN 93.41
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 289 306 18 NYRAYEDEYSYFKGQGYD 88.39
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 258 317 261 282 22 GEYEYTGANEYDNGYEIYESEN 93.8
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 258 317 289 306 18 NYRAYEDEYSYFKGQGYD 88.39
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 19 40 22 PAVYFKEQFLDGDGWTSRWIES 87.63
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 45 58 14 DFGKFVLSSGKFYG 89.32
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 71 85 15 DARFYALSASFEPFS 86.96
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 91 97 7 LVVQFTV 87.1
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 108 114 7 GYVKLFP 86.29
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 124 133 10 GDSEYNIMFG 94.45
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 144 158 15 VHVIFNYKGKNVLIN 98.19
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 168 175 8 FTHLYTLI 90.93
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 302 348 47 DPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWG 88.68
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 19 40 22 PAVYFKEQFLDGDGWTSRWIES 87.63
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 45 58 14 DFGKFVLSSGKFYG 89.32
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 71 85 15 DARFYALSASFEPFS 86.96
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 91 97 7 LVVQFTV 87.1
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 108 114 7 GYVKLFP 86.29
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 124 133 10 GDSEYNIMFG 94.45
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 144 158 15 VHVIFNYKGKNVLIN 98.19
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 168 175 8 FTHLYTLI 90.93
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 308 417 326 348 23 IFDNFLITNDEAYAEEFGNETWG 89.82
DP00334Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 1 24 12 19 8 GAVTTSQI 86.62
DP00334Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 210 304 245 254 10 FSVEFEVESL 86.96
DP00334Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 210 304 272 283 12 DDEVYQVTVYQA 86.62
DP00340P62965Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) Mus musculus (Mouse) 1 137 48 59 12 GDQFYIKTSTTV 97.32
DP00340P62965Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) Mus musculus (Mouse) 1 137 116 124 9 NDELILTFG 93.42
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 1 133 26 32 7 QQQSYLD 86.57
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 1 133 60 76 17 SQVLYEWEQGFSQSFTQ 98.33
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 17 48 26 32 7 QQQSYLD 86.57
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 664 781 688 694 7 MAWNETA 85.62
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 672 781 688 694 7 MAWNETA 85.62
DP00345P16535Leukotoxin (Lkt) Mannheimia haemolytica (Pasteurella haemolytica) 884 953 896 904 9 VVDNYELLK 85.95
DP00345P16535Leukotoxin (Lkt) Mannheimia haemolytica (Pasteurella haemolytica) 884 953 913 927 15 LDKLISSVSAFTSSN 87.49
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2059 2118 2086 2094 9 QVLNILKSN 96.32
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2059 2118 2097 2104 8 LMAAFIKQ 87.5
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2059 2117 2086 2094 9 QVLNILKSN 96.32
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2059 2117 2097 2104 8 LMAAFIKQ 87.5
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2113 2152 2139 2147 9 SLQNLNAMQ 86.62
DP00349P06709Bifunctional ligase/repressor BirA (Biotin operon repressor) (Biotin--acetyl-CoA-carboxylase ligase) (EC 6.3.4.15) (Biotin--protein ligase) (Biotin-acetyl-CoA carboxylase synthetase) Escherichia coli (strain K12) 212 234 220 229 10 NQGWITLQEA 88.03
DP00351Q27974Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) Bos taurus (Bovine) 547 813 595 604 10 SFLNTASASS 86.96
DP00351Q27974Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) Bos taurus (Bovine) 547 813 723 732 10 GGYNWQQTQS 85.95
DP00351Q27974Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) Bos taurus (Bovine) 547 813 749 756 8 YNVSFSSM 88.29
DP00352O33599Glycyl-glycine endopeptidase LytM (EC 3.4.24.75) (Autolysin LytM) Staphylococcus aureus (strain NCTC 8325 / PS 47) 147 182 150 157 8 NNQAYNSH 95.65
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 90 17 52 36 RQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSS 93.11
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 90 73 81 9 NENNIKNTL 89.97
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 89 17 52 36 RQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSS 93.11
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 89 73 81 9 NENNIKNTL 89.97
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 273 294 278 284 7 NAAAYSA 92.64
DP00356Q99967Cbp/p300-interacting transactivator 2 (MSG-related protein 1) (MRG-1) (P35srj) Homo sapiens (Human) 220 269 249 258 10 GQNEFDFMTD 86.62
DP00359A6Q0K5Calvin cycle protein CP12; chloroplastic (CP12 domain-containing protein) (Chloroplast protein 12) Chlamydomonas reinhardtii (Chlamydomonas smithii) 1 50 5 11 7 KSVVISR 87.96
DP00365P53041Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) Homo sapiens (Human) 19 147 44 58 15 YENAIKFYSQAIELN 88.47
DP00365P53041Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) Homo sapiens (Human) 19 147 60 83 24 SNAIYYGNRSLAYLRTECYGYALG 89.52
DP00372Q9NR00Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) Homo sapiens (Human) 1 106 7 16 10 HQAVIMSTSL 91.97
DP00372Q9NR00Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) Homo sapiens (Human) 1 106 35 56 22 AVGNIFENTDQESLERLFRNSG 90.26
DP00372Q9NR00Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) Homo sapiens (Human) 1 106 63 77 15 RAKIIFAIDQDVEEK 96.3
DP00372Q9NR00Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) Homo sapiens (Human) 1 106 91 101 11 KLFQFLKLRKY 87.96
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 153 215 172 178 7 QYQVIPQ 86.96
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 153 215 185 193 9 QQLQFAATG 87.29
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 153 215 202 208 7 GQIQIIP 93.55
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 342 488 366 375 10 DALNIQQNQT 91.97
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 342 488 395 402 8 QQQQILIQ 94.86
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 342 488 421 442 22 SGQTFTTQAISQETLQNLQLQA 89.68
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 342 488 460 476 17 GQVSWQTLQLQNLQVQN 90.3
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 366 375 10 DALNIQQNQT 91.97
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 395 402 8 QQQQILIQ 94.86
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 421 442 22 SGQTFTTQAISQETLQNLQLQA 89.68
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 460 476 17 GQVSWQTLQLQNLQVQN 90.3
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 478 485 8 QAQTITLA 91.97
DP00381P35869Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) Homo sapiens (Human) 545 713 650 663 14 MFENWNSNQFVPFN 92.98
DP00381P35869Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) Homo sapiens (Human) 545 713 671 688 18 QYNVFTDLHGISQEFPYK 89.3
DP00381P35869Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) Homo sapiens (Human) 545 713 696 704 9 YTQNFISCN 96.73
DP00387P25814Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) Bacillus subtilis (strain 168) 1 116 27 34 8 QFVLYTLD 88.17
DP00387P25814Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) Bacillus subtilis (strain 168) 1 116 78 84 7 KDYIIIA 96.8
DP00387P25814Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) Bacillus subtilis (strain 168) 1 116 100 111 12 LQHLFRKSSLYK 85.62
DP00389P09983Hemolysin; chromosomal Escherichia coli 962 1023 962 994 33 DALAYGSQGNLNPLINEISKIISAAGNFDVKEE 89.45
DP00389P09983Hemolysin; chromosomal Escherichia coli 962 1023 1008 1018 11 SDFSYGRNSIT 90.3
DP00396O74718Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF3) (ERF2) (Polypeptide release factor 3) (Translation release factor 3) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 280 307 282 296 15 KESWYLSWALDSTSE 88.16
DP00398P07342Acetolactate synthase catalytic subunit; mitochondrial (EC 2.2.1.6) (Acetohydroxy-acid synthase catalytic subunit) (AHAS) (ALS) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 647 687 661 668 8 LDEFINFD 94.57
DP00399P50097"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) 102 221 118 124 7 DVLAISQ 90.97
DP00399P50097"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) 102 221 205 213 9 HLRYIVFRK 91.97
DP00410P12497Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-) Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) 108 143 128 138 11 VSQNYPIVQNL 86.96
DP00410P12497Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-) Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) 123 143 128 138 11 VSQNYPIVQNL 86.96
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 30 38 9 LNVAWLESS 87.51
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 46 54 9 SAATYYPFV 87.77
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 60 77 18 TEQKIYTEDMAFGASTFP 86.88
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 100 106 7 TQNVYSV 87.86
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 109 115 7 SQYLYNQ 98.66
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 164 173 10 ADGTISSEIK 90.97
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 180 189 10 HLSIYAENSL 97.99
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 262 275 14 AAVLSKGEIVVKNN 85.28
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 319 332 14 VTSMINLKTIASSA 86.74
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 584 590 7 MDELIST 94.65
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 776 854 819 825 7 HYIEIWK 87.72
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 776 854 827 833 7 HLEAYSG 92.98
DP00421P07516Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein) Bos taurus (Bovine) 1 202 81 97 17 AVQRIAESHLQSISNLG 87.72
DP00422P0A6R3DNA-binding protein Fis (Factor-for-inversion stimulation protein) (Hin recombinational enhancer-binding protein) Escherichia coli (strain K12) 1 23 8 18 11 SDVLTVSTVNS 89.3
DP00423P53551Histone H1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 166 252 216 229 14 TSSNFDYLFNSAIK 89.87
DP00423P53551Histone H1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 171 258 216 229 14 TSSNFDYLFNSAIK 89.87
DP00427P0AFG8Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1) Escherichia coli (strain K12) 1 55 17 26 10 WLQAIESVIR 92.64
DP00427P0AFG8Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1) Escherichia coli (strain K12) 1 55 33 44 12 AQYLIDQLLAEA 89.63
DP00435Q01853Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Mus musculus (Mouse) 736 806 754 763 10 KYEMFAQTLQ 86.29
DP00435Q01853Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Mus musculus (Mouse) 736 806 792 799 8 GGSVYTED 86.96
DP00436P50477Canavalin Canavalia ensiformis (Jack bean) (Dolichos ensiformis) 1 45 14 28 15 GVVLLASVSASFAHS 91.64
DP00437P43351DNA repair protein RAD52 homolog Homo sapiens (Human) 1 23 4 10 7 TEEAILG 89.97
DP00438Q05158Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2) Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) 82 117 106 112 7 NTSKFAQ 85.91
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 37 46 10 KDSIISVNST 95.32
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 105 124 20 TIETFDNNEEESSYSYEEIN 91.74
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 141 157 17 KLSEILGMLHTLVVASA 87.23
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 118 37 46 10 KDSIISVNST 95.32
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 118 105 113 9 TIETFDNNE 91.64
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 102 37 46 10 KDSIISVNST 95.32
DP00461P08083Colicin-N Escherichia coli 1 90 60 67 8 GSYHITFH 85.95
DP00461P08083Colicin-N Escherichia coli 2 90 60 67 8 GSYHITFH 85.95
DP00461P08083Colicin-N Escherichia coli 40 76 60 67 8 GSYHITFH 85.95
DP00462P11157Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit) Mus musculus (Mouse) 353 390 359 365 7 KTNFFEK 86.96
DP00463Q9Z0U4Gamma-aminobutyric acid type B receptor subunit 1 (GABA-B receptor 1) (GABA-B-R1) (GABA-BR1) (GABABR1) (Gb1) Rattus norvegicus (Rat) 17 98 49 65 17 QVKAINFLPVDYEIEYV 91.32
DP00468P25963NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) Homo sapiens (Human) 1 66 38 54 17 KDEEYEQMVKELQEIRL 86.96
DP00468P25963NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) Homo sapiens (Human) 276 317 291 311 21 TESEFTEFTEDELPYDDCVFG 86.62
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 62 69 8 LVAEFLQD 87.29
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 118 125 8 WAQEFLAA 87.88
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 141 148 8 SQEFISEV 94.98
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 159 166 8 WAEEYLEQ 91.64
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 181 189 9 TDRWYDEYH 91.97
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 211 219 9 ANSEFLKFV 90.19
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 243 255 13 WAAEFIQQQGTSD 95.6
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 110 62 69 8 LVAEFLQD 87.29
DP00473Q49AN0Cryptochrome-2 Homo sapiens (Human) 490 593 503 522 20 MKQIYQQLSRYRGLCLLASV 87.69
DP00474Q43125Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2) Arabidopsis thaliana (Mouse-ear cress) 506 681 660 666 7 TTSSYLQ 85.28
DP00485Q9UBE0SUMO-activating enzyme subunit 1 (Ubiquitin-like 1-activating enzyme E1A) Cleaved into: SUMO-activating enzyme subunit 1; N-terminally processed Homo sapiens (Human) 289 311 290 299 10 DFVRYCFSEM 88.96
DP00488P49723Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 51 34 46 13 RFVMFPIKYHEIW 85.93
DP00491Q62165Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) Mus musculus (Mouse) 654 750 654 662 9 VVEWTNNTL 88.29
DP00491Q62165Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) Mus musculus (Mouse) 654 750 669 677 9 KEQIIGLSR 91.97
DP00491Q62165Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) Mus musculus (Mouse) 654 750 699 705 7 KALSIAV 87.29
DP00491Q62165Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) Mus musculus (Mouse) 654 750 713 719 7 HLQFIPV 91.64
DP00492P10275Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) Homo sapiens (Human) 142 485 355 368 14 EAAAYQSRDYYNFP 87.29
DP00492P10275Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) Homo sapiens (Human) 142 485 404 414 11 AQCRYGDLASL 86.29
DP00499Q9Z2F5C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) Rattus norvegicus (Rat) 306 430 364 372 9 NGAAYSRYP 87.63
DP00505P04234T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d) Homo sapiens (Human) 127 171 145 151 7 NDQVYQP 91.97
DP00518O54918Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) Mus musculus (Mouse) 1 113 73 79 7 SPLFIFV 94.94
DP00518O54918Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) Mus musculus (Mouse) 1 113 89 97 9 SSGYFSFDT 91.6
DP00518O54918Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) Mus musculus (Mouse) 85 113 89 97 9 SSGYFSFDT 91.6
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1362 1745 1487 1495 9 TLLHFATES 91.97
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1362 1745 1570 1582 13 DDIEILEECIISA 89.81
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1362 1745 1724 1731 8 LAECINSA 87.29
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1459 1532 1487 1495 9 TLLHFATES 91.97
DP00520Q969F2Protein naked cuticle homolog 2 (Naked-2) (hNkd2) Homo sapiens (Human) 1 217 23 32 10 SFVASAYASG 93.38
DP00520Q969F2Protein naked cuticle homolog 2 (Naked-2) (hNkd2) Homo sapiens (Human) 1 217 123 134 12 RQEWTFTLYDFD 92.67
DP00521O95997Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) Homo sapiens (Human) 1 202 1 8 8 MATLIYVD 97.37
DP00521O95997Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) Homo sapiens (Human) 1 202 113 121 9 EIEKFFPFN 87.74
DP00527P02783Seminal vesicle secretory protein 4 (Androgen-dependent protein) (ADP) (Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV) (SVS protein S) Rattus norvegicus (Rat) 1 70 3 21 19 STSLFLCSLLLLLVTGAIG 88.42
DP00530P12950Dehydrin DHN1 (M3) (RAB-17 protein) Zea mays (Maize) 1 168 139 146 8 TGGAYATG 86.62
DP00531Q08655Abscisic stress-ripening protein 1 Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 115 45 53 9 AAGAYALHE 92.98
DP00531Q08655Abscisic stress-ripening protein 1 Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 115 82 88 7 GGFAFHE 86.96
DP00531Q08655Abscisic stress-ripening protein 1 Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 61 115 82 88 7 GGFAFHE 86.96
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 309 321 13 SKELIVSEEIPIN 86.62
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 356 365 10 GRENFVYANN 88.36
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 386 392 7 SDEAIIP 87.63
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 463 469 7 IDFATLS 85.28
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 474 480 7 KYQIILD 88.53
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 525 540 16 ILSNFNADINLEESIR 96.99
DP00534Q9LZP9Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2) Arabidopsis thaliana (Mouse-ear cress) 1 131 6 20 15 TGLNIATQRVFVTSE 88.43
DP00537O43236Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2) Homo sapiens (Human) 1 119 33 41 9 ELSKFVKDF 86.96
DP00537O43236Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2) Homo sapiens (Human) 1 119 89 95 7 NQQYFCA 97.99
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 16 22 7 VDNAWSM 86.96
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 92 98 7 PYIIIKA 85.62
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 125 133 9 DIIKIGNLV 85.62
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 186 193 8 DIVLETMN 85.28
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 197 207 11 PIYNIKALMIK 85.28
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 265 274 10 ASGEYFLNQE 86.29
DP00541Q91V27Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) Mus musculus (Mouse) 147 403 391 397 7 LTSNISG 91.97
DP00543Q14061Cytochrome c oxidase copper chaperone Homo sapiens (Human) 1 63 34 40 7 DACIIEK 91.97
DP00543Q14061Cytochrome c oxidase copper chaperone Homo sapiens (Human) 25 63 34 40 7 DACIIEK 91.97
DP00543Q14061Cytochrome c oxidase copper chaperone Homo sapiens (Human) 25 60 34 40 7 DACIIEK 91.97
DP00546Q9NX55Huntingtin-interacting protein K (Huntingtin yeast partner K) Homo sapiens (Human) 1 129 94 105 12 DLELIMTEMEIS 94.98
DP00549O00488Zinc finger protein 593 (Zinc finger protein T86) Homo sapiens (Human) 36 77 65 72 8 ACARYFID 87.04
DP00550P02628Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3) Esox lucius (Northern pike) 1 108 19 32 14 AEGSFNHKKFFALV 88.39
DP00550P02628Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3) Esox lucius (Northern pike) 1 108 53 70 18 ASGFIEEEELKFVLKSFA 85.8
DP00551P16860Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29) Homo sapiens (Human) 1 77 10 24 15 ALLLLLFLHLAFLGG 90.81
DP00555Q16143Beta-synuclein Homo sapiens (Human) 1 134 35 41 7 EGVLYVG 97.32
DP00555Q16143Beta-synuclein Homo sapiens (Human) 1 134 73 82 10 GAGNIAAATG 92.98
DP00563Q61337Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) Mus musculus (Mouse) 1 204 40 50 11 AQSMFQIPEFE 88.96
DP00563Q61337Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) Mus musculus (Mouse) 1 204 183 192 10 WTRIIQSWWD 90.3
DP00564Q6P8Z1Protein B-Myc Mus musculus (Mouse) 2 169 63 69 7 HAGLYSP 92.98
DP00564Q6P8Z1Protein B-Myc Mus musculus (Mouse) 2 169 86 92 7 DSFSIAD 86.62
DP00564Q6P8Z1Protein B-Myc Mus musculus (Mouse) 2 169 111 133 23 DDETFVKNIILQDCMWNGFSASA 87.9
DP00566P13102Hemagglutinin Cleaved into: Hemagglutinin HA1 chain; Hemagglutinin HA2 chain Influenza A virus (strain A/Whale/Maine/328/1984 H13N2) 141 175 156 169 14 GTNSFYRNLVWFVK 93.07
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 174 361 174 183 10 ADQLLQMIRV 86.96
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 174 361 285 292 8 REAYFEKQ 86.96
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 194 361 285 292 8 REAYFEKQ 86.96
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 224 348 285 292 8 REAYFEKQ 86.96
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 262 361 285 292 8 REAYFEKQ 86.96
DP00584A2VD23Protein starmaker Danio rerio (Zebrafish) (Brachydanio rerio) 1 613 10 21 12 LILAFVGVSISA 92.06
DP00584A2VD23Protein starmaker Danio rerio (Zebrafish) (Brachydanio rerio) 1 613 42 49 8 FTVQFNVG 87.63
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 14 28 15 ALESIYPDSFTVLSE 91.01
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 52 61 10 LKFTYSEKYP 90.64
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 66 77 12 LYEIFSQENLED 96.99
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 96 120 25 GMVMIFTLVTAVQEKLNEIVDQIKT 90.19
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 144 166 23 TPVTIENFLSWKAKFDAELLEIK 94.93
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 183 194 12 GKQLFETDHNLD 86.62
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 211 219 9 DESLFQEMD 88.29
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1009 1015 7 HVQHIIG 91.26
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1121 1127 7 ALNLFSV 97.66
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1247 1253 7 GVDYYDN 88.29
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1257 1271 15 VENVIGTSMKDVLIG 90.9
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1273 1279 7 AQANTLM 86.96
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1460 1466 7 GDDWFFQ 96.27
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1499 1505 7 GVFLSLG 88.29
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1520 1528 9 VLRNIENAV 86.96
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1586 1605 20 GDDTYLFGVGYGHDTIYESG 87.49
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1617 1624 8 ADQLWFAR 97.78
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1627 1634 8 NDLEIRIL 86.62
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1651 1658 8 HRVEIIHA 85.62
DP00592P48539Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4) Homo sapiens (Human) 1 62 26 33 8 VQEEFDID 89.97
DP00592P48539Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4) Homo sapiens (Human) 1 62 42 54 13 AAVAIQSQFRKFQ 97.99
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 578 597 20 GGYNYHGHFNAINASANLSP 94.13
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 601 610 10 ASSLYEYNGV 93.85
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 612 618 7 AADNFYG 95.08
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 624 634 11 QQQSYQQHNYN 93.98
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 695 702 8 KLAKITLN 85.28
DP00605Q24246Cytoplasmic dynein 1 intermediate chain (DH IC) (Dynein intermediate chain; cytosolic) (Protein short wing) Drosophila melanogaster (Fruit fly) 109 135 109 121 13 NLSVYNVQATNIP 89.53
DP00607Q16595Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN) Homo sapiens (Human) 42 86 62 77 16 LNQIWNVKKQSVYLMN 89.78
DP00608Q13573SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) Homo sapiens (Human) 59 129 84 90 7 NALAIQV 92.98
DP00608Q13573SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) Homo sapiens (Human) 59 129 109 117 9 DKVIYSKYT 89.97
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 210 216 7 SDNVIEE 85.95
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 269 277 9 VANKFDQIG 86.62
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 519 535 17 LTAAYDGNFELAVKEIS 88.06
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 636 644 9 TEEMIFGSS 85.95
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 666 674 9 DEANISNNM 88.29
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 163 374 210 216 7 SDNVIEE 85.95
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 163 374 269 277 9 VANKFDQIG 86.62
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 408 627 519 535 17 LTAAYDGNFELAVKEIS 88.06
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 666 674 9 DEANISNNM 88.29
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 722 728 7 GNFTITS 94.31
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 759 781 23 NRSNIFSNSNVTMADETEINLSE 87.01
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 814 824 11 AQVLYRLALLA 98.66
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 828 834 7 AGQLFSL 87.15
DP00610Q9SLF3Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) Arabidopsis thaliana (Mouse-ear cress) 1 455 48 56 9 FEEAIGSEN 86.96
DP00610Q9SLF3Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) Arabidopsis thaliana (Mouse-ear cress) 1 455 123 132 10 GEAEFDVLAT 85.28
DP00610Q9SLF3Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) Arabidopsis thaliana (Mouse-ear cress) 1 455 306 318 13 TGAAYTSNIVTNA 92.28
DP00611P30291Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) Homo sapiens (Human) 1 292 22 29 8 RQKLIFSP 87.29
DP00611P30291Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) Homo sapiens (Human) 1 292 129 139 11 AAPYFLGSSFS 86.96
DP00611P30291Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) Homo sapiens (Human) 1 292 231 239 9 PQVNINPFT 97.32
DP00613Q22472Resistance to inhibitors of cholinesterase protein 3 Caenorhabditis elegans 1 378 45 58 14 VFGVIVVCFAMLYP 89.11
DP00613Q22472Resistance to inhibitors of cholinesterase protein 3 Caenorhabditis elegans 1 378 125 147 23 GMFTWMLPVYTIGVVLFLLYTLF 91.1
DP00613Q22472Resistance to inhibitors of cholinesterase protein 3 Caenorhabditis elegans 1 378 199 210 12 AMSKILEQLESV 87.29
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2213 2308 2224 2235 12 ADLIEANLLWRQ 85.95
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2213 2308 2237 2243 7 MGGNITR 86.62
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2213 2308 2248 2257 10 NKVVILDSFE 87.29
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2218 2314 2224 2235 12 ADLIEANLLWRQ 85.95
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2218 2314 2237 2243 7 MGGNITR 86.62
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2218 2314 2248 2257 10 NKVVILDSFE 87.29
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2221 2314 2224 2235 12 ADLIEANLLWRQ 85.95
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2221 2314 2237 2243 7 MGGNITR 86.62
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2221 2314 2248 2257 10 NKVVILDSFE 87.29
DP00621P00736Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain Homo sapiens (Human) 193 305 194 211 18 SSELYTEASGYISSLEYP 89.67
DP00621P00736Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain Homo sapiens (Human) 193 305 218 226 9 LRCNYSIRV 87.29
DP00621P00736Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain Homo sapiens (Human) 193 305 253 267 15 DQLQIYANGKNIGEF 93.87
DP00621P00736Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain Homo sapiens (Human) 193 305 283 291 9 VDLLFFTDE 89.22
DP00623P83949Homeotic protein ultrabithorax Drosophila melanogaster (Fruit fly) 1 174 1 13 13 MNSYFEQASGFYG 87.86
DP00623P83949Homeotic protein ultrabithorax Drosophila melanogaster (Fruit fly) 1 174 66 79 14 YDASITAACNKIYG 88.63
DP00625P45976Pre-mRNA polyadenylation factor FIP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 80 195 80 88 9 DLEVIISLG 96.99
DP00625P45976Pre-mRNA polyadenylation factor FIP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 80 195 111 125 15 KDVISVATDVSNTIT 87.76
DP00625P45976Pre-mRNA polyadenylation factor FIP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 80 195 168 181 14 KEGIFDSVGITTID 87.29
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 11 19 9 EIVTFPLFS 87.96
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 49 67 19 SATYFVKASGDSMIDGGIS 88.21
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 69 80 12 GDLLIVDSAITA 94.48
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 83 96 14 GDIVIAAVDGEFTV 88.63
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 104 120 17 TVQLIPMNSAYSPITIS 89.59
DP00628P15309"Prostatic acid phosphatase (PAP) (EC 3.1.3.2) (5-nucleotidase) (5-NT) (EC 3.1.3.5) (Acid phosphatase 3) (Ecto-5-nucleotidase) (Protein tyrosine phosphatase ACP3) (EC 3.1.3.48) (Thiamine monophosphatase) (TMPase) Cleaved into: PAPf39" Homo sapiens (Human) 248 286 262 271 10 VLVNEILNHM 91.1
DP00630O76070Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR) Homo sapiens (Human) 1 127 6 12 7 KGFSIAK 87.29
DP00630O76070Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR) Homo sapiens (Human) 1 127 84 93 10 EAENIAVTSG 91.97
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 284 90 97 8 TLFQFESH 85.54
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 284 177 190 14 KVITFELAKNWNNN 87.29
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 284 205 212 8 EDIIINPV 96.99
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 284 245 254 10 EDVITYVNKK 91.54
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 31 190 90 97 8 TLFQFESH 85.54
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 31 190 177 185 9 KVITFELAK 87.29
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 14 23 10 AQQGYSAYTA 93.14
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 32 45 14 TTQAYGQQSYGTYG 88.51
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 48 71 24 TDVSYTQAQTTATYGQTAYATSYG 91.35
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 82 88 7 APQAYSQ 87.29
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 94 119 26 GTGAYDTTTATVTTTQASYAAQSAYG 89.86
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 166 173 8 GQSNYSYP 97.99
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 204 215 12 DQSSYSQQNTYG 89.88
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 222 233 12 QQSSYGQQSSYG 87.29
DP00633Q09472Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) Homo sapiens (Human) 401 566 533 541 9 LHSAINSQN 90.97
DP00636P17120Kinesin-like protein bimC Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) 1 71 44 50 7 KTAAISR 86.29
DP00640Q89933Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) 400 525 415 427 13 AQVSFLHGDQSEN 97.32
DP00640Q89933Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) 401 525 415 427 13 AQVSFLHGDQSEN 97.32
DP00640Q89933Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) 401 486 415 427 13 AQVSFLHGDQSEN 97.32
DP00641P51671Eotaxin (C-C motif chemokine 11) (Eosinophil chemotactic protein) (Small-inducible cytokine A11) Homo sapiens (Human) 1 31 5 19 15 AALLWLLLIAAAFSP 91.97
DP00644P22362C-C motif chemokine 1 (Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309) Homo sapiens (Human) 1 23 1 14 14 MQIITTALVCLLLA 86.96
DP00645Q91ZE9Bcl-2-modifying factor Mus musculus (Mouse) 1 185 46 52 7 RLQLFPL 87.29
DP00645Q91ZE9Bcl-2-modifying factor Mus musculus (Mouse) 1 185 93 99 7 QRLFYGN 85.95
DP00645Q91ZE9Bcl-2-modifying factor Mus musculus (Mouse) 1 185 137 148 12 KLQCIADQFHRL 86.96
DP00645Q91ZE9Bcl-2-modifying factor Mus musculus (Mouse) 1 185 161 176 16 WWQVFLFLQNLALNRQ 87.58
DP00654Q9ZPI5Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 (AtMPF2) Includes: Enoyl-CoA hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase (EC 4.2.1.17) (EC 5.1.2.3) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) Arabidopsis thaliana (Mouse-ear cress) 576 596 583 590 8 KGFYLYDD 96.78
DP00657P31168Dehydrin COR47 (Cold-induced COR47 protein) Arabidopsis thaliana (Mouse-ear cress) 1 265 33 39 7 GLFDFLG 86.96
DP00659P16458Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit) Sterkiella nova (Ciliate) (Oxytricha nova) 233 385 336 345 10 QFVKYLDWHE 97.99
DP00661Q9CX60Protein LBH (Limb bud and heart-expressed protein) Mus musculus (Mouse) 1 105 1 13 13 MSVYFPIHCSDYL 90.64
DP00662Q8LBP4Inner membrane protein ALBINO3; chloroplastic Arabidopsis thaliana (Mouse-ear cress) 339 462 347 353 7 AQQVYLR 88.44
DP00662Q8LBP4Inner membrane protein ALBINO3; chloroplastic Arabidopsis thaliana (Mouse-ear cress) 339 462 365 371 7 NASKIIS 85.57
DP00663P81558Myelin basic protein (MBP) Sus scrofa (Pig) 1 171 85 94 10 PVVHFFKNIV 90.1
DP00663P81558Myelin basic protein (MBP) Sus scrofa (Pig) 1 171 150 158 9 TLSKIFKLG 90.97
DP00664Q0141718 kDa seed maturation protein Glycine max (Soybean) (Glycine hispida) 1 173 14 22 9 TATNIGASA 85.95
DP00664Q0141718 kDa seed maturation protein Glycine max (Soybean) (Glycine hispida) 1 173 98 109 12 GTATYSTTGEYG 88.29
DP00666P32004Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171) Homo sapiens (Human) 1144 1257 1169 1177 9 KDETFGEYR 85.73
DP00666P32004Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171) Homo sapiens (Human) 1144 1257 1215 1231 17 VDVQFNEDGSFIGQYSG 87.84
DP00667P42763Dehydrin ERD14 Arabidopsis thaliana (Mouse-ear cress) 1 185 29 35 7 GLFDFLG 86.96
DP00667P42763Dehydrin ERD14 Arabidopsis thaliana (Mouse-ear cress) 1 185 48 59 12 IASEFEQKVHIS 86.12
DP00672Q92886Neurogenin-1 (NGN-1) (Class A basic helix-loop-helix protein 6) (bHLHa6) (Neurogenic basic-helix-loop-helix protein) (Neurogenic differentiation factor 3) (NeuroD3) Homo sapiens (Human) 90 150 134 145 12 LRFAYNYIWALA 92.73
DP00673P06935Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) West Nile virus (WNV) 2 105 49 60 12 ALLAFFRFTAIA 89.13
DP00674Q69422Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Hepatitis GB virus B (GBV-B) (GB virus B) 2 155 129 150 22 DGVNWATGWFGVHLFVVCLLSL 90.99
DP00675P19711Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) 169 270 253 265 13 ALLAWAIIAIVLF 96.78
DP00677P1281016.9 kDa class I heat shock protein 1 (HSP 16.9) (Heat shock protein 16.9A) (Heat shock protein 17) (Low molecular weight heat shock protein) Triticum aestivum (Wheat) 1 42 23 32 10 TFRSIVPAIS 86.29
DP00678P11171Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1) Homo sapiens (Human) 800 864 819 829 11 RIVITGDADID 86.62
DP00683Q99801Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) Homo sapiens (Human) 1 184 27 35 9 TSFLIQDIL 96.32
DP00683Q99801Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) Homo sapiens (Human) 1 184 98 105 8 HLGSYLLD 86.62
DP00683Q99801Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) Homo sapiens (Human) 1 184 133 151 19 HTQVIELERKFSHQKYLSA 90.05
DP00683Q99801Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) Homo sapiens (Human) 1 184 166 174 9 TQVKIWFQN 87.4
DP00689P30185Dehydrin Rab18 Arabidopsis thaliana (Mouse-ear cress) 1 186 20 29 10 IQQQYDEYGN 87.29
DP00693P45561Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP) Sus scrofa (Pig) 2 173 2 16 15 GTWILFACLLGAAFS 89.54
DP00693P45561Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP) Sus scrofa (Pig) 2 173 25 47 23 HPGYINFSYEVLTPLKWYQNMIR 87.87
DP00693P45561Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP) Sus scrofa (Pig) 2 173 63 69 7 HHQIIPV 87.29
DP00694Q8N488RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) Homo sapiens (Human) 1 228 166 172 7 VTVIITD 97.99
DP00694Q8N488RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) Homo sapiens (Human) 145 179 166 172 7 VTVIITD 97.99
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 9 19 11 DGLNIIDFIQK 89.81
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 112 118 7 TDVVYHD 89.97
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 155 164 10 KMLSYAPEIA 86.62
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 208 214 7 IAEHYYG 90.68
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 234 241 8 SIKLYTSD 87.96
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 245 255 11 ADQLEFEDEFA 87.23
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 328 334 7 LAEEFEC 86.62
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 364 373 10 YHWSIERSIS 87.29
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 100 9 19 11 DGLNIIDFIQK 89.81
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 10 19 10 GLDIIDFIQK 87.16
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 112 118 7 TDVVYHD 89.97
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 208 214 7 IPEYYYG 87.05
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 234 241 8 SIKIYTSD 89.3
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 246 255 10 NQLEYEDEFA 93.31
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 259 265 7 SEVVIDT 90.97
DP00702P46937Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog) Homo sapiens (Human) 50 171 65 73 9 LEALFNAVM 95.65
DP00705P2294312 kDa heat shock protein (Glucose and lipid-regulated protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 109 29 35 7 GKEYITD 87.29
DP00705P2294312 kDa heat shock protein (Glucose and lipid-regulated protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 109 91 97 7 DAVEYVS 96.32
DP00706Q15517Corneodesmosin (S protein) Homo sapiens (Human) 60 171 64 70 7 GFSSYSG 92.64
DP00706Q15517Corneodesmosin (S protein) Homo sapiens (Human) 60 171 113 119 7 SQVSYSS 95.65
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 161 243 194 203 10 LLALYVAEIR 97.99
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 347 420 372 380 9 LDEVISKYA 91.19
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 495 740 499 506 8 SLQISNEK 86.96
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 495 740 563 573 11 VSQLFELEIEA 87.56
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 566 739 567 573 7 FELEIEA 86.96
DP00708O35613Death domain-associated protein 6 (Daxx) Mus musculus (Mouse) 566 739 605 613 9 AAVVTSTSV 85.28
DP00709Q9Y3M2Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1) Homo sapiens (Human) 1 63 36 42 7 LGLEYGS 85.62
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 9 111 21 31 11 LSANISQEMTM 87.96
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 9 111 69 75 7 DFSSIST 87.29
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 9 111 91 106 16 ADYKYDLKLQEYQSAI 91.66
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 112 174 119 125 7 KTQLYNK 96.99
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 112 174 147 153 7 SGFHYGV 87.29
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 238 278 247 255 9 YDSYIKSFP 92.31
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 453 477 456 464 9 SSQLFAKLL 90.64
DP00719Q13569G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) Homo sapiens (Human) 1 50 5 27 23 NAGSYSLQQAQAFYTFPFQQLMA 90.45
DP00719Q13569G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) Homo sapiens (Human) 340 410 371 379 9 GESAFSGIP 90.64
DP00720Q05344FACT complex subunit Ssrp1 (Chorion-factor 5) (Facilitates chromatin transcription complex subunit Ssrp1) (Recombination signal sequence recognition protein) (Single-strand recognition protein) (dSSRP1) Drosophila melanogaster (Fruit fly) 625 723 659 665 7 SKEYISD 85.28
DP00721Q8IRG6FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16) Drosophila melanogaster (Fruit fly) 889 1044 907 916 10 NWQKIMKTIT 87.29
DP00724Q9LQT8DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2) Arabidopsis thaliana (Mouse-ear cress) 11 113 71 86 16 ETVHYNPAELYTWLDS 88.25
DP00725P41851Type II secretion system protein M (T2SS protein M) (Cholera toxin secretion protein EpsM) (General secretion pathway protein M) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 44 85 59 66 8 QLLSWVSE 85.28
DP00728P00760Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2 Bos taurus (Bovine) 68 89 74 84 11 GEDNINVVEGN 88.42
DP00742Q99LM3Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM) Mus musculus (Mouse) 1 341 69 75 7 GEASILD 85.95
DP00749Q9TY14Apical membrane antigen 1 (Fragment) Plasmodium vivax 413 445 420 434 15 NQVVIKEEFRNYYEN 90.86
DP00752E6PBU940S ribosomal protein rpS31e Tetrahymena thermophila 1 71 34 40 7 MGFEIDM 88.29
DP00752E6PBU940S ribosomal protein rpS31e Tetrahymena thermophila 1 71 45 52 8 NNGFIAPN 88.29
DP00752E6PBU940S ribosomal protein rpS31e Tetrahymena thermophila 1 71 58 66 9 DDVTYYLSL 89.3
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 1 81 12 24 13 EQQEYKEAFQLFD 92.38
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 1 81 68 76 9 DQETFLTIM 92.6
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 82 150 91 97 7 KAFEIFD 97.75
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 82 150 100 108 9 KNGYISASE 87.29
DP00756Q04884Opacity protein opA60 (Fragment) Neisseria gonorrhoeae 75 114 78 92 15 NNNKYSVNIENVRIR 92.35
DP00756Q04884Opacity protein opA60 (Fragment) Neisseria gonorrhoeae 145 188 167 175 9 GAVTTYNTD 91.45
DP00768Q28181Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) Bos taurus (Bovine) 272 590 288 296 9 DVQTISILP 90.97
DP00771P20435DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 71 4 30 27 YEEAFNDGNENFEDFDVEHFSDEETYE 88.13
DP00774P40719Sensor protein QseC (EC 2.7.13.3) Escherichia coli (strain K12) 35 158 84 94 11 DALTFAIFTHD 96.02
DP00774P40719Sensor protein QseC (EC 2.7.13.3) Escherichia coli (strain K12) 35 158 146 152 7 GQEWEYR 90.16
DP00775P15311Ezrin (Cytovillin) (Villin-2) (p81) Homo sapiens (Human) 130 150 130 138 9 VQAKFGDYN 86.62
DP00775P15311Ezrin (Cytovillin) (Villin-2) (p81) Homo sapiens (Human) 298 515 420 434 15 ELAEYTAKIALLEEA 85.4
DP00778P46670Tubulin-specific chaperone C (Chromosome instability protein 2) (Tubulin-folding cofactor C) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 220 245 226 235 10 DHLIIQDFSN 88.96
DP00787B2LME8Alginase Pseudoalteromonas sp. SM0524 32 155 42 49 8 GFSNWNET 96.99
DP00787B2LME8Alginase Pseudoalteromonas sp. SM0524 32 155 87 95 9 TLSAYVLGK 96.32
DP00787B2LME8Alginase Pseudoalteromonas sp. SM0524 32 155 108 119 12 KNQTFNVSSWTK 89.97
DP00787B2LME8Alginase Pseudoalteromonas sp. SM0524 32 155 131 150 20 SLQVFAKHYNNTSDVRFDNF 91.34
DP00790P08245Uncharacterized protein YciH Escherichia coli (strain K12) 1 31 7 14 8 RLVYSTET 85.28
DP00791P9WHJ5RNA polymerase-binding protein RbpA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 26 12 18 7 GAVSYET 92.98
DP00791P9WHJ5RNA polymerase-binding protein RbpA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 25 12 18 7 GAVSYET 92.98
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 135 143 9 EAQVFMPIS 87.96
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 178 188 11 TTATFAATKFG 86.96
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 271 277 7 AKEFIFP 91.45
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 303 314 12 YSNAFDVFAAYG 89.97
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 323 340 18 DGLNFSLNNMQYSNQQFQ 86.55
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 345 178 188 11 TTATFAATKFG 86.96
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 345 271 277 7 AKEFIFP 91.45
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 345 303 314 12 YSNAFDVFAAYG 89.97
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 345 323 340 18 DGLNFSLNNMQYSNQQFQ 86.55
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 285 178 188 11 TTATFAATKFG 86.96
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 285 271 277 7 AKEFIFP 91.45
DP00796P15382Potassium voltage-gated channel subfamily E member 1 (Delayed rectifier potassium channel subunit IsK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel) Homo sapiens (Human) 107 129 111 117 7 NHLAIEQ 87.29
DP00797O15273Telethonin (Titin cap protein) Homo sapiens (Human) 91 167 113 122 10 LQELLALETA 86.96
DP00806A1B8N7ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) Paracoccus denitrificans (strain Pd 1222) 116 188 153 174 22 DESLIGGMIVKLGSQMIDSSIR 87.96
DP00808P24937Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 51 2 10 9 EDINFASLA 91.97
DP00808P24937Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 51 33 46 14 GAFSWGSLWSGIKN 86
DP00809P80870General stress protein 13 (GSP13) Bacillus subtilis (strain 168) 81 130 115 123 9 LEEWIEMSN 94.65
DP00815Q9DCL8Protein phosphatase inhibitor 2 (IPP-2) Mus musculus (Mouse) 1 206 49 58 10 DEMNILATYH 86.15
DP00815Q9DCL8Protein phosphatase inhibitor 2 (IPP-2) Mus musculus (Mouse) 1 206 158 164 7 ARQLISK 91.64
DP00816P41236Protein phosphatase inhibitor 2 (IPP-2) Homo sapiens (Human) 9 164 48 57 10 DEMNILATYH 86.15
DP00824Q9NJS1Salivary anti-thrombin peptide anophelin Anopheles albimanus (New world malaria mosquito) 23 83 55 71 17 DYAAIEASLSETFNTAA 87.29
DP00824Q9NJS1Salivary anti-thrombin peptide anophelin Anopheles albimanus (New world malaria mosquito) 54 83 55 71 17 DYAAIEASLSETFNTAA 87.29
DP00824Q9NJS1Salivary anti-thrombin peptide anophelin Anopheles albimanus (New world malaria mosquito) 56 83 63 71 9 LSETFNTAA 87.29
DP00833P22995Antitoxin ParD Escherichia coli 38 83 42 52 11 ADQAWQELKTM 88.29
DP00835Q03337Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 104 164 115 126 12 RASAFLSQNESS 87.29
DP00839Q16186Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog) Homo sapiens (Human) 253 285 266 275 10 DLQSILATMN 87.59
DP00840P46065Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A) Bos taurus (Bovine) 74 108 91 100 10 KLRWYFKLYD 91.81
DP00842P12506Protein Tat (Transactivating regulatory protein) Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) (HIV-1) 1 86 35 48 14 QVCFITKGLGISYG 92.98
DP00847P20220Protein F-112 Sulfolobus spindle-shape virus 1 (SSV1) 74 112 85 94 10 TQDNIAKIFD 86.96
DP00848Q49ZM2Putative secretory antigen Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) 1 49 14 22 9 IGAAIVGLD 87.29
DP00850P36932Integrase (EC 2.7.7.-) (EC 3.1.-.-) Escherichia phage P2 (Bacteriophage P2) 46 161 64 71 8 LTQIWWDL 93.69
DP00850P36932Integrase (EC 2.7.7.-) (EC 3.1.-.-) Escherichia phage P2 (Bacteriophage P2) 46 161 85 94 10 KIEIFTKITN 95.65
DP00850P36932Integrase (EC 2.7.7.-) (EC 3.1.-.-) Escherichia phage P2 (Bacteriophage P2) 46 161 98 113 16 AFQITKSLISQYCATR 86.98
DP00850P36932Integrase (EC 2.7.7.-) (EC 3.1.-.-) Escherichia phage P2 (Bacteriophage P2) 46 161 134 145 12 FTALIEAELFFG 90.61
DP00851Q9KX51PmoC Methylosinus trichosporium 177 256 179 195 17 FSLAFLIVAIGPFMIIP 96.68
DP00851Q9KX51PmoC Methylosinus trichosporium 177 256 204 241 38 HTFWFMEELFVAPLHWGFVFFGWMALGVFGVVLQILMG 89.76
DP00853P00127Cytochrome b-c1 complex subunit 6; mitochondrial (Complex III subunit 6) (Complex III subunit VI) (Cytochrome c1 non-heme 17 kDa protein) (Mitochondrial hinge protein) (Ubiquinol-cytochrome c oxidoreductase subunit 6) (Ubiquinol-cytochrome c reductase 17 kDa protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 72 6 18 13 LVGEYWEQLKITV 86.36
DP00863Q9X0Q3Transcriptional regulator; crp family Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) 130 201 134 140 7 KLMNFLV 88.29
DP00869F2Z293Chlorophyll a-b binding protein; chloroplastic Spinacia oleracea (Spinach) 1 87 53 68 16 LDQNLAKNLAGDIIGT 85.95
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 363 565 379 387 9 VARLFSLFG 93.31
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 363 565 414 420 7 ALQALME 86.62
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 363 565 514 520 7 GLQAWGQ 87.29
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 364 565 379 387 9 VARLFSLFG 93.31
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 364 565 414 420 7 ALQALME 86.62
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 364 565 514 520 7 GLQAWGQ 87.29
DP00871A4ZNR2Nuclear export protein (NEP) (Non-structural protein 2) (NS2) Influenza A virus (A/lvPR8/34(H1N1)) 1 121 72 83 12 KFEEIRWLIEEV 89.74
DP00871A4ZNR2Nuclear export protein (NEP) (Non-structural protein 2) (NS2) Influenza A virus (A/lvPR8/34(H1N1)) 1 121 94 116 23 FEQITFMQALHLLLEVEQEIRTF 91.74
DP00872P80428Actin-related protein 4 (Actin-like protein ARP4) (Actin-like protein 4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 199 226 203 211 9 IIPLFAIKQ 85.69
DP00873Q9H981Actin-related protein 8 (hArp8) (INO80 complex subunit N) Homo sapiens (Human) 401 507 420 429 10 HDEHYLLATQ 89.97
DP00874Q12406Actin-related protein 7 (Actin-like protein ARP7) (Chromatin structure-remodeling complex protein ARP7) (SWI/SNF complex component ARP7) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 353 379 359 367 9 GTSHINTNV 89.97
DP00875P69723Virion infectivity factor (Vif) (SOR protein) Cleaved into: p17; p7 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 141 192 144 156 13 SLQYLALAALITP 90.76
DP00876P14340Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5) Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2) 1 100 49 60 12 ALVAFLRFLTIP 90.13
DP00889P9WF19Putative antitoxin VapB5 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 45 24 30 7 EDVTITV 93.65
DP00892O31818UPF0291 protein YnzC Bacillus subtilis (strain 168) 41 77 50 56 7 KSVKIID 86.29
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 2 9 8 LDFFTIFS 92.43
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 12 19 8 GLVLWCFQ 93.06
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 29 39 11 VNALIRSVLLQ 85.28
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 60 84 25 NQFELVFVVGFQKILTLTYVDKLID 90.88
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 103 120 18 ALSLLNGTFDFQNDFLRL 88.63
DP00895P03421Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain A2) 1 102 37 50 14 KDSIISVNSIDIEV 95.32
DP00896P10121Signal recognition particle receptor FtsY (SRP receptor) Escherichia coli (strain K12) 1 187 8 15 8 GFFSWLGF 87.88
DP00896P10121Signal recognition particle receptor FtsY (SRP receptor) Escherichia coli (strain K12) 1 187 133 145 13 ETVEIVEAAEEEA 91.97
DP00898P13338RNA polymerase-associated protein Gp33 Enterobacteria phage T4 (Bacteriophage T4) 1 31 2 8 7 TQFSLND 86.62
DP00902O32728RNA polymerase sigma factor Geobacillus stearothermophilus (Bacillus stearothermophilus) 1 101 41 52 12 RLVWSVVQRFLN 89.97
DP00902O32728RNA polymerase sigma factor Geobacillus stearothermophilus (Bacillus stearothermophilus) 1 101 57 96 40 ADDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQ 88.98
DP00902O32728RNA polymerase sigma factor Geobacillus stearothermophilus (Bacillus stearothermophilus) 159 250 185 193 9 EASWFDKIA 92.64
DP00902O32728RNA polymerase sigma factor Geobacillus stearothermophilus (Bacillus stearothermophilus) 159 250 206 215 10 RLIVYLRYYR 87.22
DP00904Q58876Uncharacterized protein MJ1481 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 104 213 109 117 9 EGALYIVSN 97.06
DP00904Q58876Uncharacterized protein MJ1481 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 104 213 172 187 16 FIEKYKPEKIFVVVED 86.62
DP00904Q58876Uncharacterized protein MJ1481 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 104 213 190 208 19 DELLYLRAKNLYNAEKLDA 93.68
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 44 56 13 NLVPFMNFARITS 85.85
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 131 151 21 SLTTYAGYKALMQIQSWLEIR 86.65
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 155 163 9 EPVAIVGYP 86.85
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 241 250 10 GSIFIDVALP 89.3
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 262 268 7 DDILIID 95.7
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 285 307 23 LNVTIKQQLNGCMAETIVLALEN 90.05
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 322 330 9 KVLEIGEIA 86.96
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 334 348 15 GFFAYPLASYGERID 97.32
DP00918A0MHA3Patellamide protein uncultured Prochloron sp. 36 64 44 53 10 TACITFCAYD 93.68
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 1 72 20 36 17 YDVNISGLVSTTMQNEA 98.33
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 1 72 55 66 12 VARFIEMNGSFA 86.29
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 32 72 55 66 12 VARFIEMNGSFA 86.29
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 37 72 55 66 12 VARFIEMNGSFA 86.29
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 41 72 55 66 12 VARFIEMNGSFA 86.29
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 46 72 55 66 12 VARFIEMNGSFA 86.29
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 46 71 55 66 12 VARFIEMNGSFA 86.29
DP00929P04608Protein Tat (Transactivating regulatory protein) Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 1 86 35 48 14 QVCFITKALGISYG 92.98
DP00934P61925cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform) Homo sapiens (Human) 1 76 4 15 12 VETTYADFIASG 87.07
DP00937Q12972Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1) Homo sapiens (Human) 144 225 165 172 8 NLTEFNTA 87.21
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 332 186 197 12 TQQNTIQNEAAS 92.39
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 332 250 258 9 APANFASSS 86.62
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 290 186 197 12 TQQNTIQNEAAS 92.39
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 290 250 258 9 APANFASSS 86.62
DP00943O35274Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130) Rattus norvegicus (Rat) 417 494 456 466 11 IQVFSTYSNED 95.23
DP00944P1273650S ribosomal protein L32e (Hl5) Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) 1 94 10 19 10 AEEEYTELTD 90.64
DP00947O10609Protein E7 Human papillomavirus 45 1 41 7 16 10 TLQEIVLHLE 94.31
DP00947O10609Protein E7 Human papillomavirus 45 72 106 87 98 12 LQQLFLSTLSFV 88.07
DP00948P59595Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) Severe acute respiratory syndrome coronavirus (SARS-CoV) 182 247 219 226 8 ALALLLLD 86.62
DP00948P59595Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) Severe acute respiratory syndrome coronavirus (SARS-CoV) 343 402 348 364 17 KDNVILLNKHIDAYKTF 87.37
DP00949Q9HAU5Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) Homo sapiens (Human) 430 486 463 481 19 DARNFYENLIDLKAFVPAI 91.87
DP00949Q9HAU5Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) Homo sapiens (Human) 1167 1207 1181 1187 7 QQFKILN 96.66
DP00949Q9HAU5Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) Homo sapiens (Human) 1167 1207 1195 1202 8 AANHWNQQ 88.29
DP00951P17677Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46) Homo sapiens (Human) 1 238 205 211 7 AEENIEA 91.97
DP00957C0J347SBDS-like protein Trypanosoma cruzi 264 464 438 445 8 RNEYWNDA 85.28
DP00958P46984EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 123 62 76 15 SQLTYLGQLRTQLTG 95.65
DP00958P46984EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 123 80 87 8 DINEFLTG 87.04
DP00958P46984EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 123 105 115 11 IQEEINQLLDG 93.98
DP00958P46984EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 65 113 80 87 8 DINEFLTG 87.04
DP00959O15169Axin-1 (Axis inhibition protein 1) (hAxin) Homo sapiens (Human) 295 500 301 313 13 VNPYYVNAGYALA 85.28
DP00968Q60795Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2) Mus musculus (Mouse) 1 98 69 87 19 AFFAQFQLDEETGEFLPIQ 85.95
DP00970P0ABD8Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) Escherichia coli (strain K12) 1 77 19 25 7 SELEISE 87.29
DP00970P0ABD8Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) Escherichia coli (strain K12) 1 77 44 50 7 MQQAYAA 97.66
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 10 16 7 RSSWYWG 87.58
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 32 38 7 HGVFLVR 85.28
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 46 54 9 DYVLSVSEN 87.96
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 56 64 9 RVSHYIINS 92.31
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 99 110 12 ALLEFYKIHYLD 92.17
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 132 146 15 EEAEYVRALFDFNGN 89.1
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 166 172 7 EEQWWNA 91.97
DP00976P04578Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 127 196 157 165 9 CSFNISTSI 88.29
DP00976P04578Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 127 196 169 185 17 VQKEYAFFYKLDIIPID 87.9
DP00976P04578Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 297 331 316 324 9 AFVTIGKIG 98.33
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 34 41 8 WVTVYYGV 96.53
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 88 112 25 VTENFNMWKNNMVEQMHEDIISLWD 91.57
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 155 162 8 CSFNITTS 86.75
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 167 199 33 VQKEYALFYNLDVVPIDNASYRLISCNTSVITQ 87.56
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 217 230 14 AGFAILKCNDKKFN 96.32
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 253 260 8 TQLLLNGS 89.97
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 262 275 14 AEEEIVIRSENFTN 91.97
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 277 293 17 AKTIIVQLNESVVINCT 88
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 308 319 12 GRALYTTGEIIG 87.63
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 338 344 7 EQIAIKL 87.29
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 352 359 8 KTIIFNPS 94.31
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 374 391 18 GGEFFYCNSTQLFTWNDT 92.29
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 407 417 11 IKQIINMWQEV 91.97
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 127 193 155 162 8 CSFNITTS 86.75
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 127 193 167 188 22 VQKEYALFYNLDVVPIDNASYR 87.75
DP00984P12357Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) Spinacia oleracea (Spinach) 70 164 74 99 26 SLVISLSTGLSLFLGRFVFFNFQREN 94.47
DP00984P12357Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) Spinacia oleracea (Spinach) 70 164 133 159 27 VGFNIVDVLAWGSIGHIVAYYILATAS 93
DP00984P12357Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) Spinacia oleracea (Spinach) 73 167 74 99 26 SLVISLSTGLSLFLGRFVFFNFQREN 94.47
DP00984P12357Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) Spinacia oleracea (Spinach) 73 167 133 162 30 VGFNIVDVLAWGSIGHIVAYYILATASNGY 92.23
DP00985Q87WW0Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) (SAT) Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) 217 305 219 236 18 NGTLIMIDDERILEHLTD 86.99
DP00986Q8QWD4VP4 (Fragment) Human enterovirus D68 (EV68) (EV-68) 2 29 14 24 11 ENANIATNGSH 87.78
DP00990P12355Photosystem I reaction center subunit III; chloroplastic (Light-harvesting complex I 17 kDa protein) (PSI-F) Spinacia oleracea (Spinach) 1 77 1 11 11 MSFTIPTNLYK 86.29
DP00992P27356Methane monooxygenase regulatory protein B Methylosinus trichosporium 1 35 4 14 11 AHNAYNAGIMQ 94.31
DP00992P27356Methane monooxygenase regulatory protein B Methylosinus trichosporium 1 35 21 30 10 ADEFFAEENQ 96.32
DP00993Q9I332Translocation protein in type III secretion Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) 1 253 27 34 8 QQIAFEQA 91.97
DP00993Q9I332Translocation protein in type III secretion Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) 20 40 27 34 8 QQIAFEQA 91.97
DP00994P39015Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 177 273 205 219 15 EYLEFDATFVESNTR 88.32
DP00994P39015Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 273 205 219 15 EYLEFDATFVESNTR 88.32
DP00997P0A4T9HTH-type transcriptional activator TipA Streptomyces lividans 111 159 119 127 9 KFEVFGDFD 87.29
DP00998Q05127Polymerase cofactor VP35 (Ebola VP35) (eVP35) Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) 20 48 25 35 11 LSGWISEQLMT 90.97
DP00999P03315Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Semliki forest virus (SFV) 119 260 198 204 7 GAVQYSG 91.97
DP00999P03315Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Semliki forest virus (SFV) 119 260 229 237 9 RVVAIVLGG 96.32
DP00999P03315Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Semliki forest virus (SFV) 119 260 247 254 8 SVVTWNKD 91.97
DP01009P97303Transcription regulator protein BACH2 (BTB and CNC homolog 2) Mus musculus (Mouse) 331 520 428 436 9 RSVIFSASA 91.97
DP01009P97303Transcription regulator protein BACH2 (BTB and CNC homolog 2) Mus musculus (Mouse) 331 520 475 483 9 SSQAYSHSG 87.29
DP01011P68390Ovomucoid Meleagris gallopavo (Wild turkey) 1 65 41 55 15 LLCAYNIEYGTNISK 87.63
DP01014O9474226S proteasome complex subunit SEM1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 89 55 65 11 TQTNIWEENWD 86.23
DP01025P02619Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2) Esox lucius (Northern pike) 1 107 43 51 9 KKAFYVIDQ 94.17
DP01025P02619Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2) Esox lucius (Northern pike) 1 107 65 71 7 FLQNFSP 96.66
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2131 2145 15 AVAHILGIRDVASIN 89.23
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2285 2295 11 SLASYYIECIR 92.58
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2312 2319 8 ACVAFEMC 96.32
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2332 2350 19 NHSLFLFDGSHTFVLAYTQ 95.76
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2367 2379 13 KAMYFFVQQFTDM 90.71
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2401 2407 7 TVDLITQ 85.43
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2415 2426 12 HALSFAARSFYQ 87.63
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2430 2441 12 AAENYWPQATYH 87.37
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2461 2467 7 ADYNLSQ 86.29
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2490 2501 12 GLESILSIIHSC 89.69
DP01028Q59471Diol dehydrase beta subunit (EC 4.2.1.28) Klebsiella oxytoca 1 45 8 18 11 LRQIIEDVLSE 87.29
DP01032Q06556Fibronectin binding protein Streptococcus dysgalactiae 810 969 824 830 7 EEITITE 86.96
DP01034P73124Ssl1911 protein Synechocystis sp. (strain PCC 6803 / Kazusa) 1 65 14 20 7 HHQFIKN 86.96
DP01034P73124Ssl1911 protein Synechocystis sp. (strain PCC 6803 / Kazusa) 1 65 29 35 7 AAAEIGV 87.29
DP01034P73124Ssl1911 protein Synechocystis sp. (strain PCC 6803 / Kazusa) 1 65 39 45 7 KDFWTTV 89.2
DP01035Q39805Dehydrin-like protein Glycine max (Soybean) (Glycine hispida) 1 226 35 43 9 ASVTYVATR 97.32
DP01038Q9FUM5BN28a Brassica napus (Rape) 1 65 42 48 7 AGQKITE 86.96
DP01038Q9FUM5BN28a Brassica napus (Rape) 1 65 52 60 9 GAVNLVKEK 91.97
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 356 362 7 AGFEIDN 91.97
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 366 375 10 TIEEFFGSAY 87.76
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 395 402 8 FINMYGFD 87.29
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 405 413 9 EYSFIQFVD 88.33
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 421 429 9 EENVYADIR 87.29
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 458 464 7 TIHAYFR 91.97
DP01040Q9FUW7Omega gliadin storage protein Triticum aestivum (Wheat) 1 280 2 17 16 KTFLIFVLLAMAMKIA 93.6
DP01040Q9FUW7Omega gliadin storage protein Triticum aestivum (Wheat) 1 280 35 45 11 QSFSYQQQPFP 87.29
DP01043Q80FJ1Membrane fusion protein p14 Reptilian orthoreovirus 2 31 4 12 9 GPSNFVNHA 86.96
DP01045Q7DB66Lipoprotein Escherichia coli O157:H7 60 85 68 76 9 RAITILNNN 86.18
DP01047O50835Fibronectin-binding protein BBK32 Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) 56 205 87 101 15 NKSNFLQKNVILEEE 86.62
DP01047O50835Fibronectin-binding protein BBK32 Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) 56 205 187 196 10 YDQYYLDEYD 98.33
DP01049Q6QCC2Factor H-binding protein (Lipoprotein) (Lipoprotein GNA1870) Neisseria meningitidis 101 137 104 132 29 DGQLITLESGEFQVYKQSHSALTAFQTEQ 87.87
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 9 18 10 NQQNYQQYSQ 90.77
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 31 39 9 GYQAYNAQA 98.33
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 42 65 24 AGGYYQNYQGYSGYQQGGYQQYNP 89.97
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 78 84 7 GYQQYNP 91.97
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 88 95 8 YQQQFNPQ 91.64
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 100 118 19 NYKNFNYNNNLQGYQAGFQ 97.36
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 216 246 31 EDLKISESTHNTNNANVTSADALIKEQEEEV 88.49
DP01054Q76LA1CSTB protein (Cystatin B) (Cystatin B (Stefin B)) (Cystatin B (Stefin B); isoform CRA_a) (Epididymis secretory sperm binding protein) (cDNA; FLJ92415; Homo sapiens cystatin B (stefin B) (CSTB); mRNA) Homo sapiens (Human) 1 67 39 46 8 KAVSFKSQ 85.95
DP01054Q76LA1CSTB protein (Cystatin B) (Cystatin B (Stefin B)) (Cystatin B (Stefin B); isoform CRA_a) (Epididymis secretory sperm binding protein) (cDNA; FLJ92415; Homo sapiens cystatin B (stefin B) (CSTB); mRNA) Homo sapiens (Human) 1 67 49 57 9 AGTNYFIKV 87.77
DP01055Q8GT36Thylakoid soluble phosphoprotein Spinacia oleracea (Spinach) 1 103 35 43 9 VDWLLGKIT 86.06
DP01055Q8GT36Thylakoid soluble phosphoprotein Spinacia oleracea (Spinach) 1 103 45 52 8 EDQFYETD 87.58
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 161 186 26 KENTFEVSLLATSESEIDEDFFSDID 85.62
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 190 197 8 KIVTFDWD 96.32
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 234 244 11 MDQITAEQEEM 86.96
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 295 306 12 NDGKIVQQNGFG 87.29
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 475 481 7 EACNFMQ 91.97
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 701 708 8 DASLFTFQ 94.48
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 746 756 11 ASSVYSVPAYS 87.29
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 788 794 7 TSSLFTA 87.96
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 803 809 7 KAGVIAQ 85.62
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 950 958 9 SQQQYAYCS 94.46
DP01057Q42512Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) Arabidopsis thaliana (Mouse-ear cress) 41 139 44 51 8 KKSLIYAA 92.18
DP01057Q42512Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) Arabidopsis thaliana (Mouse-ear cress) 41 139 53 64 12 GDGNILDDLNEA 92.31
DP01057Q42512Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) Arabidopsis thaliana (Mouse-ear cress) 41 139 107 115 9 KAAAYVEEK 91.97
DP01057Q42512Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) Arabidopsis thaliana (Mouse-ear cress) 41 139 122 129 8 KAAEFAEG 86.96
DP01058Q9SIN5Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B) Arabidopsis thaliana (Mouse-ear cress) 41 139 45 65 21 KKSLIYAVKSDGNILDDLNEA 91.34
DP01058Q9SIN5Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B) Arabidopsis thaliana (Mouse-ear cress) 41 139 123 130 8 KAAEFVEG 87.29
DP01060A8CDV5Latent membrane protein 2A (Fragment) Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) 1 118 81 87 7 DQSLYLG 96.99
DP01060A8CDV5Latent membrane protein 2A (Fragment) Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) 1 118 107 113 7 SSQHIYE 90.16
DP01065Q9NQI0Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) Homo sapiens (Human) 1 236 13 22 10 HMSSYVPIFE 86.82
DP01065Q9NQI0Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) Homo sapiens (Human) 1 236 215 221 7 NEEVITG 87.29
DP01066Q9NQI0Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) Homo sapiens (Human) 1 204 13 22 10 HMSSYVPIFE 86.82
DP01066Q9NQI0Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) Homo sapiens (Human) 1 204 181 187 7 NEEVITG 87.29
DP01067P19599Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) Plasmodium falciparum (isolate FC27 / Papua New Guinea) 21 238 22 39 18 NESKYSNTFINNAYNMSI 89.22
DP01067P19599Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) Plasmodium falciparum (isolate FC27 / Papua New Guinea) 21 238 129 135 7 ATESISP 85.62
DP01068Q9UBB5Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) Homo sapiens (Human) 238 356 279 285 7 RQLFWEK 85.48
DP01068Q9UBB5Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) Homo sapiens (Human) 238 356 296 303 8 TEQIIKTM 91.97
DP01069Q6MRH6Hit locus orf4 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) 1 101 4 19 16 LLVLSILLTLGFSFAG 87.29
DP01070P42568Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3) Homo sapiens (Human) 490 568 522 546 25 ILQQIVNLIEETGHFHITNTTFDFD 91.34
DP01070P42568Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3) Homo sapiens (Human) 490 568 557 563 7 KLQSYLE 86
DP01071O23764CDet11-24 protein Craterostigma plantagineum (Blue gem) (Torenia plantagineum) 1 422 56 63 8 NDEEINTS 92.31
DP01071O23764CDet11-24 protein Craterostigma plantagineum (Blue gem) (Torenia plantagineum) 1 422 176 182 7 EHQTISD 85.28
DP01071O23764CDet11-24 protein Craterostigma plantagineum (Blue gem) (Torenia plantagineum) 1 422 353 359 7 LSQAIME 90.97
DP01073Q61548Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) (Phosphoprotein F1-20) Mus musculus (Mouse) 623 680 636 645 10 VIDLFGDAFG 86.62
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 335 341 7 GFDFIKD 85.95
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 382 388 7 LSFNFSQ 95.65
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 402 409 8 STTLFNFG 94.65
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 531 538 8 ADVTSNID 90.72
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 687 693 7 TSFSFTK 86.62
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 751 761 11 NGFSFTKFNHN 85.83
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 798 808 11 SAFSFGTANTN 87.29
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 817 823 7 TSFSFNA 89.63
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 862 872 11 AGSAFGFSSSG 86.62
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 881 889 9 NQSSFNFGN 90.93
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 927 937 11 SAFNFTGNNST 87.6
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 940 959 20 GGSVFNMNGNTNANTVFAGS 87.29
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 981 998 18 TVPNINFSGLNGGITNTA 86.29
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 64 83 20 SNSLFGNNNTQNNGAFGQSM 86.62
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 118 129 12 TNNAFNNNSNST 90.64
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 184 190 7 NGSNIFG 88.92
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 200 216 17 TGSLFGNQQSSAFGTNN 87.29
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 218 237 20 QGSLFGQQSQNTNNAFGNQN 86.96
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 251 267 17 SGSLFGQSNNTLGNTTN 85.95
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 307 330 24 NQMQINGNNNNSLFGKANTFSNSA 86.75
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 377 387 11 GIGLFGQNNNQ 91.97
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 434 445 12 GNSLFGATKLTN 88.29
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 472 485 14 TGSLFGNNTASTTV 87.29
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 548 556 9 NTGLFGATG 86.96
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 610 625 16 NEQLFSKISIPNSITN 92.79
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 39 61 23 GQSTFGFNNSAPNNTNNANSSIT 88.05
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 100 108 9 GTSLFGSSS 89.63
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 125 138 14 SSSLFNNSTNSNTT 90.97
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 164 172 9 SNNLFGATA 86.96
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 196 204 9 PAFSFNSSV 86.96
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 548 554 7 SAFSFGS 87.29
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 567 573 7 AAISFGA 86.96
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 498 607 548 554 7 SAFSFGS 87.29
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 498 607 567 573 7 AAISFGA 86.96
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 441 449 9 SGFTFLKTQ 90.97
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 518 525 8 STSEYAFG 86.71
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 622 637 16 SGSIFGKAAFGSSSFA 86.96
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 640 652 13 NNELFGSNFTISK 90.02
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 700 716 17 KTNAFDFGSSSFGSGFS 85.28
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 855 865 11 PFSAFATNITK 87.17
DP01079P40517Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 203 150 156 7 SGFNILK 95.32
DP01080Q9C1S9Exoglucanase-6A (EC 3.2.1.91) (1;4-beta-cellobiohydrolase 6A) (Avicelase 2) (Beta-glucancellobiohydrolase 6A) (Exocellobiohydrolase 6A) Humicola insolens (Soft-rot fungus) 44 96 53 59 7 QNDWYSQ 90.11
DP01080Q9C1S9Exoglucanase-6A (EC 3.2.1.91) (1;4-beta-cellobiohydrolase 6A) (Avicelase 2) (Beta-glucancellobiohydrolase 6A) (Exocellobiohydrolase 6A) Humicola insolens (Soft-rot fungus) 44 96 64 73 10 SQVTTTSTTS 85.28
DP01082Q7X2A1Immunoglobulin-like B protein Leptospira interrogans serovar Pomona 1119 1165 1139 1149 11 IQVVYSESINN 87.96
DP01082Q7X2A1Immunoglobulin-like B protein Leptospira interrogans serovar Pomona 1119 1165 1154 1160 7 DLSNYKI 91.83
DP01085Q9SKI4Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A) Arabidopsis thaliana (Mouse-ear cress) 106 193 135 142 8 NRVVFNEP 89.63
DP01085Q9SKI4Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A) Arabidopsis thaliana (Mouse-ear cress) 106 193 154 166 13 RGVNIQNQANNTP 91.97
DP01086Q10Q08Replication protein A 70 kDa DNA-binding subunit B (OsRPA70b) (Replication factor A protein 1B) (Replication protein A 1B) Oryza sativa subsp. japonica (Rice) 105 180 105 117 13 LEVVFKALDSEIK 86.54
DP01087Q1PAB4Protein Tat (Transactivating regulatory protein) Human immunodeficiency virus 1 1 101 35 48 14 QVCFIRKALGISYG 87.63
DP01088Q9XES8Seed maturation protein PM28 Glycine max (Soybean) (Glycine hispida) 1 89 6 14 9 EDITYATSQ 91.97
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 3546 3795 3698 3708 11 AASEIAHLAID 90.48
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 3546 3795 3758 3766 9 VIVAEVGYD 87.07
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 3546 3795 3769 3790 22 ECSTIADTITSLSSSPLYTAPV 87.29
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4717 4730 14 EVELFFSQAEVFSG 90.35
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4738 4748 11 ECSEYVTTSIQ 87.63
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4815 4822 8 QQAEIVEQ 92.31
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4878 4891 14 EVELFFSQAEVFSG 90.35
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4899 4909 11 ECSEYVTTSIQ 87.63
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4937 4944 8 QQAEIIEQ 92.52
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4976 4983 8 QQVEIIEQ 93.48
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5015 5022 8 QQAEIIEQ 92.52
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5054 5061 8 QQVEIIEQ 93.48
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5093 5100 8 QQAEIIEQ 92.52
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5132 5139 8 QQVEIIEQ 93.48
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5234 5247 14 EVELFFSKAEVFSG 90.01
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5255 5265 11 ECSEYVTTSIQ 87.63
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5332 5339 8 QQAEIIEQ 92.52
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5396 5408 13 VELLFSQAEVFSG 90.84
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5416 5426 11 ECSEYVTTSIQ 87.63
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5493 5500 8 QQAEIIEQ 92.52
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6180 6193 14 EVELFFSQAEVFSG 90.35
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6201 6211 11 ECSEYVTTSIQ 87.63
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6707 6714 8 QTAEIVEQ 86.96
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6746 6754 9 QQAAIVEQK 95.65
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6785 6792 8 QTAEIVEQ 86.96
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6824 6832 9 QQAAIVEQK 95.65
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6902 6910 9 QQAAIVEQK 95.65
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6941 6949 9 QQAAIVEQK 95.65
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 7013 8512 8492 8507 16 NQSRIFEETSIEVTSL 87.29
DP01092O66683Anti sigma factor FlgM Aquifex aeolicus (strain VF5) 5 88 38 48 11 TLSKIAQELSK 89.3
DP01094Q9BP37Aragonite protein AP7 Haliotis rufescens (California red abalone) 23 52 38 47 10 QGNTYDDLAS 88.93
DP01094Q9BP37Aragonite protein AP7 Haliotis rufescens (California red abalone) 56 88 66 72 7 LCYSITD 86.96
DP01095Q9BP38Aragonite protein AP24 Haliotis rufescens (California red abalone) 25 54 35 46 12 LCNQYNQNVTTR 87.29
DP01097P61244Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) Homo sapiens (Human) 93 150 110 116 7 DNSLYTN 89.3
DP01097P61244Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) Homo sapiens (Human) 93 150 118 126 9 KGSTISAFD 89.74
DP01100P10636Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) Homo sapiens (Human) 1 441 274 280 7 KVQIINK 97.99
DP01100P10636Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) Homo sapiens (Human) 1 441 304 312 9 GSVQIVYKP 89.37
DP01100P10636Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) Homo sapiens (Human) 1 441 388 396 9 HGAEIVYKS 86.99
DP01101P04370Myelin basic protein (MBP) (Myelin A1 protein) Mus musculus (Mouse) 1 169 83 92 10 PVVHFFKNIV 90.1
DP01101P04370Myelin basic protein (MBP) (Myelin A1 protein) Mus musculus (Mouse) 1 169 148 156 9 TLSKIFKLG 90.97
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 10 18 9 ATQSYGAYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 34 43 10 GQQSYSGYSQ 93.65
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 87 98 12 SQSSYGQQSSYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 283 291 9 DNNTIFVQG 87.55
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 294 314 21 ENVTIESVADYFKQIGIIKTN 89.03
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 321 327 7 MINLYTD 97.99
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 350 356 7 AIDWFDG 91.97
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 10 18 9 ATQSYGAYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 34 43 10 GQQSYSGYSQ 93.65
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 87 98 12 SQSSYGQQSSYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 283 291 9 DNNTIFVQG 87.55
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 294 314 21 ENVTIESVADYFKQIGIIKTN 89.03
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 321 327 7 MINLYTD 97.99
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 350 356 7 AIDWFDG 91.97
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 10 18 9 ATQSYGAYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 34 43 10 GQQSYSGYSQ 93.65
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 87 98 12 SQSSYGQQSSYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 283 291 9 DNNTIFVQG 87.55
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 294 314 21 ENVTIESVADYFKQIGIIKTN 89.03
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 321 327 7 MINLYTD 97.99
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 350 356 7 AIDWFDG 91.97
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 10 18 9 ATQSYGAYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 34 43 10 GQQSYSGYSQ 93.65
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 87 98 12 SQSSYGQQSSYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 10 18 9 ATQSYGAYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 34 43 10 GQQSYSGYSQ 93.65
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 87 98 12 SQSSYGQQSSYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 2 36 10 18 9 ATQSYGAYP 86.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 39 95 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 98 214 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 98 214 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 285 370 294 314 21 ENVTIESVADYFKQIGIIKTN 89.03
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 285 370 321 327 7 MINLYTD 97.99
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 285 370 350 356 7 AIDWFDG 91.97
DP01103Q13698Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1) Homo sapiens (Human) 666 791 776 784 9 ASSFFIFSP 97.32
DP01104P46531Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD) Homo sapiens (Human) 1758 1888 1764 1771 8 HGQLWFPE 95.53
DP01105P20444Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13) Mus musculus (Mouse) 606 672 622 633 12 GAENFDKFFTRG 92.31
DP01105P20444Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13) Mus musculus (Mouse) 606 672 641 662 22 DQLVIANIDQSDFEGFSYVNPQ 92.44
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 598 236 262 27 TVWISVAVLSAVICLIIVWAVALKGYS 89.35
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 598 310 317 8 LLVEYLEV 97.99
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 598 429 441 13 SYHNITDVCELAV 87.29
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 598 553 559 7 MDNNILV 95.65
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 396 236 262 27 TVWISVAVLSAVICLIIVWAVALKGYS 89.35
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 396 310 317 8 LLVEYLEV 97.99
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 24 31 8 GTVLLSTV 86.96
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 69 76 8 GNLVYVVN 94.48
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 120 133 14 LKEYFSTFGEVLMV 88.03
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 148 162 15 GFVRFTEYETQVKVM 91.97
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 227 251 25 RAFAFVTFADDQIAQSLCGEDLIIK 96.21
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 253 259 7 ISVHISN 88.29
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 312 320 9 NFGAFSINP 95.88
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 370 376 7 GNNSYSG 85.95
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 263 414 312 320 9 NFGAFSINP 95.88
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 263 414 370 376 7 GNNSYSG 85.95
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 266 414 312 320 9 NFGAFSINP 95.88
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 266 414 370 376 7 GNNSYSG 85.95
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 267 414 312 320 9 NFGAFSINP 95.88
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 267 414 370 376 7 GNNSYSG 85.95
DP01109P22626Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1) Homo sapiens (Human) 190 341 286 307 22 GYDNYGGGNYGSGNYNDFGNYN 91.14
DP01110Q9UHD9Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) Homo sapiens (Human) 450 624 556 562 7 NQQFIQQ 97.99
DP01110Q9UHD9Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) Homo sapiens (Human) 450 624 601 619 19 LQALIATGGDINAAIERLL 97.99
DP01118Q12834Cell division cycle protein 20 homolog (p55CDC) Homo sapiens (Human) 81 164 91 99 9 ASFLLSKEN 86.62
DP01118Q12834Cell division cycle protein 20 homolog (p55CDC) Homo sapiens (Human) 81 164 114 131 18 KAWALNLNGFDVEEAKIL 86.99
DP01118Q12834Cell division cycle protein 20 homolog (p55CDC) Homo sapiens (Human) 81 164 148 154 7 LKVLYSQ 94.31
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 1 137 26 32 7 QQQSYLD 86.57
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 1 137 60 76 17 SQVLYEWEQGFSQSFTQ 98.33
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 19 44 26 32 7 QQQSYLD 86.57
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 683 781 688 694 7 MAWNETA 85.62
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 687 781 688 694 7 MAWNETA 85.62
DP01126O43561Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) Homo sapiens (Human) 28 233 188 201 14 RDSAFSMESIDDYV 86.96
DP01127Q8VHK2Caskin-1 (CASK-interacting protein 1) Rattus norvegicus (Rat) 603 1430 831 839 9 RGFAYVLPQ 92.31
DP01127Q8VHK2Caskin-1 (CASK-interacting protein 1) Rattus norvegicus (Rat) 603 1430 1138 1146 9 NVKFILTES 87.29
DP01128O43806Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) (Fragment) Homo sapiens (Human) 25 93 58 65 8 RKWNFDFQ 86.96
DP01133Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 216 302 251 260 10 FSVEFEVESL 86.96
DP01133Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 216 302 278 289 12 DDEVYQVTVYQA 86.62
DP01134P10071Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83) Homo sapiens (Human) 106 236 212 220 9 SLSMISATR 85.95
DP01135P40019Histone H2A.Z-specific chaperone CHZ1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 153 91 104 14 DLAEIDTSNIITSG 89.06
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 42 52 11 ITVSIQYSYFT 93.19
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 58 73 16 HLSNISNNDNNENNSA 96.32
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 99 105 7 ALVLSFR 92.31
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 116 122 7 LNSFISV 87.67
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 303 316 14 NEAAFERIRRVLYD 87.53
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 318 328 11 TAVNSTNENSS 86.62
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 355 361 7 TGFFLVP 85.95
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 461 468 8 LDHIFNVA 92.31
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 505 511 7 FLENISR 95.65
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 544 557 14 RNNLFSSGVASYRN 86.96
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 560 576 17 GDVTTVELRNNNSAAFP 87.63
DP01140P38293Proteasome maturation factor UMP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 148 72 79 8 YRQIFGIA 87.96
DP01140P38293Proteasome maturation factor UMP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 84 72 79 8 YRQIFGIA 87.96
DP01141P70604Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2) Rattus norvegicus (Rat) 396 424 406 412 7 HVHNFMM 87.96
DP01141P70604Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2) Rattus norvegicus (Rat) 436 487 456 466 11 FLQAIHQLRSV 87.29
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 211 222 12 SIVYEAADVIMH 88.29
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 267 277 11 GTAAFCSAMYV 86.62
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 357 381 25 AGLAYYSMVGNWAKVLIVALLFAGV 92.15
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 399 423 25 FTSLFSSGASQKIQLVNTNGSWHIN 91.65
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 434 442 9 QTGFFAALF 93.01
DP01144P08008Outer membrane virulence protein YopE Yersinia pseudotuberculosis serotype I (strain IP32953) 1 100 2 11 10 KISSFISTSL 87.83
DP01144P08008Outer membrane virulence protein YopE Yersinia pseudotuberculosis serotype I (strain IP32953) 1 100 70 79 10 VIGFIQRMFS 93.31
DP01146O34800Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) Bacillus subtilis (strain 168) 1 56 44 51 8 NERLIDEY 86.96
DP01147Q9I322Type III secretion regulatory protein ExsE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) 1 81 2 8 7 KIESISP 87.29
DP01148A0A068MVV3Glutamine synthetase inactivating factor IF7 Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714)) 1 65 14 20 7 HHQFIKN 86.96
DP01148A0A068MVV3Glutamine synthetase inactivating factor IF7 Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714)) 1 65 29 45 17 AAAEIGVQAEKDFWTTV 88.08
DP01149Q14457Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa Homo sapiens (Human) 1 150 29 49 21 TSFKILDRVTIQELTAPLLTT 86.22
DP01149Q14457Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa Homo sapiens (Human) 1 150 121 127 7 DLFDIMS 85.28
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 139 20 29 10 LDQLIEEVLA 96.32
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 139 61 67 7 AVSQIFP 87
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 91 20 29 10 LDQLIEEVLA 96.32
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 91 61 67 7 AVSQIFP 87
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 36 20 29 10 LDQLIEEVLA 96.32
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 27 91 61 67 7 AVSQIFP 87
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 36 91 61 67 7 AVSQIFP 87
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 53 91 61 67 7 AVSQIFP 87
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 8 14 7 LVLSYQE 88.29
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 22 30 9 LVDNFFNEV 92.64
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 33 52 20 DDDLYVPSLYELYDLDVESA 92.86
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 59 79 21 QAVNEFFPESLILAASEGLFL 88.39
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 180 191 12 YLRAYNMFIYSP 95.07
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 237 249 13 AVESILDLIQEEE 87.14
DP01152Q9JK11Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) Rattus norvegicus (Rat) 544 725 691 705 15 DFSNYSEIAKFEKSV 93.51
DP01159A6NF83Nuclear protein 2 (Nuclear transcriptional regulator 1-like protein) (Nuclear transcriptional regulator protein 2) Homo sapiens (Human) 1 97 25 39 15 EEELYDCLDYYYLRD 94.74
DP01161Q9UMS4Pre-mRNA-processing factor 19 (EC 2.3.2.27) (Nuclear matrix protein 200) (PRP19/PSO4 homolog) (hPso4) (RING-type E3 ubiquitin transferase PRP19) (Senescence evasion factor) Homo sapiens (Human) 169 194 169 177 9 TPEIIQKLQ 85.28
DP01161Q9UMS4Pre-mRNA-processing factor 19 (EC 2.3.2.27) (Nuclear matrix protein 200) (PRP19/PSO4 homolog) (hPso4) (RING-type E3 ubiquitin transferase PRP19) (Senescence evasion factor) Homo sapiens (Human) 169 194 180 186 7 ATVLTTE 87.29
DP01162Q96SD1Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein) Homo sapiens (Human) 480 575 489 508 20 WEVFFKRNDEITDESLENFP 91.3
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 331 692 374 382 9 GSLVIQASE 85.95
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 331 692 605 615 11 AASSIYSMYTQ 89.94
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 331 692 659 668 10 HPENIYSNSQ 87.09
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 693 918 750 767 18 QKLLYQRTTIAAMETISV 88.59
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 693 918 859 866 8 LDVYLEEY 86.91
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 2 12 11 QIQSFYHSASL 91.67
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 14 34 21 TQEAFKSLQKTLYNGMQILSG 87.29
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 58 64 7 TWGNYLQ 87.63
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 73 80 8 LHNLYNLQ 96.32
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 131 137 7 LIELIAA 97.99
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 29 168 58 64 7 TWGNYLQ 87.63
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 29 168 73 80 8 LHNLYNLQ 96.32
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 29 168 131 137 7 LIELIAA 97.99
DP01167P02730Band 3 anion transport protein (Anion exchange protein 1) (AE 1) (Anion exchanger 1) (Solute carrier family 4 member 1) (CD antigen CD233) Homo sapiens (Human) 1 54 17 23 7 EQEEYED 87.29
DP01169P24255RNA polymerase sigma-54 factor Escherichia coli (strain K12) 1 105 19 44 26 LQQAIRLLQLSTLELQQELQQALESN 91.97
DP01169P24255RNA polymerase sigma-54 factor Escherichia coli (strain K12) 1 105 88 94 7 WDTIYTA 91.97
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 445 451 7 NIQNFQL 97.66
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 624 648 25 VQNLLDGKIEAEDFTSRLYRELNSS 85.28
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 671 677 7 SAAFIQQ 91.3
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 695 702 8 AVVLSSSV 89.97
DP01173Q15726Metastasis-suppressor KiSS-1 (Kisspeptin-1) Cleaved into: Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10 Homo sapiens (Human) 20 138 35 45 11 GQQLESLGLLA 85.62
DP01173Q15726Metastasis-suppressor KiSS-1 (Kisspeptin-1) Cleaved into: Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10 Homo sapiens (Human) 20 138 108 122 15 DLPNYNWNSFGLRFG 86.69
DP01174O43474Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) Homo sapiens (Human) 1 130 19 26 8 SFSTFASG 92.98
DP01174O43474Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) Homo sapiens (Human) 1 130 105 113 9 LDFILSNSL 87.11
DP01175P28235Gap junction alpha-4 protein (Connexin-37) (Cx37) Mus musculus (Mouse) 233 333 261 269 9 EQVFFYLPM 90.26
DP01175P28235Gap junction alpha-4 protein (Connexin-37) (Cx37) Mus musculus (Mouse) 233 333 287 297 11 TEQNWANLTTE 89.97
DP01176P08033Gap junction beta-1 protein (Connexin-32) (Cx32) (GAP junction 28 kDa liver protein) Rattus norvegicus (Rat) 217 283 244 252 9 KQNEINKLL 94.31
DP01177P0AE98Curli production assembly/transport component CsgF Escherichia coli (strain K12) 19 49 38 44 7 GAFLLNS 92.64
DP01178Q14978Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) Homo sapiens (Human) 1 699 50 60 11 LLDIYSFWLKS 89.88
DP01181P56621Nickel and cobalt resistance protein CnrY Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) 2 38 27 33 7 IQECISA 86.29
DP01184O96013Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) Homo sapiens (Human) 9 68 39 46 8 WQSLIEES 96.66
DP01186P03086Agnoprotein (Agno) JC polyomavirus (JCPyV) (JCV) 41 71 58 66 9 TEQTYSALP 92.31
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 22 28 7 NAAMISN 86.62
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 41 49 9 NSSYIVIGK 89
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 93 100 8 ALLLYTSK 88.67
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 267 286 20 KKSLYQDLMENSTVEVNRYE 85.62
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 326 338 13 NLSNFYQFNENIN 92.51
DP01195P39007Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 (Oligosaccharyl transferase subunit STT3) (EC 2.4.99.18) (Staurosporine and temperature sensitivity protein 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 299 351 299 323 25 MVSLFLILVLGVVGLSALTYMGLIA 92.76
DP01195P39007Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 (Oligosaccharyl transferase subunit STT3) (EC 2.4.99.18) (Staurosporine and temperature sensitivity protein 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 299 351 329 346 18 FYSLWDTNYAKIHIPIIA 90.04
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 46 52 7 SFENILA 96.99
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 55 92 38 HENAYIVALFTATAPEIGCSLCLELESEYDTIVASWFD 91.74
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 103 115 13 DTSIFFTKVNLED 87.65
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 122 139 18 KAFQFFQLNNVPRLFIFK 96.21
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 149 155 7 SVISIST 86.29
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 162 182 21 MKQIIQAIKQFSQVNDFSLHL 91.02
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 190 204 15 ITSTIITFITVLLFK 89.48
DP01199B9KDD4Undecaprenyl-diphosphooligosaccharide--protein glycotransferase (EC 2.4.99.19) (Protein glycosylation B) Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) 281 327 284 297 14 DPVLYQLKFYVFKA 88.63
DP01199B9KDD4Undecaprenyl-diphosphooligosaccharide--protein glycotransferase (EC 2.4.99.19) (Protein glycosylation B) Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) 281 327 304 322 19 KDAAFMYFNVNETIMEVNT 91.73
DP01200O29867Dolichyl-phosphooligosaccharide-protein glycotransferase 3 (EC 2.4.99.21) (Archaeal glycosylation protein B) (AglB-L) (AglB-Long) (Oligosaccharyl transferase) (OST) (OTase) Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 336 373 354 368 15 GALTIAEVYPFFFTH 92.06
DP01201Q47184EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) Escherichia coli 60 147 60 70 11 SIAKFADMNEA 87.29
DP01201Q47184EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) Escherichia coli 60 147 84 96 13 VDAKIADVQSSSD 87.29
DP01201Q47184EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) Escherichia coli 60 147 105 112 8 DEVISYIN 95.32
DP01201Q47184EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) Escherichia coli 60 147 116 132 17 NDITISGIDNINAQLGA 92.21
DP01202O55000Serine/threonine-protein phosphatase 1 regulatory subunit 10 (MHC class I region proline-rich protein CAT53) (Phosphatase 1 nuclear targeting subunit) (Protein PNUTS) Rattus norvegicus (Rat) 309 433 407 416 10 LREYFYFELD 87.53
DP01203O75807Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog) Homo sapiens (Human) 513 631 562 572 11 VTVHFLAVWAG 91.97
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 197 208 12 NTFEIALARLIP 94.31
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 258 267 10 ATLHINITTA 88.13
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 295 303 9 KQSTIGKTA 89.97
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 357 365 9 LNDYYAALA 86.96
DP01239P20591Interferon-induced GTP-binding protein Mx1 (Interferon-induced protein p78) (IFI-78K) (Interferon-regulated resistance GTP-binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) Cleaved into: Interferon-induced GTP-binding protein Mx1; N-terminally processed Homo sapiens (Human) 532 572 534 540 7 QDQVYRG 86.62
DP01239P20591Interferon-induced GTP-binding protein Mx1 (Interferon-induced protein p78) (IFI-78K) (Interferon-regulated resistance GTP-binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) Cleaved into: Interferon-induced GTP-binding protein Mx1; N-terminally processed Homo sapiens (Human) 532 572 560 567 8 DFGAFQSS 87.29
DP01246O13916Anaphase-promoting complex subunit hcn1 (20S cyclosome/APC complex protein hcn1) (Chaperone-like protein hcn1) (High copy suppressor of cut9 protein 1) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 25 80 62 68 7 ITQIFDS 91.97
DP01248O95292Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) Homo sapiens (Human) 1 125 5 12 8 EQVLSLEP 87.29
DP01248O95292Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) Homo sapiens (Human) 1 125 57 79 23 NSGIIDAGASINVSVMLQPFDYD 87.04
DP01249P61073C-X-C chemokine receptor type 4 (CXC-R4) (CXCR-4) (FB22) (Fusin) (HM89) (LCR1) (Leukocyte-derived seven transmembrane domain receptor) (LESTR) (Lipopolysaccharide-associated protein 3) (LAP-3) (LPS-associated protein 3) (NPYRL) (Stromal cell-derived factor 1 receptor) (SDF-1 receptor) (CD antigen CD184) Homo sapiens (Human) 1 26 3 14 12 GISIYTSDNYTE 98.33
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 27 51 25 GIAQIQEETCQLLTDEVSYRIKEIA 85.28
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 87 97 11 HAQEFIPFRFA 91.94
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 101 110 10 GRELYFYEEK 88.66
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 114 120 7 LSDIINT 86.29
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 133 140 8 AHWLSIEG 85.28
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 437 677 480 486 7 TTLTITQ 87.96
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 437 677 551 560 10 QQVLSLSTSA 90.97
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 437 677 602 611 10 SVQKYIVVSL 93.01
DP01268Q9H816"5 exonuclease Apollo (EC 3.1.-.-) (DNA cross-link repair 1B protein) (SNM1 homolog B) (SNMIB) (hSNM1B)" Homo sapiens (Human) 314 335 322 329 8 SVQQYMSS 86.96
DP01269Q8NG31Kinetochore scaffold 1 (ALL1-fused gene from chromosome 15q14 protein) (AF15q14) (Bub-linking kinetochore protein) (Blinkin) (Cancer susceptibility candidate gene 5 protein) (Cancer/testis antigen 29) (CT29) (Kinetochore-null protein 1) (Protein CASC5) (Protein D40/AF15q14) Homo sapiens (Human) 150 175 150 156 7 KEFSIIE 94.6
DP01280P05067Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31 Homo sapiens (Human) 672 711 687 694 8 KLVFFAED 88.96
DP01280P05067Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31 Homo sapiens (Human) 672 711 699 706 8 KGAIIGLM 86.96
DP01285Q97W59Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) 18 139 32 52 21 NMIILNIGNTTIIRNFAEYCD 93.1
DP01285Q97W59Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) 18 139 79 107 29 GELVIQGKFSSQVINTLMERFLKAYVECS 86.96
DP01285Q97W59Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) 18 139 120 129 10 KKSWYIVCLA 96.96
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 241 251 11 MDVSYALEMSS 95.32
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 310 318 9 HFHAYSETE 90.97
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 342 350 9 GLSHIQTQT 90.97
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 353 363 11 PDGLYNTQHTQ 87.29
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 369 381 13 MDELFPDNFQSTC 87.29
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 367 381 15 PLFKIANPIAGEPIS 86.96
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 415 426 12 TDLSYASQNFIP 90.55
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 521 542 22 VHSSYNVATGNIISNSLVAETV 90.36
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 562 575 14 SAPIINFSAQNSML 87.48
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 584 601 18 QTQTIDLLSDLENILSSN 89.8
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 637 651 15 DIEEFFSASNIQTQT 91.42
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 674 680 7 TDFLLAD 90.3
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 682 688 7 SAQSYGC 85.95
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 690 701 12 GNSNFLGLEMFD 88.63
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 706 714 9 TDLNFFLDS 92.53
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 775 785 11 LGSLFFTSNET 91.12
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 790 812 23 DDFLLADLAWNTMESQFSSVETQ 90.96
DP01292P49768Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) Homo sapiens (Human) 1 77 7 16 10 PLSYFQNAQM 87.29
DP01292P49768Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) Homo sapiens (Human) 262 378 283 299 17 FPALIYSSTMVWLVNMA 87.43
DP01292P49768Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) Homo sapiens (Human) 262 378 311 319 9 KNSKYNAES 86.96
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 1 120 20 26 7 RTVAISD 91.3
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 1 120 49 61 13 GTRIIYDRKFLLD 87.63
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 1 120 97 105 9 NLNNLNNHD 87.29
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 18 62 20 26 7 RTVAISD 91.3
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 18 62 49 57 9 GTRIIYDRK 87.63
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 37 49 13 NQTKIAYEQRLLN 86.62
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 60 75 16 LFLDYMIWISTSYIEV 89.92
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 90 102 13 RCLIYIQDMETYR 91.97
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 106 135 30 RFLKIWIWYINLFLSNNFHESENTFKYMFN 93.11
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 141 153 13 KLSLFYEEFSKLL 89.63
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 155 170 16 NAQFFLEAKVLLELGA 91.39
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 183 189 7 SLSNYED 92.64
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 192 203 12 REMNIVENQNSV 86.96
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 212 225 14 GRLIYRTAPFFIRK 86.62
DP01295Q98XH7Protein Tat (Fragment) Human immunodeficiency virus 1 1 72 34 48 15 CQVCFMTKGLGIYYG 89.83
DP01296Q6BBK3CP12 Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2) 1 52 29 43 15 AAAAWDAVEELQAEA 85.95
DP01300Q9SLJ2Dehydrin HIRD11 (Histidine-rich dehydrin of 11 kDa) (AtHIRD11) (Protein SRC1 homolog) Arabidopsis thaliana (Mouse-ear cress) 1 98 1 15 15 MAGLINKIGDALHIG 88.36
DP01306Q03518Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) Homo sapiens (Human) 61 172 84 98 15 GTVLLLLADWVLLRT 87
DP01306Q03518Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) Homo sapiens (Human) 61 172 103 111 9 IFSLLVPTA 87.63
DP01306Q03518Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) Homo sapiens (Human) 61 172 125 132 8 WAVLWLGA 88.17
DP01306Q03518Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) Homo sapiens (Human) 61 172 149 157 9 AQGWLAALK 87.96
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 1 265 25 34 10 EEEIIAEDYD 91.97
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 1 265 61 69 9 GLPYYWNAD 86.55
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 1 265 71 77 7 DLVSWLS 86.81
DP01310Q8WUP2Filamin-binding LIM protein 1 (FBLP-1) (Migfilin) (Mitogen-inducible 2-interacting protein) (MIG2-interacting protein) Homo sapiens (Human) 1 85 11 18 8 SSVFITLA 88.5
DP01311Q6NUK1Calcium-binding mitochondrial carrier protein SCaMC-1 (Mitochondrial ATP-Mg/Pi carrier protein 1) (Mitochondrial Ca(2+)-dependent solute carrier protein 1) (Small calcium-binding mitochondrial carrier protein 1) (Solute carrier family 25 member 24) Homo sapiens (Human) 50 78 59 72 14 AEEKIFTTGDVNKD 89.3
DP01312Q9UMX1Suppressor of fused homolog (SUFUH) Homo sapiens (Human) 279 360 314 321 8 RGLEINSK 85.28
DP01315Q9QWH1Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36) Mus musculus (Mouse) 1 79 47 55 9 QISVYSGIP 92.31
DP01315Q9QWH1Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36) Mus musculus (Mouse) 1 79 59 68 10 TVQVIQQALH 90.64
DP01316P25916Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) Mus musculus (Mouse) 106 240 127 140 14 DDEIISLSIEFFDQ 91.88
DP01316P25916Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) Mus musculus (Mouse) 106 240 185 194 10 NTFQIDVMYE 89.63
DP01316P25916Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) Mus musculus (Mouse) 106 240 205 214 10 MDIAYIYTWR 89.5
DP01319Q15796Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) Homo sapiens (Human) 1 262 80 86 7 TCSEIWG 85.28
DP01319Q15796Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) Homo sapiens (Human) 1 262 98 106 9 TTGLYSFSE 88.81
DP01319Q15796Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) Homo sapiens (Human) 1 262 124 135 12 PHVIYCRLWRWP 88.29
DP01319Q15796Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) Homo sapiens (Human) 1 262 149 156 8 CEYAFNLK 86.96
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 439 445 7 ESVEFTK 85.62
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 476 482 7 ESVEFTK 85.62
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 513 519 7 ESVEFTK 85.62
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 550 556 7 ESVEFTK 85.62
DP01323Q8R316HMG box-containing protein 1 (HMG box transcription factor 1) (High mobility group box transcription factor 1) Mus musculus (Mouse) 358 380 367 373 7 VYVLSSM 89.97
DP01329P28324ETS domain-containing protein Elk-4 (Serum response factor accessory protein 1) (SAP-1) (SRF accessory protein 1) Homo sapiens (Human) 94 136 106 116 11 ESLNFSEVSSS 86.96
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 112 94 102 9 QHNTILNSS 87.29
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 193 257 205 211 7 QAVAILA 88.15
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 193 257 231 238 8 LGGEINDN 85.28
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 193 257 241 252 12 DDEEYDYNDVEV 86.62
DP01339P0A903Outer membrane protein assembly factor BamC Escherichia coli (strain K12) 26 98 37 44 8 GDEAYLEA 93.98
DP01344Q13469Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1) Homo sapiens (Human) 131 294 175 187 13 SASFISDTFSPYT 91.97
DP01344Q13469Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1) Homo sapiens (Human) 131 294 204 213 10 QFQNIPAHYS 94.31
DP01361P15927Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) Homo sapiens (Human) 1 42 5 15 11 GFESYGSSSYG 89.97
DP01361P15927Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) Homo sapiens (Human) 175 270 223 229 7 EGLNFQD 86.96
DP01361P15927Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) Homo sapiens (Human) 175 270 246 259 14 VDFLSNEGHIYSTV 88.75
DP01378P0CU43Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 6 14 9 QESSYQYSD 85.95
DP01378P0CU43Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 44 56 13 MPNLIAPFISSSA 86.96
DP01378P0CU43Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 66 75 10 GFQASVSRIT 86.96
DP01378P0CU43Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 152 158 7 MEQTIEN 88.29
DP01379P0CU44Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 6 14 9 QESSYQYSD 85.95
DP01379P0CU44Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 44 56 13 MPNLIAPFISSSA 86.96
DP01379P0CU44Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 66 75 10 GFQASVSRIT 86.96
DP01379P0CU44Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 152 158 7 MEQTIEN 88.29
DP01380P0CU45Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 227 62 80 19 LAEEIVGQGFTASAARISG 91.97
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 12 18 7 TEVVYGG 91.97
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 60 77 18 LAQEIVGEGFTASATRIS 94.31
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 83 89 7 TQVLESQ 87.96
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 105 112 8 EQAAIARA 91.97
DP01382P0CU47Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 414 312 318 7 DAELIRQ 86.62
DP01382P0CU47Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 414 342 353 12 QQQEIRLEAEYA 87.96
DP01382P0CU47Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 414 377 386 10 IDVNIDSAIG 91.97
DP01383P0CU51Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 229 60 66 7 SAQEILG 86.53
DP01383P0CU51Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 229 69 77 9 FQASISRIS 87.63
DP01383P0CU51Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 229 109 117 9 LSANYQKEV 88.29
DP01384P0CU50Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 227 62 80 19 LAEEIVGQGFTASAARISG 91.97
DP01385P0CU48Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 227 62 80 19 LAEEIVGQGFTASAARISG 91.97
DP01386P0CU49Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 238 30 41 12 VAAVYAVRFASS 87.99
DP01386P0CU49Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 238 171 178 8 AANAWETV 87.21
DP01386P0CU49Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 238 200 210 11 AQQVIHDATTQ 88.29
DP01388P0CU52Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 227 32 38 7 QQTSYMQ 86.29
DP01388P0CU52Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 227 67 80 14 FQASISRISAVTED 87.63
DP01388P0CU52Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 227 152 158 7 AELAIEN 91.97
DP01391P03520Phosphoprotein (P protein) (Protein M1) Vesicular stomatitis Indiana virus (strain San Juan) (VSIV) 1 60 20 29 10 AVGEIDEIEA 87.29
DP01393P04880Phosphoprotein (Protein P) (Protein M1) Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV) 1 60 20 29 10 AVGEIDEIEA 87.29
DP01394P04879Phosphoprotein (Protein P) (Protein M1) Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV) 1 60 20 29 10 AVGEIDEIEA 87.29
DP01395Q8B0H3Phosphoprotein (Protein P) (NS) (Protein M1) Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV) 1 60 20 29 10 AVGEIDEIEA 87.29
DP01397Q9Z0P7Suppressor of fused homolog Mus musculus (Mouse) 279 359 314 321 8 RGLEINSK 85.28
DP01400P45985Dual specificity mitogen-activated protein kinase kinase 4 (MAP kinase kinase 4) (MAPKK 4) (EC 2.7.12.2) (JNK-activating kinase 1) (MAPK/ERK kinase 4) (MEK 4) (SAPK/ERK kinase 1) (SEK1) (Stress-activated protein kinase kinase 1) (SAPK kinase 1) (SAPKK-1) (SAPKK1) (c-Jun N-terminal kinase kinase 1) (JNKK) Homo sapiens (Human) 1 86 44 50 7 LKLNFAN 87.29
DP01401P47093U6 snRNA-associated Sm-like protein LSm8 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 68 109 96 104 9 EHVIWEKVY 86.96
DP01424Q2KIG3Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI) Bos taurus (Bovine) 1 117 8 16 9 VLVATVLFC 94.54
DP01424Q2KIG3Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI) Bos taurus (Bovine) 1 117 26 33 8 GQVLSALP 91.97
DP01424Q2KIG3Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI) Bos taurus (Bovine) 1 117 37 55 19 RQVQILQNVTTTYKIVLWQ 90.49
DP01424Q2KIG3Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI) Bos taurus (Bovine) 1 117 57 76 20 VAAEYIVKGYEVHFFVNASD 91.84
DP01425Q15004PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor) Homo sapiens (Human) 1 111 64 72 9 GIGEFFRLS 90.97
DP01425Q15004PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor) Homo sapiens (Human) 50 77 64 72 9 GIGEFFRLS 90.97
DP01426P06400Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) Homo sapiens (Human) 786 928 801 808 8 GGNIYISP 94.52
DP01426P06400Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) Homo sapiens (Human) 786 928 831 840 10 ILVSIGESFG 91.64
DP01426P06400Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) Homo sapiens (Human) 786 928 893 902 10 GESKFQQKLA 85.28
DP01426P06400Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) Homo sapiens (Human) 829 873 831 840 10 ILVSIGESFG 91.64
DP01427Q01094Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) Homo sapiens (Human) 200 301 222 235 14 HLMNICTTQLRLLS 88.96
DP01427Q01094Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) Homo sapiens (Human) 200 301 241 249 9 QRLAYVTCQ 87.29
DP01427Q01094Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) Homo sapiens (Human) 200 301 278 288 11 SSENFQISLKS 88.2
DP01428P03120Regulatory protein E2 Human papillomavirus type 16 286 365 308 322 15 HCTLYTAVSSTWHWT 87.29
DP01428P03120Regulatory protein E2 Human papillomavirus type 16 286 365 331 342 12 AIVTLTYDSEWQ 90.25
DP01428P03120Regulatory protein E2 Human papillomavirus type 16 286 365 344 353 10 DQFLSQVKIP 87.56
DP01431C6ZFX3Intrinsically disordered protein 1 Lotus japonicus (Lotus corniculatus var. japonicus) 1 94 4 23 20 SFTNIKAISALVAEEFSNSL 87.11
DP01431C6ZFX3Intrinsically disordered protein 1 Lotus japonicus (Lotus corniculatus var. japonicus) 1 94 69 88 20 VTGYYKPENIKEIDVAELRS 87.29
DP01432E1UJ20Parvalbumin beta-1 Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) 2 109 21 41 21 AADTFNFKTFFHTIGFASKSA 87.24
DP01432E1UJ20Parvalbumin beta-1 Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) 2 109 55 72 18 ASGFIEVEELKLFLQNFC 89.63
DP01433P04052DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) Drosophila melanogaster (Fruit fly) 1657 1739 1660 1666 7 SGSNIYS 93.41
DP01435O60829P antigen family member 4 (PAGE-4) (G antigen family C member 1) (PAGE-1) Homo sapiens (Human) 1 102 20 28 9 DVVAFVAPG 96.32
DP01437P90976LIN-7 (Fragment) Caenorhabditis elegans 115 180 149 169 21 LQSEFFGAVREVYETVYESID 91.59
DP01438O14936Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) Homo sapiens (Human) 335 401 383 391 9 LLDLYDKIN 87.63
DP01438O14936Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) Homo sapiens (Human) 394 460 412 420 9 VLEEISCYP 90.97
DP01438O14936Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) Homo sapiens (Human) 394 460 448 454 7 AHEVYSD 86.14
DP01442Q2Q4X9Seed maturation protein Medicago truncatula (Barrel medic) (Medicago tribuloides) 1 260 130 145 16 SALTIGEALEATAHTV 87.63
DP01442Q2Q4X9Seed maturation protein Medicago truncatula (Barrel medic) (Medicago tribuloides) 1 260 154 163 10 DASAIQAAEV 87.63
DP01442Q2Q4X9Seed maturation protein Medicago truncatula (Barrel medic) (Medicago tribuloides) 1 260 182 190 9 SAAAFNAEC 91.64
DP01443Q9UJX4Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) Homo sapiens (Human) 1 26 5 13 9 HESLYFNPM 92.53
DP01443Q9UJX4Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) Homo sapiens (Human) 1 24 5 13 9 HESLYFNPM 92.53
DP01443Q9UJX4Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) Homo sapiens (Human) 353 413 357 365 9 SYVLLEHSV 86.96
DP01443Q9UJX4Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) Homo sapiens (Human) 353 413 367 391 25 KAVHFGLPYLASLGIQSLVQQRAFA 89.5
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 171 450 172 180 9 SLQNFSNCL 87.85
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 171 450 230 242 13 SSVSYIDSAVISP 93.11
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 171 450 293 303 11 GDGSYLQNYTN 90.7
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 171 450 419 445 27 TQPNINDSLEITKLDSSIISEGKISTI 88.57
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 180 447 230 242 13 SSVSYIDSAVISP 93.11
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 180 447 293 303 11 GDGSYLQNYTN 90.7
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 180 447 419 442 24 TQPNINDSLEITKLDSSIISEGKI 88.14
DP01448P10923Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) Mus musculus (Mouse) 17 294 192 198 7 VAQLLSM 88.2
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 70 79 10 RLVSYTPAYL 91.64
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 123 154 32 VQQTLNSTNEIEALETSRLYEDSGYSSFSLQS 87.24
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 165 182 18 LEENFGDSLQSCLLQIQS 88.29
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 220 236 17 LKEIIARGNFRLQNIIG 91.3
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 258 274 17 VLATILAQLSDMDLINV 91.97
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 291 310 20 AFQLYSKAIQRVTENNNKFS 99
DP01452Q13042Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) Homo sapiens (Human) 528 620 554 560 7 TLKNIIS 87.48
DP01452Q13042Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) Homo sapiens (Human) 528 620 596 604 9 LEETFEIEM 86.29
DP01452Q13042Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) Homo sapiens (Human) 534 620 554 560 7 TLKNIIS 87.48
DP01452Q13042Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) Homo sapiens (Human) 534 620 596 604 9 LEETFEIEM 86.29
DP01453Q8NHZ8Anaphase-promoting complex subunit CDC26 (Anaphase-promoting complex subunit 12) (APC12) (Cell division cycle protein 26 homolog) Homo sapiens (Human) 26 85 44 52 9 GEGAIGLSS 85.28
DP01456Q01081Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) Homo sapiens (Human) 38 152 42 54 13 FSQTIALLNIYRN 92.15
DP01456Q01081Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) Homo sapiens (Human) 38 152 74 99 26 MQEHYDEFFEEVFTEMEEKYGEVEEM 87.24
DP01456Q01081Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) Homo sapiens (Human) 38 152 110 118 9 VGNVYVKFR 88.29
DP01457Q92973Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP) Homo sapiens (Human) 319 371 320 327 8 DIDIILLK 87.29
DP01461Q13188Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C) Homo sapiens (Human) 314 427 363 370 8 GTMVINSE 85.62
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 600 900 714 724 11 LIVKIDLNLLT 96.32
DP01464P28229Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein) Mus musculus (Mouse) 265 332 273 283 11 GAYNYPFTWNT 88.14
DP01464P28229Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein) Mus musculus (Mouse) 265 332 298 312 15 QIQYTELSNAKIAYK 86.96
DP01465Q8IW19Aprataxin and PNK-like factor (EC 3.1.-.-) (Apurinic-apyrimidinic endonuclease APLF) (PNK and APTX-like FHA domain-containing protein) (XRCC1-interacting protein 1) Homo sapiens (Human) 399 420 405 411 7 GGVQIVG 87.63
DP01466A4L7I2Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1758 1764 7 ASVRFFR 86.96
DP01466A4L7I2Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1826 1836 11 ELLTFGDFLPG 86.96
DP01467Q9SP32Endoribonuclease Dicer homolog 1 (EC 3.1.26.-) (Dicer-like protein 1) (AtDCL1) (Protein ABNORMAL SUSPENSOR 1) (Protein CARPEL FACTORY) (Protein SHORT INTEGUMENTS 1) (Protein SUSPENSOR 1) Arabidopsis thaliana (Mouse-ear cress) 1732 1811 1761 1767 7 TVEVFID 96.13
DP01468A3RMR8Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1758 1764 7 ASVRFFR 86.96
DP01468A3RMR8Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1826 1836 11 ELLTFGDFLPG 86.96
DP01469A4L7I4Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1758 1764 7 ASVRFFR 86.96
DP01469A4L7I4Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1826 1836 11 ELLTFGDFLPG 86.96
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 61 72 12 RDITFDGEQAIK 86.79
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 96 104 9 DDLLILNME 87.81
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 192 198 7 EITNFSD 86.96
DP01473Q96GU1P antigen family member 5 (PAGE-5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate-associated gene 5 protein) Homo sapiens (Human) 20 130 86 100 15 DVEAFQQELALLKIE 88.43
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 1 130 15 21 7 QNYLFGC 88.29
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 1 130 55 69 15 DELHIVEAEAMNYEG 87.16
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 1 130 90 96 7 GGFEITP 91.97
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 1 130 107 122 16 GPVHISGQHLVAVEED 86.62
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 159 294 251 257 7 MQASIEK 86.29
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 159 294 265 272 8 EAKFINYV 95.4
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 159 294 280 289 10 DQEAIQDLWQ 90.64
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 824 876 838 844 7 NSELYQS 91.97
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 880 888 9 KFKNFNNNN 90.97
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1004 1031 28 LAQKIDNLNQAVSEAKAGFFGNLEQTID 88.41
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1041 1049 9 VMNLYVESA 96.99
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1059 1068 10 KLDNYAINSH 88.9
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1071 1083 13 INSNIQNGAINEK 87.93
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1112 1120 9 SLSEYDKIG 87.96
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1149 1166 18 GFTHFLANAFSTGYYCLA 88.65
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 998 1038 1004 1031 28 LAQKIDNLNQAVSEAKAGFFGNLEQTID 88.41
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 889 900 12 GSNVIVTERVIA 87.29
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 946 954 9 AHNVIVTER 88.63
DP01478Q9UJX5Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4) Homo sapiens (Human) 480 521 494 505 12 GNQWYDFLQNSS 87.51
DP01479Q9UJX3Anaphase-promoting complex subunit 7 (APC7) (Cyclosome subunit 7) Homo sapiens (Human) 1 35 4 23 20 GDAAILESSLRILYRLFESV 90.1
DP01482O13828mRNA decapping complex subunit 2 (EC 3.-.-.-) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 553 741 724 736 13 HFLSYLQSVVSSN 93.31
DP01484P04626Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) Homo sapiens (Human) 988 1255 1000 1007 8 LDSTFYRS 91.97
DP01484P04626Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) Homo sapiens (Human) 988 1255 1019 1025 7 DAEEYLV 87
DP01484P04626Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) Homo sapiens (Human) 988 1255 1217 1225 9 FDNLYYWDQ 93.01
DP01486P11912B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a) Homo sapiens (Human) 166 226 184 194 11 DENLYEGLNLD 90.97
DP01486P11912B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a) Homo sapiens (Human) 166 226 214 221 8 GSLNIGDV 88.29
DP01487P40259B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b) Homo sapiens (Human) 181 229 203 214 12 QTATYEDIVTLR 86.29
DP01487P40259B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b) Homo sapiens (Human) 181 229 216 222 7 GEVKWSV 87.29
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 83 41 57 17 SLEEYNSLEETAYLLRS 91.97
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 55 41 50 10 SLEEYNSLEE 91.97
DP01489Q9UBK2Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) Homo sapiens (Human) 2 220 60 97 38 DQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLD 88.96
DP01489Q9UBK2Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) Homo sapiens (Human) 2 220 154 161 8 TQLSYNEC 95.65
DP01489Q9UBK2Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) Homo sapiens (Human) 2 220 209 215 7 ELLKYLT 87.96
DP01490Q9NR61Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4) Homo sapiens (Human) 553 685 668 674 7 SVCLISE 93.31
DP01491P22059Oxysterol-binding protein 1 Homo sapiens (Human) 346 379 355 368 14 DENEFFDAPEIITM 86.96
DP01492Q01097Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) Mus musculus (Mouse) 1259 1482 1399 1406 8 SKSYFFRQ 86.96
DP01495P08510Potassium voltage-gated channel protein Shaker (Protein minisleep) Drosophila melanogaster (Fruit fly) 513 655 581 592 12 LQQLTQTQLYQQ 91.39
DP01497Q9NK80Gliotactin Drosophila melanogaster (Fruit fly) 750 956 756 769 14 SDRFYDEDVFINGE 93.02
DP01497Q9NK80Gliotactin Drosophila melanogaster (Fruit fly) 750 956 795 803 9 RDNIYEYRD 90.41
DP01498O70480Vesicle-associated membrane protein 4 (VAMP-4) Mus musculus (Mouse) 47 117 60 76 17 VDEVIDVMQENITKVIE 92.6
DP01498O70480Vesicle-associated membrane protein 4 (VAMP-4) Mus musculus (Mouse) 47 117 94 102 9 NATAFSNRS 85.62
DP01501G3V7P1Syntaxin-12 (Syntaxin-13) Rattus norvegicus (Rat) 182 250 198 210 13 VNQIFKDLAMMIH 88.29
DP01501G3V7P1Syntaxin-12 (Syntaxin-13) Rattus norvegicus (Rat) 182 250 239 245 7 RAAYYQK 91.97
DP01502P33328Synaptobrevin homolog 2 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 91 64 74 11 DNLAISAQGFK 86.96
DP01503P32867Protein SSO1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 192 265 210 217 8 LTQLFNDM 96.99
DP01504P39926Protein SSO2 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 196 269 214 221 8 LTQLFNDM 96.99
DP01505P0AGB6ECF RNA polymerase sigma-E factor (RNA polymerase sigma-E factor) (Sigma-24) Escherichia coli (strain K12) 67 90 67 85 19 DSAFYTWLYRIAVNTAKNY 88.82
DP01508Q15418Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) Homo sapiens (Human) 683 735 698 708 11 MAATYSALNSS 91.97
DP01508Q15418Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) Homo sapiens (Human) 683 735 717 723 7 IESSILA 85.28
DP01508Q15418Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) Homo sapiens (Human) 696 735 698 708 11 MAATYSALNSS 91.97
DP01508Q15418Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) Homo sapiens (Human) 696 735 717 723 7 IESSILA 85.28
DP01509P9WIP5Protein MbtH Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 71 10 27 18 NGAFFVLVNDEDQHSLWP 87.48
DP01511P32917Protein STE5 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 147 238 190 202 13 GEKIIELACGHLS 85.28
DP01511P32917Protein STE5 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 147 238 204 215 12 QECLIISFGTTS 88.32
DP01512P03050Transcriptional repressor arc Salmonella phage P22 (Bacteriophage P22) 1 53 33 39 7 VNSEIYQ 91.3
DP01516Q06810Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 194 333 195 206 12 RASNILPIAYIP 91.97
DP01516Q06810Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 194 333 264 272 9 DDNLITAIR 91.97
DP01516Q06810Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 194 333 276 290 15 KLVQIAEEESDKEIQ 90.64
DP01517Q06710Paired box protein Pax-8 Homo sapiens (Human) 1 27 16 22 7 LGGAFVN 85.95
DP01518P26367Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) Homo sapiens (Human) 1 130 83 91 9 VVSKIAQYK 88.29
DP01518P26367Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) Homo sapiens (Human) 1 130 96 103 8 SIFAWEIR 91.47
DP01518P26367Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) Homo sapiens (Human) 1 130 119 125 7 SVSSINR 87.63
DP01521Q5RJL0Ermin (Juxtanodin) (JN) Rattus norvegicus (Rat) 1 282 37 43 7 ETQTYYG 91.5
DP01521Q5RJL0Ermin (Juxtanodin) (JN) Rattus norvegicus (Rat) 1 282 83 103 21 EENLFVVHQAIQDLSLQETSA 89.11
DP01521Q5RJL0Ermin (Juxtanodin) (JN) Rattus norvegicus (Rat) 1 282 162 169 8 SQVDILHS 86.96
DP01521Q5RJL0Ermin (Juxtanodin) (JN) Rattus norvegicus (Rat) 1 282 252 265 14 SYSRYNTISYRKIR 88.8
DP01524Q9UM11Fizzy-related protein homolog (Fzr) (CDC20-like protein 1) (Cdh1/Hct1 homolog) (hCDH1) Homo sapiens (Human) 1 41 11 21 11 RQIVIQNENTM 87.29
DP01526Q9UJX6Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2) Homo sapiens (Human) 731 822 750 784 35 ELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTG 96.32
DP01526Q9UJX6Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2) Homo sapiens (Human) 731 822 786 800 15 ALAEIDLQELQGYLQ 90.97
DP01526Q9UJX6Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2) Homo sapiens (Human) 731 822 806 817 12 QQLVYSAGVYRL 91.25
DP01527Q57904Uncharacterized protein MJ0480 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 46 101 60 69 10 EIQEFQVKFK 89.9
DP01527Q57904Uncharacterized protein MJ0480 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 46 101 84 95 12 EQQRIMQLNAEL 85.28
DP01531O75554WW domain-binding protein 4 (WBP-4) (Formin-binding protein 21) (WW domain-containing-binding protein 4) Homo sapiens (Human) 276 376 317 326 10 TENEYVSTSE 91.97
DP01533Q9NS23Ras association domain-containing protein 1 Homo sapiens (Human) 1 50 31 37 7 LEQYFTA 96.32
DP01534Q07889Son of sevenless homolog 1 (SOS-1) Homo sapiens (Human) 1141 1300 1244 1251 8 HGNAFFPN 87.63
DP01537O00429Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) Homo sapiens (Human) 514 613 595 601 7 HAVNLLD 87.63
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 9 19 11 AEQLENLNIQD 86.9
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 51 62 12 EAHLYDIFSPIG 87.88
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 79 87 9 LGYAYVNFN 96.88
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 97 103 7 EQLNYTP 96.32
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 124 132 9 GSGNIFIKN 86.81
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 139 158 20 NKALYDTFSVFGDILSSKIA 88.03
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 169 177 9 GFVHFEEEG 96.99
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 192 199 8 NGQEIYVA 97.37
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 218 230 13 YTNLYVKNINSET 92.59
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 235 250 16 FQELFAKFGPIVSASL 89.17
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 262 268 7 GFVNYEK 99
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 320 329 10 QGVNLFVKNL 96.12
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 338 351 14 LEEEFAPYGTITSA 87.29
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 365 371 7 GFVCFST 94.31
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 407 424 18 LAQQIQARNQMRYQQATA 85.51
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 497 503 7 NNQFYQQ 86.53
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 526 535 10 AAGKITGMIL 86.62
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 548 557 10 SDELFEQHYK 87.56
DP01538P04147Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 577 559 567 9 ASAAYESFK 86.96
DP01539O57173Protein F1 Vaccinia virus (strain Ankara) (VACV) 1 50 1 14 14 MLSMFMCNNIVDYV 91.23
DP01539O57173Protein F1 Vaccinia virus (strain Ankara) (VACV) 1 50 31 37 7 HDYVYPL 85.95
DP01540O00429Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) Homo sapiens (Human) 503 610 508 514 7 MNNNIEE 87.96
DP01541Q9DBZ9Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1) Mus musculus (Mouse) 1 267 107 115 9 AGEIWYNPI 97.51
DP01541Q9DBZ9Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1) Mus musculus (Mouse) 1 267 197 205 9 AGSVISRYR 87.29
DP01542P06401Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) Homo sapiens (Human) 1 566 373 381 9 AYPLYSDFQ 88.29
DP01542P06401Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) Homo sapiens (Human) 1 566 457 464 8 TLECILYK 86.79
DP01542P06401Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) Homo sapiens (Human) 1 566 540 546 7 PYLNYLR 91.64
DP01542P06401Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) Homo sapiens (Human) 165 545 373 381 9 AYPLYSDFQ 88.29
DP01542P06401Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) Homo sapiens (Human) 165 545 457 464 8 TLECILYK 86.79
DP01542P06401Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) Homo sapiens (Human) 165 535 373 381 9 AYPLYSDFQ 88.29
DP01542P06401Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) Homo sapiens (Human) 165 535 457 464 8 TLECILYK 86.79
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1052 1069 18 STFISNVLSKIGEVWASH 86.96
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1074 1081 8 GVSLFNSP 97.99
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1130 1137 8 QCLEFIQQ 87.25
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1193 1199 7 GFAEFTP 91.97
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1257 1263 7 AFVSTSF 86.96
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1393 1401 9 AVEAFSELS 91.97
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1409 1418 10 AEASFAVSSV 86.96
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1519 1534 16 EIHLIGCENLEVQNSE 86.62
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1556 1566 11 NLSTIEQQFCD 91.97
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1582 1598 17 DGELFVAQSNFTLILEG 92.6
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 1660 1674 15 VKVAIAENLLDVIKD 90.97
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 2016 2022 7 ALVVTSK 86.62
DP01548Q8CJF7Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Mus musculus (Mouse) 1018 2243 2159 2165 7 PLEIIEQ 86.62
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1051 1069 19 RSVFINNVLSKIGEVWASK 89.67
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1130 1140 11 QCSEFIQQSSM 85.95
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1193 1203 11 GFSEFTPQSIL 91.97
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1251 1258 8 KLEVFTTP 86.96
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1276 1284 9 TTSFFLNSP 86.51
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1308 1323 16 SSVSITSDETTLEYQD 86.35
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1391 1402 12 AAEAFSELNHLS 87.96
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1417 1423 7 YEGKIFT 85.28
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1480 1487 8 QEVALNLK 86.96
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1553 1566 14 LQYNFDTIDQQFCD 88.84
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1582 1598 17 DGELFVAQSNFTLILEG 92.6
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1664 1678 15 IKVAIAENLLDVIKD 88.29
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1700 1706 7 VSQNIMC 92.98
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1785 1792 8 ASENIYSD 94.61
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1883 1889 7 ESVEIIN 95.51
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 1961 1970 10 VQAEFDMSAI 88.29
DP01549Q8WYP5Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) Homo sapiens (Human) 1018 2266 2149 2155 7 SQFVISP 88.01
DP01555Q9EPU7Zinc finger protein 354C (Protein AJ18) Rattus norvegicus (Rat) 4 91 19 31 13 VAVSFSQDEWLHL 91.97
DP01555Q9EPU7Zinc finger protein 354C (Protein AJ18) Rattus norvegicus (Rat) 4 91 43 60 18 MLENYSNLASLGFQASIP 87.01
DP01556Q96GC6Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) Homo sapiens (Human) 4 246 43 51 9 MLENYRNLV 90.64
DP01556Q96GC6Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) Homo sapiens (Human) 4 246 111 117 7 VEVLTLN 87.96
DP01556Q96GC6Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) Homo sapiens (Human) 4 246 128 140 13 IQALYAEDGSLSA 97.99
DP01556Q96GC6Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) Homo sapiens (Human) 4 246 203 212 10 LLVLEQFLGA 86.96
DP01556Q96GC6Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) Homo sapiens (Human) 4 77 43 51 9 MLENYRNLV 90.64
DP01557P27682Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide Rattus norvegicus (Rat) 25 210 88 102 15 NIPNIVAELTGDNIP 86.89
DP01557P27682Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide Rattus norvegicus (Rat) 25 210 163 169 7 KKLLYEK 85.28
DP01558Q9XTY3C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2) Caenorhabditis elegans 17 211 35 41 7 FIDLISR 88.29
DP01558Q9XTY3C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2) Caenorhabditis elegans 17 211 147 155 9 SLQKILEEN 88.29
DP01559Q04964Ribonucleotide reductase inhibitor protein SML1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 104 4 14 11 SQDYFYAQNRC 96.5
DP01560Q9UMR2ATP-dependent RNA helicase DDX19B (EC 3.6.4.13) (DEAD box RNA helicase DEAD5) (DEAD box protein 19B) Homo sapiens (Human) 55 91 58 82 25 AQSLLNKLIRSNLVDNTNQVEVLQR 91.64
DP01561P08235Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) Homo sapiens (Human) 1 169 38 49 12 DENNYMEIVNVS 90.89
DP01561P08235Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) Homo sapiens (Human) 1 169 115 125 11 ADYSYEQQNQQ 89.97
DP01561P08235Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) Homo sapiens (Human) 1 169 139 145 7 QLVKFYK 94.98
DP01561P08235Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) Homo sapiens (Human) 247 385 337 345 9 VNNAFSYTA 91.27
DP01571Q88QP8Elongation factor Tu-A (EF-Tu-A) Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) 40 62 40 51 12 FGSAIVEFDKID 95.23
DP01574C6KSX0Merozoite surface protein P12 Cleaved into: Merozoite surface protein P12; processed form Plasmodium falciparum (isolate 3D7) 84 116 98 108 11 KEFVIGSSMFM 89.3
DP01576O14777Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC) Homo sapiens (Human) 1 79 26 32 7 KQGLYTP 94.31
DP01578P41969ETS domain-containing protein Elk-1 Mus musculus (Mouse) 320 429 378 387 10 HFWSTLSPIA 86.29
DP01578P41969ETS domain-containing protein Elk-1 Mus musculus (Mouse) 320 429 404 418 15 AQVHIPSISVDGLST 94.31
DP01578P41969ETS domain-containing protein Elk-1 Mus musculus (Mouse) 320 428 378 387 10 HFWSTLSPIA 86.29
DP01578P41969ETS domain-containing protein Elk-1 Mus musculus (Mouse) 320 428 404 418 15 AQVHIPSISVDGLST 94.31
DP01584P19880AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 565 650 632 645 14 RGVVINAEDVQLAL 88.89
DP01590Q92945Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75) Homo sapiens (Human) 130 218 155 161 7 MVGLIIG 91.93
DP01593P21374Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 96 235 164 170 7 NDFYYHG 97.66
DP01593P21374Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 96 235 179 192 14 FEANWTSILKAHYN 85.28
DP01593P21374Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 97 235 164 170 7 NDFYYHG 97.66
DP01593P21374Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 97 235 179 192 14 FEANWTSILKAHYN 85.28
DP01594Q80ZV0Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B) Mus musculus (Mouse) 182 266 187 194 8 QSSAYFSG 87.5
DP01594Q80ZV0Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B) Mus musculus (Mouse) 182 266 204 218 15 DYVRYAHGLISDYIP 89.97
DP01594Q80ZV0Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B) Mus musculus (Mouse) 182 202 187 194 8 QSSAYFSG 87.5
DP01594Q80ZV0Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B) Mus musculus (Mouse) 283 308 294 300 7 IDAFFGA 88.29
DP01600Q93KQ4Regulatory protein YscM2 (YscM2) Yersinia enterocolitica 51 81 57 70 14 AKNTILNRQDVAKL 85.62
DP01601P26599Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) Homo sapiens (Human) 411 458 445 451 7 NFQNIFP 92.93
DP01602Q86WV6Stimulator of interferon genes protein (hSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (hMITA) (Transmembrane protein 173) Homo sapiens (Human) 344 379 361 367 7 PELLISG 86.96
DP01602Q86WV6Stimulator of interferon genes protein (hSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (hMITA) (Transmembrane protein 173) Homo sapiens (Human) 359 379 361 367 7 PELLISG 86.96
DP01606Q06208Protein RIF2 (RAP1-interacting factor 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 152 186 167 180 14 GQASYSGQLDFEAS 91.3
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 395 2 11 10 EYWHYVETTS 97.66
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 395 22 28 7 KDIFIDQ 91.97
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 395 46 59 14 RIFLTSQRIIYIDD 91.5
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 395 72 96 25 DDLAYVNYSSGFLTRSPRLILFFKD 96.43
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 395 114 123 10 VVSTWVCPIC 87.63
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 395 264 271 8 DGVLFSQA 92.98
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 395 275 298 24 ALENILTEKNKHIFNQNVVSVNGV 91.16
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 395 339 371 33 NDILFNNALTDLNKLMSLATSIERLYKNSNITM 95.87
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 203 395 264 271 8 DGVLFSQA 92.98
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 203 395 275 298 24 ALENILTEKNKHIFNQNVVSVNGV 91.16
DP01611Q06696Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 203 395 339 371 33 NDILFNNALTDLNKLMSLATSIERLYKNSNITM 95.87
DP01613Q96AC1Fermitin family homolog 2 (Kindlin-2) (Mitogen-inducible gene 2 protein) (MIG-2) (Pleckstrin homology domain-containing family C member 1) (PH domain-containing family C member 1) Homo sapiens (Human) 328 367 351 358 8 SDLEITLE 87.63
DP01616P10104Fibritin (Collar protein) (Whisker antigen control protein) Enterobacteria phage T4 (Bacteriophage T4) 372 484 378 391 14 AVQNLQVEIGNNSA 93.36
DP01616P10104Fibritin (Collar protein) (Whisker antigen control protein) Enterobacteria phage T4 (Bacteriophage T4) 372 484 396 407 12 QVVALNTLVNGT 87.63
DP01616P10104Fibritin (Collar protein) (Whisker antigen control protein) Enterobacteria phage T4 (Bacteriophage T4) 372 484 426 448 23 NETNIASVTQEVNTAKGNISSLQ 87.55
DP01618P03070Large T antigen (LT) (LT-AG) (EC 3.6.4.-) Simian virus 40 (SV40) 82 130 91 107 17 WEQWWNAFNEENLFCSE 90.14
DP01621E5LC01LANA "Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)" 1065 1117 1087 1095 9 LQSSIVKFK 89.3
DP01622Q06609DNA repair protein RAD51 homolog 1 (HsRAD51) (hRAD51) (RAD51 homolog A) Homo sapiens (Human) 86 114 96 105 10 RSEIIQITTG 86.89
DP01623Q03834DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 304 29 36 8 SLLSFFSK 94.36
DP01623Q03834DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 304 83 95 13 NDLTIAEETVSTV 94.98
DP01623Q03834DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 304 217 224 8 KKFSYNTS 86.96
DP01623Q03834DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 304 276 282 7 RYQWLVD 87.29
DP01626Q01831DNA repair protein complementing XP-C cells (Xeroderma pigmentosum group C-complementing protein) (p125) Homo sapiens (Human) 815 940 818 834 17 KDVLLTAWENEQAVIER 86.41
DP01628P14736DNA repair protein RAD4 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 100 79 85 7 SVEEIQS 86.62
DP01628P14736DNA repair protein RAD4 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 633 754 645 656 12 ALESWNTLLLKL 86.96
DP01628P14736DNA repair protein RAD4 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 633 754 662 670 9 LNSTYGKIA 86.96
DP01631P07276DNA repair protein RAD2 (EC 3.1.-.-) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 642 760 666 672 7 SEELFED 87.63
DP01631P07276DNA repair protein RAD2 (EC 3.1.-.-) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 642 760 702 711 10 LIFDYDFSED 87.63
DP01631P07276DNA repair protein RAD2 (EC 3.1.-.-) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 642 760 723 739 17 EQEEFDTFKNTTLSTSA 86.62
DP01631P07276DNA repair protein RAD2 (EC 3.1.-.-) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 642 760 744 755 12 AENAFVEDELFE 91.14
DP01631P07276DNA repair protein RAD2 (EC 3.1.-.-) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 642 690 666 672 7 SEELFED 87.63
DP01639P17778Outer membrane protein YopM Yersinia pestis 1 33 7 15 9 NVSNTFLQE 86.77
DP01640Q13351Krueppel-like factor 1 (Erythroid krueppel-like transcription factor) (EKLF) Homo sapiens (Human) 51 90 76 84 9 DLLLTNFSG 87.77
DP01642P06492Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) 350 394 373 382 10 YGSTIEGLLD 85.62
DP01642P06492Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) 403 490 471 485 15 ADFEFEQMFTDALGI 94.98
DP01642P06492Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) 412 490 471 485 15 ADFEFEQMFTDALGI 94.98
DP01642P06492Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) 452 490 471 485 15 ADFEFEQMFTDALGI 94.98
DP01642P06492Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) 456 490 471 485 15 ADFEFEQMFTDALGI 94.98
DP01647P51449Nuclear receptor ROR-gamma (Nuclear receptor RZR-gamma) (Nuclear receptor subfamily 1 group F member 3) (RAR-related orphan receptor C) (Retinoid-related orphan receptor-gamma) Homo sapiens (Human) 479 518 482 499 18 RLQIFQHLHPIVVQAAFP 91.19
DP01647P51449Nuclear receptor ROR-gamma (Nuclear receptor RZR-gamma) (Nuclear receptor subfamily 1 group F member 3) (RAR-related orphan receptor C) (Retinoid-related orphan receptor-gamma) Homo sapiens (Human) 479 518 502 510 9 YKELFSTET 85.62
DP01654P3657860S ribosomal protein L4 (60S ribosomal protein L1) (Large ribosomal subunit protein uL4) Homo sapiens (Human) 80 114 88 96 9 GQGAFGNMC 87.96
DP01657Q5XJY5Coatomer subunit delta (Archain) (Delta-coat protein) (Delta-COP) Mus musculus (Mouse) 166 232 200 208 9 ITETIIETD 86.58
DP01658Q09882Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 100 315 132 138 7 GVGEISL 86.96
DP01658Q09882Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 100 315 156 162 7 ALQKILS 92.98
DP01658Q09882Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 100 315 182 188 7 VYIRYTP 86.62
DP01658Q09882Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 100 315 287 298 12 GFAKFSEALYTV 91.42
DP01658Q09882Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 316 557 325 332 8 EQRLFMLA 87.63
DP01661P70444BH3-interacting domain death agonist (p22 BID) (BID) Cleaved into: BH3-interacting domain death agonist p15 (p15 BID); BH3-interacting domain death agonist p13 (p13 BID); BH3-interacting domain death agonist p11 (p11 BID) Mus musculus (Mouse) 41 81 44 51 8 VQAYWEAD 86.04
DP01665Q5S1W7Prion protein (Fragment) Xenopus laevis (African clawed frog) 1 69 36 46 11 GQQPYNPSGYN 87.29
DP01667Q548Y4Nuclear transcription factor RelA (V-rel reticuloendotheliosis viral oncogene homolog A (Avian)) Mus musculus (Mouse) 426 490 473 483 11 FQQLLNQGVSM 90.97
DP01675O75928E3 SUMO-protein ligase PIAS2 (EC 2.3.2.-) (Androgen receptor-interacting protein 3) (ARIP3) (DAB2-interacting protein) (DIP) (E3 SUMO-protein transferase PIAS2) (Msx-interacting zinc finger protein) (Miz1) (PIAS-NY protein) (Protein inhibitor of activated STAT x) (Protein inhibitor of activated STAT2) Homo sapiens (Human) 427 488 470 478 9 IDLTIESSS 90.3
DP01705Q07666KH domain-containing; RNA-binding; signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68) Homo sapiens (Human) 135 156 141 151 11 DEENYLDLFSH 88.99
DP01705Q07666KH domain-containing; RNA-binding; signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68) Homo sapiens (Human) 390 419 392 400 9 GDSEYYDYG 87.89
DP01716P0AD49Ribosome-associated inhibitor A (Protein Y) (pY) (Ribosome associated factor Y) (Spot Y) Escherichia coli (strain K12) 91 113 102 108 7 KDANFVE 89.39
DP01731O75143Autophagy-related protein 13 Homo sapiens (Human) 384 517 462 471 10 DLGTFYREFQ 86.96
DP01732Q06628Autophagy-related protein 13 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 268 738 270 276 7 NDELFSA 94.98
DP01732Q06628Autophagy-related protein 13 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 268 738 391 398 8 NSSFFNQP 91.97
DP01732Q06628Autophagy-related protein 13 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 268 738 490 504 15 NINISDSLIRYQNLK 86.76
DP01732Q06628Autophagy-related protein 13 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 268 738 607 615 9 HDNKIQKYN 92.31
DP01732Q06628Autophagy-related protein 13 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 268 738 723 733 11 DDLVFFMSDMN 97.08
DP01748P05556Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29) Homo sapiens (Human) 752 798 752 758 7 KLLMIIH 86.91
DP01748P05556Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29) Homo sapiens (Human) 752 795 752 758 7 KLLMIIH 86.91
DP01751O43172U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4) Homo sapiens (Human) 1 169 61 80 20 EAGNINITSGEVFEIEEHIS 88.46
DP01751O43172U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4) Homo sapiens (Human) 1 169 132 139 8 RLRNILSV 85.28
DP01752Q60598Src substrate cortactin Mus musculus (Mouse) 83 324 137 143 7 VGFEYQG 91.97
DP01752Q60598Src substrate cortactin Mus musculus (Mouse) 83 324 211 217 7 VGFEYQG 91.97
DP01754Q8BHZ5Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog) Mus musculus (Mouse) 1 157 69 75 7 LGILIEG 90.3
DP01754Q8BHZ5Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog) Mus musculus (Mouse) 1 157 146 152 7 DALKYVR 89.35
DP01759Q0GBY3Phosphoprotein (Protein P) (Protein M1) Rabies virus (strain China/MRV) (RABV) 1 68 24 33 10 TVDLINRNIE 88.96
DP01762P03714Head-tail connector protein FII (Head-tail joining protein) (Minor capsid protein FII) Escherichia phage lambda (Bacteriophage lambda) 1 24 4 19 16 FDNLFDAAIARADETI 90.84
DP01763E6Y5X0Urease (EC 3.5.1.5) (Urea amidohydrolase) Canavalia ensiformis (Jack bean) (Dolichos ensiformis) 232 321 298 310 13 LIAEIEKDFALYG 90.84
DP01765Q9NQA5Transient receptor potential cation channel subfamily V member 5 (TrpV5) (Calcium transport protein 2) (CaT2) (Epithelial calcium channel 1) (ECaC) (ECaC1) (Osm-9-like TRP channel 3) (OTRPC3) Homo sapiens (Human) 587 725 699 720 22 RGWEILRQNTLGHLNLGLNLSE 87.96
DP01767Q9H1D0Transient receptor potential cation channel subfamily V member 6 (TrpV6) (CaT-like) (CaT-L) (Calcium transport protein 1) (CaT1) (Epithelial calcium channel 2) (ECaC2) Homo sapiens (Human) 655 725 683 694 12 RIQRYAQAFHTR 86.4
DP01769Q8WUG5Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR) Homo sapiens (Human) 1 105 83 93 11 TTNAIGQWDLV 86.62
DP01770P50402Emerin Homo sapiens (Human) 1 187 37 44 8 KIFEYETQ 96.32
DP01770P50402Emerin Homo sapiens (Human) 1 187 55 67 13 AASSYSFSDLNST 91.3
DP01770P50402Emerin Homo sapiens (Human) 1 187 81 87 7 DALLYQS 94.65
DP01770P50402Emerin Homo sapiens (Human) 1 187 91 106 16 NDDYYEESYFTTRTYG 89.86
DP01770P50402Emerin Homo sapiens (Human) 1 187 157 168 12 RDSAYQSITHYR 90.89
DP01770P50402Emerin Homo sapiens (Human) 67 170 81 87 7 DALLYQS 94.65
DP01770P50402Emerin Homo sapiens (Human) 67 170 91 106 16 NDDYYEESYFTTRTYG 89.86
DP01770P50402Emerin Homo sapiens (Human) 67 170 157 165 9 RDSAYQSIT 90.52
DP01772Q07912Activated CDC42 kinase 1 (ACK-1) (EC 2.7.10.2) (EC 2.7.11.1) (Tyrosine kinase non-receptor protein 2) Homo sapiens (Human) 448 489 458 466 9 LQNSFIHTG 87.96
DP01775P53632Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 160 44 50 7 NEVEILP 95.65
DP01775P53632Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 160 67 75 9 ADGILVLEH 85.28
DP01775P53632Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 160 82 91 10 GFDVYDGHFD 85.28
DP01775P53632Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 160 120 130 11 NDDFISLSASS 86.65
DP01775P53632Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 482 584 563 569 7 GETYITV 88.29
DP01776Q8GYN5RPM1-interacting protein 4 Arabidopsis thaliana (Mouse-ear cress) 1 211 8 25 18 KFGNWEAEENVPYTAYFD 87.85
DP01776Q8GYN5RPM1-interacting protein 4 Arabidopsis thaliana (Mouse-ear cress) 1 211 164 172 9 GYTHIFNKV 89.67
DP01777Q3LS93Uncharacterized protein Strongylocentrotus purpuratus (Purple sea urchin) 22 329 125 131 7 AAQQIGD 85.28
DP01779Q05917Homeobox protein engrailed-2 (Gg-En-2) (Homeobox protein en-2) Gallus gallus (Chicken) 146 199 170 179 10 PAWVYCTRYS 87.29
DP01780P21736Protein E7 Human papillomavirus 45 1 54 7 16 10 TLQEIVLHLE 94.31
DP01781O75112LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein) Homo sapiens (Human) 85 283 162 171 10 SQDAIMDAIA 85.62
DP01781O75112LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein) Homo sapiens (Human) 85 283 199 206 8 YQAVIKSQ 86.96
DP01782Q53GG5PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein) Homo sapiens (Human) 107 273 110 116 7 QDGNYFE 88.01
DP01782Q53GG5PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein) Homo sapiens (Human) 107 273 188 206 19 AQFNTPMQLYSDDNIMETL 86.22
DP01783Q2JIZ5Sensor histidine kinase "Synechococcus sp. (strain JA-2-3Ba(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime)" 1 30 14 22 9 RDALINRIT 87.85
DP01785Q87P35Uncharacterized protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) 1 125 63 70 8 IVVNLLTK 87.29
DP01786D2JX42Abscisic stress ripening Musa AAB Group 1 143 20 31 12 AEEVIYSETAYS 97.41
DP01786D2JX42Abscisic stress ripening Musa AAB Group 1 143 76 85 10 AAGAFALYEK 95.65
DP01787A0A1Z3GD05Abcissic acid stress ripening Hordeum vulgare (Barley) 1 138 71 80 10 AAGAFALYEK 95.65
DP01789A0A1Z3GD08Abcissic acid stress ripening Triticum turgidum subsp. durum (Durum wheat) (Triticum durum) 1 136 42 50 9 NDGEYERIT 86.62
DP01789A0A1Z3GD08Abcissic acid stress ripening Triticum turgidum subsp. durum (Durum wheat) (Triticum durum) 1 136 69 78 10 AAGAFALYEK 95.65
DP01791A0ZWU1Ell1-associated factor 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 158 251 201 209 9 FDQEFNSID 88.85
DP01796Q9NS91E3 ubiquitin-protein ligase RAD18 (EC 2.3.2.27) (Postreplication repair protein RAD18) (hHR18) (hRAD18) (RING finger protein 73) (RING-type E3 ubiquitin transferase RAD18) Homo sapiens (Human) 339 366 349 355 7 EFQLLVD 87.29
DP01797O96017Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2) Homo sapiens (Human) 64 90 68 75 8 TQELYSIP 97.99
DP01799P49790Nuclear pore complex protein Nup153 (153 kDa nucleoporin) (Nucleoporin Nup153) Homo sapiens (Human) 1313 1390 1340 1346 7 GFGSISS 87.96
DP01801P04985Elastin (Tropoelastin) Bos taurus (Bovine) 1 747 13 22 10 VLLLLLCILQ 87.09
DP01801P04985Elastin (Tropoelastin) Bos taurus (Bovine) 1 747 100 106 7 AAAAYKA 89.3
DP01801P04985Elastin (Tropoelastin) Bos taurus (Bovine) 1 747 193 201 9 GAGAFAGIP 88.96
DP01805P40855Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) Homo sapiens (Human) 1 165 60 88 29 KDALFASQEKFFQELFDSELASQATAEFE 92.87
DP01805P40855Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) Homo sapiens (Human) 1 165 121 128 8 SQQEFTSC 90.97
DP01805P40855Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) Homo sapiens (Human) 4 182 60 88 29 KDALFASQEKFFQELFDSELASQATAEFE 92.87
DP01805P40855Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) Homo sapiens (Human) 4 182 121 128 8 SQQEFTSC 90.97
DP01805P40855Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) Homo sapiens (Human) 4 182 167 177 11 GEGNILPIMQS 90.15
DP01806Q67953Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen) Hepatitis B virus (HBV) 1 108 1 25 25 MQLIITSKLGIIYILCGRLAFYIRE 91
DP01825P25644DNA topoisomerase 2-associated protein PAT1 (Decapping activator and translational repressor PAT1) (Topoisomerase II-associated protein PAT1) (mRNA turnover protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 422 469 456 464 9 SSYAFNNGN 87.63
DP01833P85800Variegin Amblyomma variegatum (Tropical bont tick) 1 32 19 27 9 DFEAIPEEY 86.62
DP01833P85800Variegin Amblyomma variegatum (Tropical bont tick) 8 32 19 27 9 DFEAIPEEY 86.62
DP01833P85800Variegin Amblyomma variegatum (Tropical bont tick) 11 32 19 27 9 DFEAIPEEY 86.62
DP01840P38968Protein transport protein SEC31 (Protein WEB1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 770 1100 874 882 9 PQNTFAPIQ 85.95
DP01840P38968Protein transport protein SEC31 (Protein WEB1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 770 1100 1032 1038 7 AQVASSN 88.29
DP01841P08514Integrin alpha-IIb (GPalpha IIb) (GPIIb) (Platelet membrane glycoprotein IIb) (CD antigen CD41) Cleaved into: Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; form 1; Integrin alpha-IIb light chain; form 2 Homo sapiens (Human) 989 1039 1007 1027 21 GLLLLTILVLAMWKVGFFKRN 94.12
DP01842P05106Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) Homo sapiens (Human) 741 788 741 748 8 WKLLITIH 87.04
DP01842P05106Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) Homo sapiens (Human) 741 788 776 783 8 ATSTFTNI 90.59
DP01842P05106Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) Homo sapiens (Human) 742 788 776 783 8 ATSTFTNI 90.59
DP01842P05106Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) Homo sapiens (Human) 762 788 776 783 8 ATSTFTNI 90.59
DP01842P05106Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) Homo sapiens (Human) 763 788 776 783 8 ATSTFTNI 90.59
DP01844Q92540Protein SMG7 (EST1-like protein C) (SMG-7 homolog) (hSMG-7) Homo sapiens (Human) 111 143 125 131 7 QLGIISN 94.31
DP01849O60260E3 ubiquitin-protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2) Homo sapiens (Human) 109 142 118 126 9 GLAVILHTD 90.97
DP01850Q9JK66E3 ubiquitin-protein ligase parkin (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) Rattus norvegicus (Rat) 76 141 118 125 8 GLAVILDT 88.63
DP01852P04480Colicin-A Citrobacter freundii 1 172 2 8 7 PGFNYGG 86.62
DP01852P04480Colicin-A Citrobacter freundii 1 172 63 70 8 GKVIINAA 97.32
DP01852P04480Colicin-A Citrobacter freundii 1 172 121 128 8 AVENYLMV 86.79
DP01852P04480Colicin-A Citrobacter freundii 21 107 63 70 8 GKVIINAA 97.32
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 1 200 21 30 10 PAFKYQFVRE 85.95
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 210 408 293 299 7 SELEYSE 87.96
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 210 408 335 347 13 VSNNILHNQQELP 91.64
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 210 358 293 299 7 SELEYSE 87.96
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 210 358 335 347 13 VSNNILHNQQELP 91.64
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 359 566 458 468 11 SGAYITCAPFN 85.53
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 359 566 471 483 13 ATESIATNIFPLL 87.99
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 409 616 458 468 11 SGAYITCAPFN 85.53
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 409 616 471 483 13 ATESIATNIFPLL 87.99
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 567 774 642 650 9 SSVNYESIK 92.31
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 567 748 642 650 9 SSVNYESIK 92.31
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 617 824 642 650 9 SSVNYESIK 92.31
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 775 1016 837 851 15 TAVYSNDDLFISKEA 91.97
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 775 1016 864 876 13 PIEIIDEFPTLIS 87.63
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 775 1016 928 936 9 VEEKISFSD 86.62
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 775 1016 960 968 9 TQAEIESIV 87.51
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 825 1016 837 851 15 TAVYSNDDLFISKEA 91.97
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 825 1016 864 876 13 PIEIIDEFPTLIS 87.63
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 825 1016 928 936 9 VEEKISFSD 86.62
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 825 1016 960 968 9 TQAEIESIV 87.51
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 1055 1094 1060 1068 9 VIQAIQKSD 96.32
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 1055 1094 1079 1089 11 SEVAISEELVQ 93.92
DP01855Q9NQC3Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Homo sapiens (Human) 1155 1187 1176 1182 7 AMAKIQA 85.28
DP01858Q96270Late embryogenesis abundant protein 7 Arabidopsis thaliana (Mouse-ear cress) 1 169 97 103 7 DAAEYTK 86.62
DP01859Q5NJL5Late embryogenesis abundant protein Pisum sativum (Garden pea) 1 358 7 18 12 TRNAIFRFSKSF 90.3
DP01859Q5NJL5Late embryogenesis abundant protein Pisum sativum (Garden pea) 1 358 55 63 9 MDWAYNSTS 98.66
DP01859Q5NJL5Late embryogenesis abundant protein Pisum sativum (Garden pea) 1 358 286 293 8 AQGAWETA 86.37
DP01863O75533Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) Homo sapiens (Human) 1 462 35 45 11 STGYYDQEIYG 91.88
DP01863O75533Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) Homo sapiens (Human) 1 462 53 65 13 GYVTSIAATELED 85.28
DP01864Q9XTN4Brinker (Brk) (Putative transcription factor) (RE18244p) Drosophila melanogaster (Fruit fly) 1 101 54 62 9 LQVLESYRN 88.29
DP01864Q9XTN4Brinker (Brk) (Putative transcription factor) (RE18244p) Drosophila melanogaster (Fruit fly) 1 101 83 93 11 QIQKWLQCESN 86.62
DP01864Q9XTN4Brinker (Brk) (Putative transcription factor) (RE18244p) Drosophila melanogaster (Fruit fly) 43 101 54 62 9 LQVLESYRN 88.29
DP01864Q9XTN4Brinker (Brk) (Putative transcription factor) (RE18244p) Drosophila melanogaster (Fruit fly) 43 101 83 93 11 QIQKWLQCESN 86.62
DP01867P47047ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 672 809 678 684 7 RLVEISV 91.97
DP01867P47047ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 672 809 694 703 10 AVVDFAKRIN 87.29
DP01867P47047ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 672 809 708 729 22 SAVYTDHESYIVNVVVNTMYID 91.06
DP01869P51587Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) Homo sapiens (Human) 48 284 53 61 9 KNNNYEPNL 88.29
DP01869P51587Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) Homo sapiens (Human) 48 284 229 237 9 VKSYFSNHD 87.29
DP01869P51587Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) Homo sapiens (Human) 48 284 243 257 15 NDRFIASVTDSENTN 88.63
DP01870P84040Histone H4 Drosophila melanogaster (Fruit fly) 22 102 47 55 9 ISGLIYEET 90.56
DP01870P84040Histone H4 Drosophila melanogaster (Fruit fly) 22 102 60 75 16 KVFLENVIRDAVTYTE 91.24
DP01870P84040Histone H4 Drosophila melanogaster (Fruit fly) 22 102 85 92 8 MDVVYALK 97.32
DP01874O95149Snurportin-1 (RNA U transporter 1) Homo sapiens (Human) 288 348 305 311 7 QLQQIME 87.29
DP01875Q2GI62120 kDa immunodominant surface protein Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) 142 221 181 192 12 AQVVTERESEIE 86.29
DP01880Q15596Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2) Homo sapiens (Human) 624 829 641 648 8 LLQLLTTK 86.83
DP01880Q15596Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2) Homo sapiens (Human) 624 829 743 750 8 ALLRYLLD 87.96
DP01880Q15596Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2) Homo sapiens (Human) 624 829 805 811 7 NLEEILD 91.97
DP01883P02655Apolipoprotein C-II (Apo-CII) (ApoC-II) (Apolipoprotein C2) Cleaved into: Proapolipoprotein C-II (ProapoC-II) Homo sapiens (Human) 40 65 54 60 7 AAQNLYE 96.46
DP01890Q07930Pre-mRNA leakage protein 1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 61 22 29 8 KSQYIDIM 90.97
DP01890Q07930Pre-mRNA leakage protein 1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 51 22 29 8 KSQYIDIM 90.97
DP01890Q07930Pre-mRNA leakage protein 1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 22 42 22 29 8 KSQYIDIM 90.97
DP01919Q9V0U0Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-) Pyrococcus abyssi (strain GE5 / Orsay) 513 633 530 551 22 AFQLYLEGKIAKEAFEEIFKEL 88.02
DP01919Q9V0U0Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-) Pyrococcus abyssi (strain GE5 / Orsay) 513 633 580 590 11 IEEVIQQNIEV 87.29
DP01920P77522FeS cluster assembly protein SufB Escherichia coli (strain K12) 1 33 22 28 7 KEGFFTQ 86.62
DP01920P77522FeS cluster assembly protein SufB Escherichia coli (strain K12) 80 156 84 93 10 NYQDYSYYSA 94.05
DP01920P77522FeS cluster assembly protein SufB Escherichia coli (strain K12) 80 156 114 132 19 GANAFLSKEVEAAFEQLGV 89.33
DP01920P77522FeS cluster assembly protein SufB Escherichia coli (strain K12) 80 156 141 151 11 AVDAIFDSVSV 92.76
DP01926C4M7X2Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase) Entamoeba histolytica 583 769 610 621 12 GFQLEIRVGKIV 87.18
DP01926C4M7X2Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase) Entamoeba histolytica 583 769 703 714 12 ADAAIGAQVIPK 88.43
DP01926C4M7X2Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase) Entamoeba histolytica 583 769 716 729 14 GKVTISAKKISIDV 88.29
DP01928P03254Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) 1 137 20 29 10 LDQLIEEVLA 96.32
DP01928P03254Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) 1 137 61 67 7 AVSQIFP 87
DP01937Q9EPH0Prestin (Solute carrier family 26 member 5) Rattus norvegicus (Rat) 564 636 583 592 10 GNANIANATV 91.97
DP01942P50553Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46) Homo sapiens (Human) 1 236 28 35 8 AACFFATA 96.99
DP01942P50553Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46) Homo sapiens (Human) 1 236 132 142 11 KLVNLGFATLR 85.28
DP01942P50553Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46) Homo sapiens (Human) 1 236 162 175 14 SAVEYIRALQQLLD 89.99
DP01943Q9NRY2SOSS complex subunit C (INTS3- and NABP-interacting protein) (Sensor of single-strand DNA complex subunit C) (Sensor of ssDNA subunit C) (SOSS-C) (Single-stranded DNA-binding protein-interacting protein 1) (SSB-interacting protein 1) (hSSBIP1) Homo sapiens (Human) 1 62 14 23 10 NRVAILAELD 90.97
DP01944P31324cAMP-dependent protein kinase type II-beta regulatory subunit Mus musculus (Mouse) 1 103 26 37 12 ADLLEFALQHFT 89.94
DP01944P31324cAMP-dependent protein kinase type II-beta regulatory subunit Mus musculus (Mouse) 1 103 72 79 8 KGVNFAEE 94.98
DP01944P31324cAMP-dependent protein kinase type II-beta regulatory subunit Mus musculus (Mouse) 394 416 400 408 9 QLVALFGTN 91.45
DP01948Q9HZJ8Cell division inhibitor SulA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) 1 42 15 23 9 FQEAFWASN 92.27
DP01951P04083Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) Homo sapiens (Human) 2 26 3 21 19 MVSEFLKQAWFIENEEQEY 89.24
DP01951P04083Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) Homo sapiens (Human) 116 185 136 142 7 TLIEILA 87.96
DP01963P19619Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) Sus scrofa (Pig) 1 41 3 25 23 MVSEFLKQAWFIDNEEQEYIKTV 92.54
DP01963P19619Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) Sus scrofa (Pig) 1 40 3 25 23 MVSEFLKQAWFIDNEEQEYIKTV 92.54
DP01968A4C1A5Cold shock protein; putative DNA-binding protein Polaribacter irgensii 23-P 1 86 4 12 9 SQQTFSKSE 92.64
DP01968A4C1A5Cold shock protein; putative DNA-binding protein Polaribacter irgensii 23-P 1 86 43 49 7 IQFAYVD 98.66
DP01968A4C1A5Cold shock protein; putative DNA-binding protein Polaribacter irgensii 23-P 1 86 63 76 14 LKVEYELEDIQISV 86.62
DP01969P27058Systemin Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 200 50 58 9 TISSYVLRD 92.64
DP01969P27058Systemin Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 200 83 92 10 TISQYIIKIE 90.03
DP01969P27058Systemin Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 200 101 116 16 LKVEYEEEEYEKEKIV 86.62
DP01969P27058Systemin Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 200 160 166 7 GALEITK 91.97
DP01969P27058Systemin Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 200 168 174 7 VCEKIIV 85.28
DP01971P01071Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) Glycine max (Soybean) (Glycine hispida) 1 181 13 30 18 NGGTYYILSDITAFGGIR 87.51
DP01971P01071Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) Glycine max (Soybean) (Glycine hispida) 1 181 53 60 8 GIGTIISS 90.97
DP01971P01071Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) Glycine max (Soybean) (Glycine hispida) 1 181 63 70 8 RIRFIAEG 86.96
DP01971P01071Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) Glycine max (Soybean) (Glycine hispida) 1 181 79 95 17 SFAVIMLCVGIPTEWSV 91.97
DP01971P01071Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) Glycine max (Soybean) (Glycine hispida) 1 181 114 121 8 VDGWFRIE 88.29
DP01971P01071Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) Glycine max (Soybean) (Glycine hispida) 1 181 127 142 16 EFNNYKLVFCTQQAED 91.97
DP01972P13693Translationally-controlled tumor protein (TCTP) (Fortilin) (Histamine-releasing factor) (HRF) (p23) Homo sapiens (Human) 37 68 39 56 18 TEGNIDDSLIGGNASAEG 89.8
DP01973Q09514GLOBIN domain-containing protein Caenorhabditis elegans 216 266 227 233 7 QHIEISE 85.28
DP01973Q09514GLOBIN domain-containing protein Caenorhabditis elegans 216 266 242 255 14 KQSEIENTAVSNEP 87.63
DP01975O74958RNA binding exosome specificity factor Mmi1 (Meiotic mRNA interception protein 1) (YTH domain-containing protein mmi1) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 282 327 289 296 8 SYLLSNSS 85.95
DP01977P49736DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28) Homo sapiens (Human) 1 160 133 139 7 RGLLYDS 87.63
DP01979Q6CMF0KLLA0E20769p Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) 1 39 1 17 17 MDQQFVAQLEQALGAIV 89.34
DP01983Q9Q8N4Probable host range protein 2-3 Myxoma virus (strain Lausanne) (MYXV) 151 203 176 184 9 TVHLYCLEE 88.29
DP01993Q80VP1Epsin-1 (EPS-15-interacting protein 1) (Intersectin-EH-binding protein 1) (Ibp1) Mus musculus (Mouse) 229 407 238 246 9 LQMAIEESK 87.63
DP01993Q80VP1Epsin-1 (EPS-15-interacting protein 1) (Intersectin-EH-binding protein 1) (Ibp1) Mus musculus (Mouse) 229 407 261 267 7 ADVFTTP 90.3
DP01996Q07009Calpain-2 catalytic subunit (EC 3.4.22.53) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (Calpain-2 large subunit) (Millimolar-calpain) (M-calpain) Rattus norvegicus (Rat) 437 459 442 454 13 GQTNIHLSKNFFL 87.75
DP01999Q8K4J6Myocardin-related transcription factor A (MRTF-A) (Basic SAP coiled-coil transcription activator) (MKL/myocardin-like protein 1) (Megakaryoblastic leukemia 1 protein homolog) (Megakaryocytic acute leukemia protein homolog) Mus musculus (Mouse) 111 142 131 137 7 KEAIIVG 94.84
DP02000O14745Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory factor 1) Homo sapiens (Human) 242 358 321 329 9 LDFNISLAM 98.33
DP02004Q92793CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Homo sapiens (Human) 674 1080 789 796 8 AQSQFLPQ 87.29
DP02004Q92793CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Homo sapiens (Human) 674 1080 964 970 7 AAASIDN 86.96
DP02004Q92793CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Homo sapiens (Human) 1852 2057 1969 1979 11 QQHLYRVNINN 89.51
DP02005P47710Alpha-S1-casein Cleaved into: Casoxin-D Homo sapiens (Human) 1 185 1 15 15 MRLLILTCLVAVALA 87.36
DP02005P47710Alpha-S1-casein Cleaved into: Casoxin-D Homo sapiens (Human) 1 185 105 124 20 RLNEYNQLQLQAAHAQEQIR 91.97
DP02005P47710Alpha-S1-casein Cleaved into: Casoxin-D Homo sapiens (Human) 1 185 132 162 31 VQVPFQQLNQLAAYPYAVWYYPQIMQYVPFP 92.58
DP02005P47710Alpha-S1-casein Cleaved into: Casoxin-D Homo sapiens (Human) 1 185 172 178 7 AHENYEK 91.64
DP02007Q9H2Y7Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) Homo sapiens (Human) 1265 1521 1496 1504 9 TQTVISSIK 85.4
DP02007Q9H2Y7Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) Homo sapiens (Human) 1265 1521 1508 1514 7 NSSEISS 85.28
DP02008Q9M4V2O-acyltransferase Brassica napus (Rape) 1 113 82 89 8 VDVRYTYR 89.97
DP02009O75683Surfeit locus protein 6 Homo sapiens (Human) 1 182 90 97 8 AAWASSSA 87.29
DP02010Q9NRJ3C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28) Homo sapiens (Human) 1 108 4 12 9 RGLAIVALA 90.3
DP02010Q9NRJ3C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28) Homo sapiens (Human) 1 108 19 27 9 ASEAILPIA 86.62
DP02010Q9NRJ3C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28) Homo sapiens (Human) 1 108 60 67 8 LAAVILHV 86.25
DP02016Q9RSK050S ribosomal protein L36 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) 1 36 22 29 8 RVLVICSN 85.28
DP02025P30429Cell death protein 4 Caenorhabditis elegans 1 108 1 7 7 MLCEIEC 87.29
DP02025P30429Cell death protein 4 Caenorhabditis elegans 1 108 25 46 22 DALTYLEGKNIFTEDHSELISK 89.1
DP02025P30429Cell death protein 4 Caenorhabditis elegans 1 108 53 62 10 RIANFLRIYR 88.36
DP02025P30429Cell death protein 4 Caenorhabditis elegans 1 108 71 96 26 LIDFFNYNNQSHLADFLEDYIDFAIN 94.87
DP02027P17405Sphingomyelin phosphodiesterase (EC 3.1.4.12) (Acid sphingomyelinase) (aSMase) Homo sapiens (Human) 49 85 52 59 8 SRVLWAPA 86.62
DP02027P17405Sphingomyelin phosphodiesterase (EC 3.1.4.12) (Acid sphingomyelinase) (aSMase) Homo sapiens (Human) 170 197 172 180 9 IFSSWNISL 93.27
DP02030P09546Bifunctional protein PutA Includes: Proline dehydrogenase (EC 1.5.5.2) (Proline oxidase); Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C dehydrogenase) (EC 1.2.1.88) (L-glutamate gamma-semialdehyde dehydrogenase) Escherichia coli (strain K12) 611 669 636 646 11 ALLNSALQKWQ 86.77
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 3 15 13 SSILFLLKLMKIM 87.63
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 44 64 21 QYKTYYTKYIQWCQLNQIIPT 86.69
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 81 93 13 SAELIHWFLLDTL 91
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 127 136 10 GSLNFLSKLC 91.97
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 158 183 26 HTHWIDSQKAITTNETNNTNTQVLCP 87.29
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 189 196 8 SLNLWNPE 91.97
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 223 230 8 YLNLSFEE 85.95
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 246 253 8 RDAIIYHK 88.75
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 285 298 14 TLAAYLYLRFYGIP 90.42
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 337 349 13 TFSNYYTTVFRYC 88.4
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 355 370 16 RREYFNKCNLVYPTWD 85.62
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 373 396 24 TFRTFFNEENHGNWLEQPEAFAFP 87.21
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 431 443 13 LLVQIFPEIDEYK 92.02
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 471 480 10 NLPWIYKFFP 92.01
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 494 505 12 DFQSYFNDKTIH 97.85
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 519 525 7 GFNKIYK 94.31
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 527 537 11 KTNFYSLLIER 89.3
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 539 546 8 SQLTFASS 93.31
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 578 608 31 KQQSFEYVQFQTLSNFQILLSVFNKIFEKLE 91.28
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 619 638 20 HQLNLFKITLDERIKKSKID 94.83
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 652 660 9 KEENIVNED 89.07
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 675 681 7 RLLSIAD 86.62
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 725 737 13 INELINSKISTFL 92.51
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 744 756 13 FELKINALLDKIL 90.64
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 839 867 29 DEQEFMLDKSIDSIEGIILEWFTPNAKYA 91.81
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 895 908 14 SIVEFYIYLVNHES 90.42
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 956 943 951 9 HQNSFDGLL 88.52
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 43 3 15 13 SSILFLLKLMKIM 87.63
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 539 546 8 SQLTFASS 93.31
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 578 608 31 KQQSFEYVQFQTLSNFQILLSVFNKIFEKLE 91.28
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 619 638 20 HQLNLFKITLDERIKKSKID 94.83
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 652 660 9 KEENIVNED 89.07
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 675 681 7 RLLSIAD 86.62
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 725 737 13 INELINSKISTFL 92.51
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 744 756 13 FELKINALLDKIL 90.64
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 839 867 29 DEQEFMLDKSIDSIEGIILEWFTPNAKYA 91.81
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 895 908 14 SIVEFYIYLVNHES 90.42
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 538 956 943 951 9 HQNSFDGLL 88.52
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 552 956 578 608 31 KQQSFEYVQFQTLSNFQILLSVFNKIFEKLE 91.28
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 552 956 619 638 20 HQLNLFKITLDERIKKSKID 94.83
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 552 956 652 660 9 KEENIVNED 89.07
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 552 956 675 681 7 RLLSIAD 86.62
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 552 956 725 737 13 INELINSKISTFL 92.51
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 552 956 744 756 13 FELKINALLDKIL 90.64
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 552 956 839 867 29 DEQEFMLDKSIDSIEGIILEWFTPNAKYA 91.81
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 552 956 895 908 14 SIVEFYIYLVNHES 90.42
DP02033P32504Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 552 956 943 951 9 HQNSFDGLL 88.52
DP02035A6QHR2Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) Staphylococcus aureus (strain Newman) 323 420 356 363 8 VEVLIETG 97.66
DP02035A6QHR2Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) Staphylococcus aureus (strain Newman) 323 420 376 384 9 NNGAIYING 96.36
DP02035A6QHR2Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) Staphylococcus aureus (strain Newman) 323 420 388 395 8 QDVNYALA 98.66
DP02049O74774Elongation factor 1 alpha-like protein Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 155 57 66 10 DTVWYYYFDV 97.56
DP02049O74774Elongation factor 1 alpha-like protein Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 155 68 76 9 KSVNYLLQK 96.32
DP02049O74774Elongation factor 1 alpha-like protein Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 204 259 222 231 10 GSFSYAWLLD 90.1
DP02050P41814tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 88 188 136 146 11 AQELTVEEIEK 87.93
DP02050P41814tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 88 188 175 183 9 SQEKYVNRK 91.97
DP02066Q9FG31Late embryogenesis abundant protein 46 (Late embryogenesis abundant protein 4-5) (AtLEA4-5) Arabidopsis thaliana (Mouse-ear cress) 1 158 7 15 9 TASNIAASA 96.32
DP02075P28300Protein-lysine 6-oxidase (EC 1.4.3.13) (Lysyl oxidase) Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form Homo sapiens (Human) 22 168 45 65 21 QIQWENNGQVFSLLSLGSQYQ 88.58
DP02076O69245FixK2 protein Bradyrhizobium japonicum 1 37 7 14 8 KTQVINTQ 88.29
DP02078P02686Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) Homo sapiens (Human) 1 171 86 95 10 PVVHFFKNIV 90.1
DP02078P02686Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) Homo sapiens (Human) 1 171 150 158 9 TLSKIFKLG 90.97
DP02086Q9JPP1Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132) Neisseria meningitidis 133 274 154 160 7 SQNITLT 85.95
DP02086Q9JPP1Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132) Neisseria meningitidis 133 274 182 190 9 EFENLNESE 85.28
DP02086Q9JPP1Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132) Neisseria meningitidis 133 274 216 226 11 GTNKYVIIYKD 93.07
DP02094P49427Ubiquitin-conjugating enzyme E2 R1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme R1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme R1) (Ubiquitin-conjugating enzyme E2-32 kDa complementing) (Ubiquitin-conjugating enzyme E2-CDC34) (Ubiquitin-protein ligase R1) Homo sapiens (Human) 183 236 186 195 10 TLAEYCVKTK 88.29
DP02094P49427Ubiquitin-conjugating enzyme E2 R1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme R1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme R1) (Ubiquitin-conjugating enzyme E2-32 kDa complementing) (Ubiquitin-conjugating enzyme E2-CDC34) (Ubiquitin-protein ligase R1) Homo sapiens (Human) 183 236 203 213 11 SDLFYDDYYED 89.84
DP02097P27472Glycogen starch synthase isoform 2 (EC 2.4.1.11) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 627 705 681 689 9 ADDYFSLGV 88.29
DP02097P27472Glycogen starch synthase isoform 2 (EC 2.4.1.11) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 640 705 681 689 9 ADDYFSLGV 88.29
DP02097P27472Glycogen starch synthase isoform 2 (EC 2.4.1.11) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 648 705 681 689 9 ADDYFSLGV 88.29
DP02105P74518Ribosome hibernation promotion factor (HPF) (Light-repressed protein A) Synechocystis sp. (strain PCC 6803 / Kazusa) 100 191 158 164 7 HDFYMFR 86.96
DP02105P74518Ribosome hibernation promotion factor (HPF) (Light-repressed protein A) Synechocystis sp. (strain PCC 6803 / Kazusa) 100 191 170 178 9 EINVIYIRN 92.49
DP02109O94316Pre-mRNA-splicing factor cwf10 (114 kDa U5 small nuclear ribonucleoprotein component homolog) (Complexed with cdc5 protein 10) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 60 9 15 7 EFGNYIG 90.54
DP02118P19836Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A) Rattus norvegicus (Rat) 236 312 271 280 10 SIDLIQKWEE 86.96
DP02118P19836Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A) Rattus norvegicus (Rat) 236 312 285 294 10 FIGSFLEMFG 85.95
DP02118P19836Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A) Rattus norvegicus (Rat) 237 293 271 280 10 SIDLIQKWEE 86.96
DP02122Q02199Nucleoporin NUP49/NSP49 (Nuclear pore protein NUP49/NSP49) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 121 154 131 139 9 NTNNINNSS 96.32
DP02123P52948Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96) Homo sapiens (Human) 2 150 38 46 9 GTSAFGSSN 86.62
DP02123P52948Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96) Homo sapiens (Human) 2 150 98 112 15 GTSLFSSQNNAFAQN 89.48
DP02123P52948Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96) Homo sapiens (Human) 2 150 116 137 22 GFGNFGTSTSSGGLFGTTNTTS 91.97
DP02127P0AG30Transcription termination factor Rho (EC 3.6.4.-) (ATP-dependent helicase Rho) Escherichia coli (strain K12) 1 30 11 18 8 VSELITLG 89.3
DP02127P0AG30Transcription termination factor Rho (EC 3.6.4.-) (ATP-dependent helicase Rho) Escherichia coli (strain K12) 355 411 396 404 9 MEFLINKLA 98.66
DP02130P02671Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Homo sapiens (Human) 232 581 265 271 7 GGNEITR 85.95
DP02130P02671Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Homo sapiens (Human) 232 581 515 523 9 DEAAFFDTA 87.25
DP02130P02671Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Homo sapiens (Human) 232 581 536 545 10 MLGEFVSETE 87.29
DP02143O6708650S ribosomal protein L20 Aquifex aeolicus (strain VF5) 1 59 38 47 10 MRALYYQYRD 94.21
DP02145P47054Nucleoporin NUP192 (Nuclear pore protein NUP192) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 328 424 337 345 9 SMELFYDIR 93.35
DP02145P47054Nucleoporin NUP192 (Nuclear pore protein NUP192) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 328 424 362 376 15 DDEKIFSQTTNSTYN 88.76
DP02145P47054Nucleoporin NUP192 (Nuclear pore protein NUP192) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 328 424 412 419 8 NVNEYSYT 88.59
DP02148Q676U5Autophagy-related protein 16-1 (APG16-like 1) Homo sapiens (Human) 49 307 107 117 11 AQLVIDLNNQM 94.31
DP02148Q676U5Autophagy-related protein 16-1 (APG16-like 1) Homo sapiens (Human) 49 307 127 144 18 NEAKIAECLQTISDLETE 87.16
DP02148Q676U5Autophagy-related protein 16-1 (APG16-like 1) Homo sapiens (Human) 49 307 168 177 10 ALQITFTALE 93.18
DP02148Q676U5Autophagy-related protein 16-1 (APG16-like 1) Homo sapiens (Human) 49 307 239 249 11 DIEVIVDETSD 90.97
DP02148Q676U5Autophagy-related protein 16-1 (APG16-like 1) Homo sapiens (Human) 49 307 276 284 9 LDSITNIFG 88.67
DP02155P49687Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 125 8 19 12 SGFTFGNQNTST 87.29
DP02155P49687Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 125 56 71 16 SGGLFNANSNANSISQ 87.44
DP02155P49687Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 125 102 116 15 AGSLFGNNNATANST 89.97
DP02155P49687Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 124 8 19 12 SGFTFGNQNTST 87.29
DP02155P49687Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 124 56 71 16 SGGLFNANSNANSISQ 87.44
DP02155P49687Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 124 102 116 15 AGSLFGNNNATANST 89.97
DP02156P46673Nucleoporin NUP85 (Nuclear pore protein NUP85) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 43 23 29 7 TAQLSNN 86.62
DP02158P36161Nucleoporin NUP133 (Nuclear pore protein NUP133) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 55 26 33 8 LAQLSYEE 91.14
DP02159P32566Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 340 505 399 407 9 ESVKIVKTE 87.29
DP02162P16050Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12) Homo sapiens (Human) 22 162 22 28 7 VQLWLVG 92.31
DP02162P16050Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12) Homo sapiens (Human) 22 162 58 66 9 GPLLFVKLR 88.29
DP02162P16050Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12) Homo sapiens (Human) 22 162 73 83 11 DDAWFCNWISV 95.38
DP02162P16050Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12) Homo sapiens (Human) 22 162 145 157 13 KDGLILNMAGAKL 90.64
DP02163Q02388Collagen alpha-1(VII) chain (Long-chain collagen) (LC collagen) Homo sapiens (Human) 1940 1978 1955 1964 10 ALREIVETWD 87.29
DP02164Q8WUM0Nuclear pore complex protein Nup133 (133 kDa nucleoporin) (Nucleoporin Nup133) Homo sapiens (Human) 244 293 259 267 9 VSSLFGILS 85.8
DP02167Q8N726Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF) Homo sapiens (Human) 1 132 41 51 11 AAVALVLMLLR 88.11
DP02173Q9BS26Endoplasmic reticulum resident protein 44 (ER protein 44) (ERp44) (Thioredoxin domain-containing protein 4) Homo sapiens (Human) 328 358 345 351 7 KQFVFDL 94.31
DP02192O00571ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2) Homo sapiens (Human) 1 167 12 24 13 LDQQFAGLDLNSS 86.29
DP02192O00571ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2) Homo sapiens (Human) 1 167 81 87 7 KSSFFSD 86.96
DP02192O00571ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2) Homo sapiens (Human) 1 167 147 153 7 EQELFSG 92.98
DP02192O00571ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2) Homo sapiens (Human) 1 167 156 162 7 TGINFEK 89.97
DP02195P53136Ribosome biogenesis protein NSA1 (NOP7-associated protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 434 463 441 448 8 ADELWNKL 94.31
DP02205Q2TUW1Abscisic stress ripening-like protein Glycine max (Soybean) (Glycine hispida) 1 238 171 179 9 SAAAYALHE 91.97
DP02205Q2TUW1Abscisic stress ripening-like protein Glycine max (Soybean) (Glycine hispida) 1 238 208 214 7 GGFAFHE 86.96
DP02209O82132Dehydration-responsive element-binding protein 2A (Protein DREB2A) Arabidopsis thaliana (Mouse-ear cress) 168 335 201 214 14 WLSEFEHNYWSDIL 86.34
DP02209O82132Dehydration-responsive element-binding protein 2A (Protein DREB2A) Arabidopsis thaliana (Mouse-ear cress) 168 335 321 330 10 GNGFFDDLSY 86.96
DP02210Q03519Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11) Homo sapiens (Human) 1 129 17 24 8 AALLWLLQ 91.93
DP02210Q03519Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11) Homo sapiens (Human) 1 129 99 107 9 WSWLLVGYG 86.85
DP02210Q03519Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11) Homo sapiens (Human) 1 129 110 119 10 GLSWSLWAVL 86.96
DP02216Q9U3S5MUTator Caenorhabditis elegans 1 100 75 83 9 VDAYYANDN 97.99
DP02216Q9U3S5MUTator Caenorhabditis elegans 400 950 432 439 8 TSSHFNRN 85.95
DP02216Q9U3S5MUTator Caenorhabditis elegans 400 950 518 529 12 SDSEITSEGSYS 86.96
DP02216Q9U3S5MUTator Caenorhabditis elegans 400 950 639 648 10 EVGNFYSKSN 91.57
DP02216Q9U3S5MUTator Caenorhabditis elegans 400 950 716 722 7 QTAVYQN 85.28
DP02216Q9U3S5MUTator Caenorhabditis elegans 400 950 802 808 7 SPFNYSQ 90.97
DP02216Q9U3S5MUTator Caenorhabditis elegans 400 950 834 840 7 GYQNSYN 94.41
DP02216Q9U3S5MUTator Caenorhabditis elegans 400 950 931 944 14 GYDNFNGNSAPYFN 88.53
DP02224P29375Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A) Homo sapiens (Human) 184 360 238 244 7 KLQIFGA 94.31
DP02224P29375Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A) Homo sapiens (Human) 184 360 286 299 14 LSVNFVDLYVCMFC 92.31
DP02248Q8RWK8Coilin (Atcoilin) Arabidopsis thaliana (Mouse-ear cress) 117 350 128 136 9 ANEEFQKET 85.62
DP02253Q96F86Enhancer of mRNA-decapping protein 3 (LSM16 homolog) (YjeF N-terminal domain-containing protein 2) (YjeF_N2) (hYjeF_N2) (YjeF domain-containing protein 1) Homo sapiens (Human) 203 258 216 226 11 AAVFEEIDTYE 90.76
DP02253Q96F86Enhancer of mRNA-decapping protein 3 (LSM16 homolog) (YjeF N-terminal domain-containing protein 2) (YjeF_N2) (hYjeF_N2) (YjeF domain-containing protein 1) Homo sapiens (Human) 203 258 246 253 8 HDENILES 94.31
DP02263P32120Beta-arrestin-2 (Arrestin beta-2) (Arrestin-3) Bos taurus (Bovine) 350 393 381 388 8 DTNLIEFE 88.04
DP02267Q8IVG9Humanin (Humanin mitochondrial) (HNM) Homo sapiens (Human) 1 24 9 17 9 LLLLTSEID 85.95
DP02269Q9Y6K9NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) Homo sapiens (Human) 44 111 78 86 9 ELLHFQASQ 86.96
DP02272Q7KLE5Endophilin-A (SH3 domain-containing GRB2-like protein) Drosophila melanogaster (Fruit fly) 242 452 269 284 16 NNANINSNYQNQITTN 89.8
DP02290Q92905COP9 signalosome complex subunit 5 (SGN5) (Signalosome subunit 5) (EC 3.4.-.-) (Jun activation domain-binding protein 1) Homo sapiens (Human) 198 218 202 213 12 EYQTIPLNKIED 85.95
DP02291P04486Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1) 412 490 471 485 15 ADFEFEQMFTDALGI 94.98
DP02291P04486Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1) 456 490 471 485 15 ADFEFEQMFTDALGI 94.98
DP02296P60761Neurogranin (Ng) (RC3) Cleaved into: NEUG(55-78) Mus musculus (Mouse) 26 47 29 38 10 AAAKIQASFR 87.29
DP02299P50498Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen) Plasmodium falciparum (isolate 3D7) 1 272 6 39 34 TLSIINFFIFVTFNIKNESKYSNTFINNAYNMSI 92.17
DP02299P50498Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen) Plasmodium falciparum (isolate 3D7) 1 272 240 267 28 ATSLLNNSSNIASINKFVVLISATLVLS 89.03
DP02299P50498Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen) Plasmodium falciparum (isolate 3D7) 1 270 6 39 34 TLSIINFFIFVTFNIKNESKYSNTFINNAYNMSI 92.17
DP02299P50498Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen) Plasmodium falciparum (isolate 3D7) 1 270 240 265 26 ATSLLNNSSNIASINKFVVLISATLV 88.53
DP02304Q9Y5X1Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A) Homo sapiens (Human) 73 183 75 93 19 ADQAFLDSLSASTAQASSS 96.32
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 1 26 26 MRIIILALLIVCTIINYYCAVQNNGN 95.27
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 149 174 26 GNDNINNNDNFNNNDNYNDNDNFNEE 86.98
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 201 212 12 EEATINEMGKIT 87.63
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 236 246 11 NLQSFLSSLTG 85.77
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 258 264 7 DMMNIFG 89.78
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 391 399 9 VDNNLVPSN 85.62
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 426 443 18 VNSKYADNSFEDKFNTFD 88.63
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 447 469 23 DDVKYELFGENEEAEELNNNTTT 91.8
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 495 528 34 NEENINNNNNHNNKNYNNYNTSQQEEDDNSFNEN 94.26
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 577 584 8 MSNNYNSK 93.98
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 1 667 625 641 17 ADNEIVQNILKKYVTID 95.97
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 824 993 849 857 9 RQRAFNILK 87.37
DP02305Q8ILA1Translocon component PTEX150 Plasmodium falciparum (isolate 3D7) 824 993 883 891 9 FSKNYNFSS 88.41
DP02309Q96RF0Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1) Homo sapiens (Human) 59 224 103 109 7 AFQALLQ 87.29
DP02309Q96RF0Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1) Homo sapiens (Human) 59 224 137 148 12 PQQLYGGYQASQ 90.3
DP02311Q7DD77PilP protein Neisseria meningitidis serogroup B (strain MC58) 20 84 35 42 8 KAEIIPFQ 87.63
DP02311Q7DD77PilP protein Neisseria meningitidis serogroup B (strain MC58) 20 69 35 42 8 KAEIIPFQ 87.63
DP02313Q8IG33Boca/MESD chaperone for YWTD beta-propeller-EGF Caenorhabditis elegans 18 88 26 32 7 DLSSYTD 86.62
DP02313Q8IG33Boca/MESD chaperone for YWTD beta-propeller-EGF Caenorhabditis elegans 18 88 35 45 11 LEKLYEEWEEN 85.28
DP02316O43663Protein regulator of cytokinesis 1 Homo sapiens (Human) 467 620 566 583 18 LQRNFSINSVASTYSEFA 90.12
DP02317Q03689Heterokaryon incompatibility protein s (Small s protein) (Vegetative incompatibility protein s) Podospora anserina (Pleurage anserina) 228 289 273 282 10 SRVLIGNEYG 87.96
DP02323Q5L0X5Cell division protein DivIB Geobacillus kaustophilus (strain HTA426) 233 261 240 246 7 VGSYFVP 92.4
DP02327Q00169Phosphatidylinositol transfer protein alpha isoform (PI-TP-alpha) (PtdIns transfer protein alpha) (PtdInsTP alpha) Homo sapiens (Human) 119 190 136 144 9 VEAVYIDIA 96.8
DP02330C4PB33Vitellogenin Bombus ignitus (Bumblebee) 361 395 364 370 7 KGQNYRS 86.62
DP02334Q98148"Kaposis sarcoma-associated herpes-like virus ORF73 homolog" "Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)" 1110 1162 1132 1140 9 LQSSIVKFK 89.3
DP02337O46385Supervillin (Archvillin) (p205/p250) Bos taurus (Bovine) 1 342 116 125 10 LAEKYGLTLD 86.62
DP02337O46385Supervillin (Archvillin) (p205/p250) Bos taurus (Bovine) 1 342 196 204 9 TEVLLNAEN 90.97
DP02337O46385Supervillin (Archvillin) (p205/p250) Bos taurus (Bovine) 1 342 284 290 7 KHEWFLQ 87.63
DP02337O46385Supervillin (Archvillin) (p205/p250) Bos taurus (Bovine) 1 342 297 305 9 TPSLINWPS 87.96
DP02337O46385Supervillin (Archvillin) (p205/p250) Bos taurus (Bovine) 11 174 116 125 10 LAEKYGLTLD 86.62
DP02340A0A3N4AZ09Putative exported protein Yersinia pestis 21 112 26 36 11 KVCFYMDDDYN 96.32
DP02340A0A3N4AZ09Putative exported protein Yersinia pestis 21 112 58 65 8 RISSISIP 85.95
DP02340A0A3N4AZ09Putative exported protein Yersinia pestis 21 112 67 81 15 GLVVTVYEDVDFLGA 87.29
DP02340A0A3N4AZ09Putative exported protein Yersinia pestis 21 112 95 107 13 KDLIYLNDNISAF 88.06
DP02340A0A3N4AZ09Putative exported protein Yersinia pestis 110 215 111 122 12 KAVCFYGESNFT 93.34
DP02340A0A3N4AZ09Putative exported protein Yersinia pestis 110 215 133 142 10 QFDLYRGNYP 85.95
DP02340A0A3N4AZ09Putative exported protein Yersinia pestis 110 215 154 163 10 NDEVYSIKIP 91.64
DP02340A0A3N4AZ09Putative exported protein Yersinia pestis 110 215 177 188 12 NGKYFVLTEDYT 90.64
DP02340A0A3N4AZ09Putative exported protein Yersinia pestis 110 215 190 202 13 DDLLIIRMNNKIS 90.79
DP02341A0A178W0D3Plastid transcriptionally active 4 Arabidopsis thaliana (Mouse-ear cress) 221 259 241 252 12 KDSEIENELNEL 85.95
DP02345Q92804TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) Homo sapiens (Human) 1 198 13 21 9 EQQSYSTYG 90.19
DP02345Q92804TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) Homo sapiens (Human) 1 198 31 57 27 ASQSYSGYGQTTDSSYGQNYSGYSSYG 88.73
DP02345Q92804TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) Homo sapiens (Human) 1 198 74 84 11 KQSSYSQQPYN 86.8
DP02345Q92804TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) Homo sapiens (Human) 1 198 125 136 12 HQGSYDEQSNYD 90.47
DP02345Q92804TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) Homo sapiens (Human) 1 198 145 157 13 NQQSYHSQRENYS 86.96
DP02353P0DMV9Heat shock 70 kDa protein 1B (Heat shock 70 kDa protein 2) (HSP70-2) (HSP70.2) Homo sapiens (Human) 229 306 237 246 10 LVNHFVEEFK 87.53
DP02353P0DMV9Heat shock 70 kDa protein 1B (Heat shock 70 kDa protein 2) (HSP70-2) (HSP70.2) Homo sapiens (Human) 229 306 280 299 20 ASLEIDSLFEGIDFYTSITR 89.97
DP02355P36080Ribosomal RNA-processing protein 14 (Ribosome biogenesis protein RRP14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 295 12 30 19 NSSAFDGLLALIPAKYYYD 88.88
DP02355P36080Ribosomal RNA-processing protein 14 (Ribosome biogenesis protein RRP14) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 295 264 271 8 MFQNIIFD 92.77
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2049 2055 7 QIAEIEK 87.63
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2082 2092 11 TTSAYENEKFS 87.29
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2101 2107 7 AISSISL 91.97
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2111 2144 34 TKNIYVNSDNISETFPYTYILPQNLLRKFVTISD 89.67
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2241 2247 7 LTVSYIP 90.97
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2251 2257 7 SLAAYTV 87.24
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2273 2281 9 SDEAIGYEP 86.96
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2295 2302 8 IQGFFLVP 86.41
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2305 2318 14 GVWNYNFNGASFSP 95.37
DP02357O14187Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 2044 2363 2341 2351 11 HVISYTELETN 85.77
DP02359Q8IYB3Serine/arginine repetitive matrix protein 1 (SR-related nuclear matrix protein of 160 kDa) (SRm160) (Ser/Arg-related nuclear matrix protein) Homo sapiens (Human) 1 299 26 36 11 KQLKFAECLEK 90.3
DP02359Q8IYB3Serine/arginine repetitive matrix protein 1 (SR-related nuclear matrix protein of 160 kDa) (SRm160) (Ser/Arg-related nuclear matrix protein) Homo sapiens (Human) 1 299 44 54 11 NLEVIKPWITK 86.29
DP02359Q8IYB3Serine/arginine repetitive matrix protein 1 (SR-related nuclear matrix protein of 160 kDa) (SRm160) (Ser/Arg-related nuclear matrix protein) Homo sapiens (Human) 1 299 64 77 14 DDVVIEFIFNQLEV 96.44
DP02359Q8IYB3Serine/arginine repetitive matrix protein 1 (SR-related nuclear matrix protein of 160 kDa) (SRm160) (Ser/Arg-related nuclear matrix protein) Homo sapiens (Human) 1 299 112 127 16 AQENIAGIPSAFLELK 97.99
DP02371O08583THO complex subunit 4 (Tho4) (Ally of AML-1 and LEF-1) (Aly/REF export factor) (REF1-I) (RNA and export factor-binding protein 1) (Transcriptional coactivator Aly/REF) Mus musculus (Mouse) 77 182 121 131 11 IQELFAEFGTL 90.67
DP02372Q88MI5Putative Killer protein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) 1 22 10 17 8 TEALFTTG 87.63
DP02373Q92837Proto-oncogene FRAT1 (Frequently rearranged in advanced T-cell lymphomas 1) (FRAT-1) Homo sapiens (Human) 1 198 24 35 12 SFLLLQQSVALG 85.95
DP02373Q92837Proto-oncogene FRAT1 (Frequently rearranged in advanced T-cell lymphomas 1) (FRAT-1) Homo sapiens (Human) 188 226 205 216 12 QLVLSGNLIKEA 85.95
DP02380O23661Auxin response factor 3 (Protein ETTIN) Arabidopsis thaliana (Mouse-ear cress) 388 594 440 451 12 QGQEIFPGFINT 89.52
DP02380O23661Auxin response factor 3 (Protein ETTIN) Arabidopsis thaliana (Mouse-ear cress) 388 594 500 506 7 SQRNIWC 86.29
DP02380O23661Auxin response factor 3 (Protein ETTIN) Arabidopsis thaliana (Mouse-ear cress) 388 594 508 514 7 PFQNFST 91.3
DP02380O23661Auxin response factor 3 (Protein ETTIN) Arabidopsis thaliana (Mouse-ear cress) 388 594 527 534 8 SVLLTNSN 85.95
DP02383P08631Tyrosine-protein kinase HCK (EC 2.7.10.2) (Hematopoietic cell kinase) (Hemopoietic cell kinase) (p59-HCK/p60-HCK) (p59Hck) (p61Hck) Homo sapiens (Human) 2 79 33 41 9 GGNTFSKTE 87.29
DP02386Q9NYB9Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) Homo sapiens (Human) 156 513 347 354 8 PVQFYSMN 92.98
DP02386Q9NYB9Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) Homo sapiens (Human) 156 513 432 438 7 AVVEYSD 97.99
DP02386Q9NYB9Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) Homo sapiens (Human) 156 513 455 463 9 KVVAIYDYT 89.97
DP02386Q9NYB9Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) Homo sapiens (Human) 156 513 473 483 11 QEGAIIYVIKK 89.27
DP02386Q9NYB9Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) Homo sapiens (Human) 156 513 485 491 7 DDGWYEG 91.97
DP02386Q9NYB9Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) Homo sapiens (Human) 156 513 500 508 9 FPGNYVESI 86.55
DP02390Q9NQS7Inner centromere protein Homo sapiens (Human) 853 903 856 862 7 IHQYYHP 87.29
DP02390Q9NQS7Inner centromere protein Homo sapiens (Human) 853 903 865 873 9 LLELFGTIL 92.31
DP02391Q9Y580RNA-binding protein 7 (RNA-binding motif protein 7) Homo sapiens (Human) 90 266 127 136 10 SAQIIQRSFS 96.32
DP02391Q9Y580RNA-binding protein 7 (RNA-binding motif protein 7) Homo sapiens (Human) 90 266 233 239 7 DDFFYED 88.68
DP02395P35201Inner kinetochore subunit MIF2 (CENP-C homolog) (Constitutive centromere-associated network protein MIF2) (Mitotic fidelity of chromosome transmission protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 331 438 415 424 10 KDEIIAFAPN 92.71
DP02395P35201Inner kinetochore subunit MIF2 (CENP-C homolog) (Constitutive centromere-associated network protein MIF2) (Mitotic fidelity of chromosome transmission protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 365 436 415 424 10 KDEIIAFAPN 92.71
DP02396Q7RTP6F-actin-monooxygenase MICAL3 (EC 1.14.13.225) (Molecule interacting with CasL protein 3) (MICAL-3) Homo sapiens (Human) 1735 1918 1789 1795 7 RQLSFSE 86.62
DP02396Q7RTP6F-actin-monooxygenase MICAL3 (EC 1.14.13.225) (Molecule interacting with CasL protein 3) (MICAL-3) Homo sapiens (Human) 1735 1918 1850 1856 7 RAQIIQR 93.31
DP02396Q7RTP6F-actin-monooxygenase MICAL3 (EC 1.14.13.225) (Molecule interacting with CasL protein 3) (MICAL-3) Homo sapiens (Human) 1735 1918 1894 1901 8 MQEWFKLV 94.31
DP02396Q7RTP6F-actin-monooxygenase MICAL3 (EC 1.14.13.225) (Molecule interacting with CasL protein 3) (MICAL-3) Homo sapiens (Human) 1735 1918 1906 1913 8 AMVRYESE 87.25
DP02396Q7RTP6F-actin-monooxygenase MICAL3 (EC 1.14.13.225) (Molecule interacting with CasL protein 3) (MICAL-3) Homo sapiens (Human) 1881 1990 1894 1901 8 MQEWFKLV 94.31
DP02396Q7RTP6F-actin-monooxygenase MICAL3 (EC 1.14.13.225) (Molecule interacting with CasL protein 3) (MICAL-3) Homo sapiens (Human) 1881 1990 1906 1925 20 AMVRYESELMIFARELELED 88.68
DP02398Q04637Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220) Homo sapiens (Human) 161 216 192 198 7 ITEEIMS 86.96
DP02398Q04637Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220) Homo sapiens (Human) 178 203 192 198 7 ITEEIMS 86.96
DP02408Q9P2K3REST corepressor 3 Homo sapiens (Human) 1 272 38 44 7 GGLHYSE 87.63
DP02408Q9P2K3REST corepressor 3 Homo sapiens (Human) 1 272 101 108 8 LDEYIAIA 93.31
DP02408Q9P2K3REST corepressor 3 Homo sapiens (Human) 1 272 151 163 13 DKVLFEQAFSFHG 90.2
DP02408Q9P2K3REST corepressor 3 Homo sapiens (Human) 1 272 180 189 10 SLVKYYYSWK 92.14
DP02409Q9BTT0Acidic leucine-rich nuclear phosphoprotein 32 family member E (LANP-like protein) (LANP-L) Homo sapiens (Human) 186 232 216 227 12 VGLSYLMKEEIQ 87.24
DP02451P46938Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog) Mus musculus (Mouse) 35 64 50 58 9 LEALFNAVM 95.65
DP02455Q9UKX7Nuclear pore complex protein Nup50 (50 kDa nucleoporin) (Nuclear pore-associated protein 60 kDa-like) (Nucleoporin Nup50) Homo sapiens (Human) 48 109 90 97 8 NGNNITSA 91.97
DP02458P17181Interferon alpha/beta receptor 1 (IFN-R-1) (IFN-alpha/beta receptor 1) (Cytokine receptor class-II member 1) (Cytokine receptor family 2 member 1) (CRF2-1) (Type I interferon receptor 1) Homo sapiens (Human) 330 436 335 341 7 PVFNIRS 86.62
DP02458P17181Interferon alpha/beta receptor 1 (IFN-R-1) (IFN-alpha/beta receptor 1) (Cytokine receptor class-II member 1) (Cytokine receptor family 2 member 1) (CRF2-1) (Type I interferon receptor 1) Homo sapiens (Human) 330 436 344 352 9 DSFHIYIGA 90.19
DP02458P17181Interferon alpha/beta receptor 1 (IFN-R-1) (IFN-alpha/beta receptor 1) (Cytokine receptor class-II member 1) (Cytokine receptor family 2 member 1) (CRF2-1) (Type I interferon receptor 1) Homo sapiens (Human) 330 436 365 379 15 YPLIYEIIFWENTSN 92.84
DP02463Q9NRR4Ribonuclease 3 (EC 3.1.26.3) (Protein Drosha) (Ribonuclease III) (RNase III) (p241) Homo sapiens (Human) 411 432 417 425 9 HSENYYSSD 95.24
DP02463Q9NRR4Ribonuclease 3 (EC 3.1.26.3) (Protein Drosha) (Ribonuclease III) (RNase III) (p241) Homo sapiens (Human) 459 521 501 509 9 VFDVIAEIK 86.73
DP02463Q9NRR4Ribonuclease 3 (EC 3.1.26.3) (Protein Drosha) (Ribonuclease III) (RNase III) (p241) Homo sapiens (Human) 712 849 768 778 11 TFPIIVHFGIR 92.43
DP02463Q9NRR4Ribonuclease 3 (EC 3.1.26.3) (Protein Drosha) (Ribonuclease III) (RNase III) (p241) Homo sapiens (Human) 712 849 824 834 11 ALQKIRQKNTM 86.96
DP02463Q9NRR4Ribonuclease 3 (EC 3.1.26.3) (Protein Drosha) (Ribonuclease III) (RNase III) (p241) Homo sapiens (Human) 930 957 942 950 9 INTLINIMS 95.09
DP02471Q96G97Seipin (Bernardinelli-Seip congenital lipodystrophy type 2 protein) Homo sapiens (Human) 2 60 31 55 25 FGVLFCTILLLLWVSVFLYGSFYYS 92.59
DP02471Q96G97Seipin (Bernardinelli-Seip congenital lipodystrophy type 2 protein) Homo sapiens (Human) 220 398 224 264 41 RYLLYNFPMTCAFIGVASNFTFLSVIVLFSYMQWVWGGIWP 91.94
DP02475Q86UE8Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2) Homo sapiens (Human) 191 391 210 224 15 SDLTIEKISALENSK 88.49
DP02475Q86UE8Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2) Homo sapiens (Human) 191 391 317 329 13 AFQNLIKQQERIN 90.3
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 231 12 27 16 GQNKYIEYLLQEETEA 88.46
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 231 80 91 12 NNENYDAAEYSH 89.05
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 231 122 142 21 EDSKYYCELCDPSLYAHLETS 86.24
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 74 134 80 91 12 NNENYDAAEYSH 89.05
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 74 134 122 129 8 EDSKYYCE 87.29
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 366 594 379 387 9 GDELIEDIA 93.65
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 366 594 391 397 7 EDILYSK 94.31
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 366 594 436 460 25 LNCAFLYPGLGLEFTGYLNYIGASQ 91.64
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 366 594 499 509 11 AILVYQLFPSN 93.16
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 366 594 581 589 9 TLFAFVVVK 96.8
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 366 447 379 387 9 GDELIEDIA 93.65
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 366 447 391 397 7 EDILYSK 94.31
DP02476P36106Transcription factor BYE1 (Bypass of ESS1 protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 366 447 436 442 7 LNCAFLY 89.92
DP02477Q019701-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) Homo sapiens (Human) 882 1234 941 949 9 LIASILSEV 88.29
DP02477Q019701-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) Homo sapiens (Human) 882 1234 1030 1045 16 RYQEFQNRQVQSLLEL 87.29
DP02477Q019701-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) Homo sapiens (Human) 882 1234 1093 1099 7 ELQKILD 87.29
DP02477Q019701-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) Homo sapiens (Human) 934 1192 941 949 9 LIASILSEV 88.29
DP02477Q019701-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) Homo sapiens (Human) 934 1192 1030 1045 16 RYQEFQNRQVQSLLEL 87.29
DP02477Q019701-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) Homo sapiens (Human) 934 1192 1093 1099 7 ELQKILD 87.29
DP02478Q6SJQ7CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) Mus musculus (Mouse) 132 330 145 158 14 TTTIFTVTTTVKET 85.28
DP02478Q6SJQ7CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) Mus musculus (Mouse) 132 330 164 170 7 LTSYYSD 96.32
DP02478Q6SJQ7CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) Mus musculus (Mouse) 132 330 200 217 18 SAVLLLLLLVASLFAWRM 87.44
DP02478Q6SJQ7CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) Mus musculus (Mouse) 132 330 272 280 9 EEVEYVTMA 94.31
DP02478Q6SJQ7CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) Mus musculus (Mouse) 132 330 285 295 11 EEVSYAALTLA 90.97
DP02479O60502Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT) Homo sapiens (Human) 335 372 351 363 13 STVSIQIKLENEG 87.29
DP02479O60502Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT) Homo sapiens (Human) 341 371 351 363 13 STVSIQIKLENEG 87.29
DP02479O60502Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT) Homo sapiens (Human) 341 370 351 363 13 STVSIQIKLENEG 87.29
DP02479O60502Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT) Homo sapiens (Human) 348 369 351 363 13 STVSIQIKLENEG 87.29
DP02480Q12102Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 423 625 452 458 7 NGNAIID 91.3
DP02480Q12102Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 423 625 498 506 9 NDNLLNLLK 86.77
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 142 12 18 7 TNFNFFK 94.46
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 142 33 44 12 NNSNFFLNSNET 88.27
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 142 119 125 7 PRFLINQ 87.29
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 570 593 24 ADQSFLMENFQNNYNEKLNQNSSV 95.61
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 723 732 10 KQVITEQIAN 88.29
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 765 783 19 TRELYDAFLHERLYLIYMD 91.64
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 802 808 7 WQASYSQ 90.64
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 860 867 8 DKNLIFSP 91.26
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 891 901 11 MQSIYYDNLTK 92.55
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 910 936 27 PANLFIYAKDWTSLSNRWILSKFNLQT 93.92
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 943 960 18 FSNNIISSRIICIDDEYE 91.75
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 967 986 20 LQLLIFNTGVTNPDIFDLEM 89.82
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 992 1030 39 GEELIKLITGISLNTNICFSLLIIYWESAENTLSESTIK 88.61
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 1066 1080 15 KLSEISHSYVYKLTE 88.29
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 1125 1143 19 YQQQIGERNTYAHLESHID 86.73
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 1231 1237 7 SQQLIEN 88.58
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 1240 1260 21 STSVYLNNVSERILGNQEICQ 87.15
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 1301 1285 1293 9 LELKILIDS 86.85
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 551 719 570 593 24 ADQSFLMENFQNNYNEKLNQNSSV 95.61
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 720 805 723 732 10 KQVITEQIAN 88.29
DP02481P46674Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 720 805 765 783 19 TRELYDAFLHERLYLIYMD 91.64
DP02483Q8ZRP0Outer membrane protein assembly factor BamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 426 4 32 29 KKLLIASLLFSSATVYGAEGFVVKDIHFE 91.44
DP02483Q8ZRP0Outer membrane protein assembly factor BamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 426 65 73 9 ALFATGNFE 87.07
DP02483Q8ZRP0Outer membrane protein assembly factor BamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 426 93 100 8 TIASITFS 87.08
DP02483Q8ZRP0Outer membrane protein assembly factor BamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 426 137 151 15 LEDFYYSVGKYSASV 88
DP02483Q8ZRP0Outer membrane protein assembly factor BamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 426 176 201 26 KIQQINIVGNHAFSTEELISHFQLRD 94.22
DP02483Q8ZRP0Outer membrane protein assembly factor BamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 426 226 241 16 LRSYYLDRGYARFNID 91.01
DP02483Q8ZRP0Outer membrane protein assembly factor BamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 426 252 262 11 KGIYITVNITE 94.92
DP02483Q8ZRP0Outer membrane protein assembly factor BamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 426 344 353 10 GNRFYVRKIR 87.29
DP02483Q8ZRP0Outer membrane protein assembly factor BamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 426 412 418 7 VDVVYKV 91.97
DP02484P0AD27Inner membrane protein YejM Escherichia coli (strain K12) 1 244 18 46 29 WGHWFALFNILLSLVIGSRYLFIADWPTT 91.24
DP02484P0AD27Inner membrane protein YejM Escherichia coli (strain K12) 1 244 48 81 34 AGRIYSYVSIIGHFSFLVFATYLLILFPLTFIVG 91.16
DP02484P0AD27Inner membrane protein YejM Escherichia coli (strain K12) 1 244 88 96 9 FLSVILATA 87.11
DP02484P0AD27Inner membrane protein YejM Escherichia coli (strain K12) 1 244 99 126 28 TLLLIDSEVFTRFHLHLNPIVWQLVINP 96.74
DP02484P0AD27Inner membrane protein YejM Escherichia coli (strain K12) 1 244 135 158 24 WQLMFISVPVILLLELVFATWSWQ 87.42
DP02484P0AD27Inner membrane protein YejM Escherichia coli (strain K12) 1 244 174 197 24 AAFLFIAFIASHVVYIWADANFYR 93.51
DP02484P0AD27Inner membrane protein YejM Escherichia coli (strain K12) 1 244 225 235 11 DAQEYQRRLIE 88.29
DP02485P40709Inner membrane protein YejM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 244 18 46 29 WGHWFALFNILLATLLGSRYLFVADWPTT 88.87
DP02485P40709Inner membrane protein YejM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 244 48 83 36 AGRIYSYLSIVGHFSFLVFATYLLILFPLTFIVMSQ 90.65
DP02485P40709Inner membrane protein YejM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 244 88 96 9 FLSAILATA 88.96
DP02485P40709Inner membrane protein YejM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 244 99 125 27 TLLLIDSEVFTRFHLHLNPIVWELVIN 94.82
DP02485P40709Inner membrane protein YejM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 244 135 158 24 WQLMFISVPVILLIEMLFATWSWQ 89.3
DP02485P40709Inner membrane protein YejM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 244 173 197 25 LAAFFFVSFIASHLIYIWADANFYR 93.32
DP02485P40709Inner membrane protein YejM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 244 225 231 7 DAQEYQR 88.29
DP02486A7ZUK2"DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)" Escherichia coli O139:H28 (strain E24377A / ETEC) 931 1134 1042 1048 7 DGQTITR 85.28
DP02486A7ZUK2"DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)" Escherichia coli O139:H28 (strain E24377A / ETEC) 931 1134 1096 1103 8 PAQYFLPG 88.29
DP02486A7ZUK2"DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)" Escherichia coli O139:H28 (strain E24377A / ETEC) 931 1134 1112 1118 7 GVQISSG 85.28
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 1 288 59 67 9 VSTIILDYK 86.29
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 1 288 95 101 7 AFQSIMP 96.99
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 1 288 103 123 21 LSALFNTPFIQGAFRHRIISS 86.83
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 1 288 127 136 10 EISYLVMVIG 86.29
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 1 288 164 174 11 LNDIIAINSTM 94.04
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 1 288 203 220 18 GILLSQALPFFRNYVNVQ 90.64
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 301 506 311 320 10 YEKLYSETIS 86.89
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 301 506 344 360 17 GGVKIIGRFKISDFNTV 87.41
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 301 506 388 394 7 TDSNISM 94.98
DP02487P22473Protein P7 (55 kDa core protein) Rice dwarf virus (isolate O) (RDV) 301 506 418 428 11 KSENIVVCFKN 88.63
DP02488O28769HAMP domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 1 233 6 17 12 QIVLIVVVASLV 99
DP02488O28769HAMP domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 1 233 44 51 8 VSQEYLTK 87.63
DP02488O28769HAMP domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 1 233 67 74 8 AVQTYIEA 92.52
DP02488O28769HAMP domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 1 233 86 92 7 TFDLIQD 89.3
DP02488O28769HAMP domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 1 233 121 128 8 DVAVILTH 90.05
DP02488O28769HAMP domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 1 233 152 164 13 MPELYNLLLKITE 88.99
DP02488O28769HAMP domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 1 233 172 179 8 VCGYYHWD 86.45
DP02488O28769HAMP domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 1 233 208 228 21 KGQLWVVVGTSAYIDGYFQYL 88.42
DP02489Q9YIJ1Capsid protein Adeno-associated virus - 5 1 208 74 84 11 HDISYNEQLEA 91.97
DP02489Q9YIJ1Capsid protein Adeno-associated virus - 5 1 208 95 104 10 ADAEFQEKLA 87.96
DP02490D1A4G7ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) 200 413 202 214 13 LPVAISLRSFARI 87.96
DP02490D1A4G7ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) 200 413 227 238 12 VRALIMQLAAFH 87.29
DP02490D1A4G7ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) 200 413 240 247 8 PDDVRITV 85.54
DP02490D1A4G7ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) 200 413 312 318 7 FHLVIVD 87.29
DP02490D1A4G7ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) 200 413 320 331 12 GQASYDSQIASD 86.4
DP02490D1A4G7ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) 200 413 335 353 19 GVCVIDLTGSVAETNEATM 87.96
DP02490D1A4G7ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) 200 413 383 394 12 DQASIAEAEALA 86.96
DP02493P21401Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) Rift valley fever virus (strain ZH-548 M12) (RVFV) 154 370 187 196 10 ACSSFDVLLE 86.56
DP02493P21401Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) Rift valley fever virus (strain ZH-548 M12) (RVFV) 154 370 299 305 7 LQDLFCQ 87.29
DP02493P21401Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) Rift valley fever virus (strain ZH-548 M12) (RVFV) 440 469 441 450 10 GIVQIQVSGV 91.97
DP02495Q928V6Putative integrase Bacteriophage A118 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) 133 350 165 173 9 TKLYINEEE 91.97
DP02495Q928V6Putative integrase Bacteriophage A118 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) 133 350 176 194 19 QLRLIYDIFEEEQSITFLQ 86.76
DP02495Q928V6Putative integrase Bacteriophage A118 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) 133 350 203 226 24 KVRTYNRYNNWLTNDLYCGYVSYK 89.37
DP02495Q928V6Putative integrase Bacteriophage A118 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) 133 350 241 252 12 EEQFYRVQEIFS 92.25
DP02495Q928V6Putative integrase Bacteriophage A118 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) 133 350 267 275 9 LLNNLVVCS 86.96
DP02495Q928V6Putative integrase Bacteriophage A118 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) 133 350 296 306 11 HYRYYSCKTYK 91.97
DP02495Q928V6Putative integrase Bacteriophage A118 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) 133 350 324 343 20 LEELIIDRVNNYSFASRNID 88.48
DP02495Q928V6Putative integrase Bacteriophage A118 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) 400 452 414 443 30 ADLATVDFNSLEFREKQLYLKSLINKIYID 87.63
DP02496P56926Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) 633 852 682 689 8 QDAEFTRL 86.62
DP02496P56926Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) 633 852 722 733 12 AQVASWTVNELV 88.02
DP02496P56926Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) 633 852 801 807 7 VAQVIAA 87.67
DP02496P56926Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) 633 852 821 833 13 ALLGFFTGQVMRA 91.48
DP02497P05844Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 Infectious pancreatic necrosis virus (strain Jasper) (IPNV) 735 960 835 845 11 SPEWIAENNYR 89.84
DP02497P05844Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 Infectious pancreatic necrosis virus (strain Jasper) (IPNV) 735 960 850 859 10 GQFKYYMITG 89.97
DP02497P05844Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 Infectious pancreatic necrosis virus (strain Jasper) (IPNV) 735 960 889 895 7 ANSVYGL 86.96
DP02497P05844Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 Infectious pancreatic necrosis virus (strain Jasper) (IPNV) 735 960 909 916 8 VVEVFAEN 88.29
DP02498A7YK37Capsid protein Murine norovirus GV/CR10/2005/USA 1 227 44 61 18 AAGQINQIDPWIFQNFVQ 91.23
DP02498A7YK37Capsid protein Murine norovirus GV/CR10/2005/USA 1 227 65 71 7 GEFSISP 91.97
DP02498A7YK37Capsid protein Murine norovirus GV/CR10/2005/USA 1 227 76 85 10 GEILFDLALG 92.64
DP02498A7YK37Capsid protein Murine norovirus GV/CR10/2005/USA 1 227 113 120 8 AGNAFTAG 87.63
DP02498A7YK37Capsid protein Murine norovirus GV/CR10/2005/USA 1 227 195 203 9 GDESFVVSG 87.63
DP02498A7YK37Capsid protein Murine norovirus GV/CR10/2005/USA 1 227 211 220 10 ADFNFVYLTP 95.55
DP02499A0KJC7ImpA-related domain protein Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) 1 230 88 108 21 LGAAISLLEAWIQAYWLLAWP 92.1
DP02499A0KJC7ImpA-related domain protein Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) 1 230 117 125 9 LMVQIVKRF 88.96
DP02499A0KJC7ImpA-related domain protein Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) 1 230 141 158 18 LAQLLAQAEQLERVWLAQ 86.96
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 1 232 8 14 7 LHQHYSK 87.29
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 1 232 51 69 19 LDDIYNNYTLAQGTNNNSV 96.2
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 1 232 76 84 9 NNQAINKFI 92.31
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 1 232 158 166 9 VSSEFNHLV 86.96
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 522 944 603 611 9 SVAAYVLNK 91.97
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 522 944 660 668 9 SVGSYVKTT 85.28
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 522 944 764 774 11 QIVNEVNNNTS 89.97
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 522 944 785 791 7 SLAIIEP 91.97
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 522 944 863 905 43 RALLFIRNDIESNYLLIAEIKLKYPFIHFQELVISQTKFSKLV 88.07
DP02500Q5A3P6Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) 522 944 907 939 33 SVGVFVISSIDNSLIFEVEKFEVNQWTEALAKS 89.2
DP02501P00800Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) Bacillus thermoproteolyticus 1 232 17 52 36 AAQVFLPYNALASTEHVTWNQQFQTPQFISGDLLKV 87.31
DP02501P00800Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) Bacillus thermoproteolyticus 1 232 58 75 18 EELVYQYVEKNENKFKFH 88.11
DP02501P00800Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) Bacillus thermoproteolyticus 1 232 92 104 13 LGFTFMRFQQTYK 93.23
DP02501P00800Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) Bacillus thermoproteolyticus 1 232 176 198 23 EFVVYVNGDEASLAYVVNLNFLT 94.88
DP02501P00800Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) Bacillus thermoproteolyticus 1 232 202 220 19 GNWLYIIDAVDGKILNKFN 92.59
DP02502A0R1T8LAO/AO transport system ATPase (EC 2.7.-.-) Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) 1 238 8 14 7 VPELITV 85.28
DP02502A0R1T8LAO/AO transport system ATPase (EC 2.7.-.-) Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) 1 238 136 148 13 AALSYDLIVLETV 88.73
DP02502A0R1T8LAO/AO transport system ATPase (EC 2.7.-.-) Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) 1 238 151 161 11 GQSEIEIAAIA 90.64
DP02502A0R1T8LAO/AO transport system ATPase (EC 2.7.-.-) Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) 1 238 226 233 8 LHELIEAI 90.34
DP02503Q28146Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) Bos taurus (Bovine) 31 280 65 71 7 GLVLYFD 96.75
DP02503Q28146Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) Bos taurus (Bovine) 31 280 78 85 8 FLELILTR 96.32
DP02503Q28146Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) Bos taurus (Bovine) 31 280 89 97 9 LQLSFSIFC 94.5
DP02503Q28146Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) Bos taurus (Bovine) 31 280 126 140 15 TTLFIDQVEAKWVEV 91.97
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 256 8 18 11 LVTAYTNANLG 86.96
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 256 28 35 8 TLDAYATQ 86.62
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 256 44 71 28 AAALTNTLKLVNSTTAVAIQTYQFFTGV 89.76
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 256 92 114 23 NDAYYSKFAQENRFINFSINLAT 92.35
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 256 119 151 33 GATAFAAAYTGVSYAQTVATAYDKIIGNAVATA 88.73
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 256 158 179 22 AAVAFLSRQANIDYLTAFVRAN 92.02
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 256 193 221 29 KAALIGTILNAATVSGIGGYATATAAMIN 90.87
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 256 234 243 10 AGVNLFTAYP 88.6
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 248 8 18 11 LVTAYTNANLG 86.96
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 248 28 35 8 TLDAYATQ 86.62
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 248 44 71 28 AAALTNTLKLVNSTTAVAIQTYQFFTGV 89.76
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 248 92 114 23 NDAYYSKFAQENRFINFSINLAT 92.35
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 248 119 151 33 GATAFAAAYTGVSYAQTVATAYDKIIGNAVATA 88.73
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 248 158 179 22 AAVAFLSRQANIDYLTAFVRAN 92.02
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 248 193 221 29 KAALIGTILNAATVSGIGGYATATAAMIN 90.87
DP02504P35828S-layer protein (Paracrystalline surface layer protein) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 248 234 243 10 AGVNLFTAYP 88.6
DP02505O53168Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 262 46 56 11 IAALIADVAKA 94.98
DP02505O53168Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 262 105 126 22 ANAAIAAAQHRFDTFAAATYMN 92.44
DP02505O53168Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 262 138 155 18 PDEIIATVTAAKTLSASS 87.63
DP02505O53168Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 262 233 240 8 RLVAWSSE 88.29
DP02506Q8A6W3SusC homolog Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) 1 235 14 31 18 VCFLFAFMSALWGQNITV 95.35
DP02506Q8A6W3SusC homolog Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) 1 235 41 61 21 GQPIIGASVVETTATTNGTIT 85.95
DP02506Q8A6W3SusC homolog Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) 1 235 63 85 23 FDGNFTLSVPVNSTLKITYIGYK 89.38
DP02506Q8A6W3SusC homolog Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) 1 235 90 102 13 KAAAIVNVLLEED 91.97
DP02506Q8A6W3SusC homolog Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) 1 235 200 217 18 DIESIQVLKDAASASIYG 87.85
DP02506Q8A6W3SusC homolog Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) 1 235 222 230 9 NGVIIITTK 89.52
DP02507Q84852Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Porcine respiratory coronavirus 17 299 30 42 13 QCASYVANVFTTQ 86.36
DP02507Q84852Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Porcine respiratory coronavirus 17 299 49 66 18 SDFSFNNWFLLTNSSTLV 91.75
DP02507Q84852Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Porcine respiratory coronavirus 17 299 90 98 9 AASTFCFEG 91.97
DP02507Q84852Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Porcine respiratory coronavirus 17 299 108 125 18 VLNNTVDVIRFNLNFTTN 88.74
DP02507Q84852Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Porcine respiratory coronavirus 17 299 132 151 20 ATVFSLNTTGGVTLEISCYN 87.07
DP02507Q84852Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Porcine respiratory coronavirus 17 299 158 168 11 SFSSYGEIPFG 87.29
DP02507Q84852Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Porcine respiratory coronavirus 17 299 176 189 14 CYVLYNGTALKYLG 94.65
DP02507Q84852Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Porcine respiratory coronavirus 17 299 196 228 33 KEIAISKWGHFYINGYNFFSTFPIDCISFNLTT 88.94
DP02507Q84852Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Porcine respiratory coronavirus 17 299 231 268 38 SDVFWTIAYTSYTEALVQVENTAITNVTYCNSYVNNIK 88.99
DP02508P12537Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 304 585 320 334 15 RILRYVQQSVSLNLM 85.95
DP02508P12537Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 304 585 377 387 11 NPEYFTNAILN 87.66
DP02508P12537Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 304 585 408 414 7 DGFLWDD 86.96
DP02508P12537Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 304 585 486 497 12 GEEEYLNNSLLQ 89.97
DP02509P0DOC6CRISPR-associated endoribonuclease Cas13a (EC 3.1.-.-) (CRISPR-associated endoribonuclease C2c2) (EndoRNase) (LshC2c2) Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) 103 174 104 113 10 EVVLYIEAYG 94.58
DP02509P0DOC6CRISPR-associated endoribonuclease Cas13a (EC 3.1.-.-) (CRISPR-associated endoribonuclease C2c2) (EndoRNase) (LshC2c2) Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) 103 174 151 158 8 NEEEIEID 86.62
DP02509P0DOC6CRISPR-associated endoribonuclease Cas13a (EC 3.1.-.-) (CRISPR-associated endoribonuclease C2c2) (EndoRNase) (LshC2c2) Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) 914 1005 922 942 21 KKEIFNNYYEDIKNNILTEFK 88.9
DP02509P0DOC6CRISPR-associated endoribonuclease Cas13a (EC 3.1.-.-) (CRISPR-associated endoribonuclease C2c2) (EndoRNase) (LshC2c2) Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) 914 1005 954 962 9 KLEKIVIFD 94.87
DP02510P09327Villin-1 Homo sapiens (Human) 360 613 371 380 10 EQVKFDATSM 91.64
DP02510P09327Villin-1 Homo sapiens (Human) 360 613 400 410 11 VQVWRIENLEL 87.14
DP02510P09327Villin-1 Homo sapiens (Human) 360 613 417 471 55 WLGHFYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYN 89.71
DP02510P09327Villin-1 Homo sapiens (Human) 360 613 495 501 7 RMVVYQG 88.29
DP02510P09327Villin-1 Homo sapiens (Human) 360 613 535 558 24 ARANFLNSNDVFVLKTQSCCYLWC 89.88
DP02510P09327Villin-1 Homo sapiens (Human) 360 613 592 598 7 ANFWMAL 86.62
DP02511P02640Villin-1 Gallus gallus (Chicken) 723 763 749 756 8 NEVFTATT 87.96
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 60 68 9 SDVLFGNES 96.32
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 104 116 13 RAGLIEHVNFKTL 86.83
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 134 160 27 LCITFTDGISGYVNLTHISEEFTSILE 90
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 206 223 18 RYFHIGQWLRCSVIKNTS 90.97
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 243 249 7 SSVNIYA 97.04
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 288 296 9 DFGNFEKLL 88.29
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 298 307 10 GAVFLGNITK 90.47
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 328 337 10 QISSIDAIIP 87.69
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 402 417 16 DKVLILSNLPHILKLE 87.42
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 443 453 11 RDSEYLYLALD 86.59
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 484 510 27 VDDIYQLSTDPKYLKLKYLRTNDIPIG 87.96
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 526 539 14 IELKIFNGQFKASV 87.34
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 582 588 7 SLVNIED 97.32
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 610 618 9 TLATIQVFK 88.41
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 620 628 9 NGCIISFFG 92.31
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 654 662 9 GQTVIVKLL 87.96
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 708 716 9 KDSVIVEIP 91.42
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 797 805 9 MHAYIKSIS 85.95
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 809 826 18 LFVAFNGKFIGLVLPSYA 99
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 836 848 13 KAFYINQSVTVYL 94.62
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 857 864 8 KFLLSLKA 85.95
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 909 936 28 QLNVILAANLHGRVDIAEVFDTYEEITD 87.9
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 996 1014 19 SLEEINIGQELTGFVNNSS 87.78
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 1017 1023 7 HLWLTIS 88.06
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 1038 1051 14 NDSNFSENIESVFP 89.25
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 1094 1107 14 RVLKIAEKYVLLDL 87.67
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 1113 1119 7 GISFITD 97.32
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 1191 1204 14 GIFVYLSRKVEAFV 92.81
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 1255 1263 9 VLKTYSDIK 86.29
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 1277 1300 24 DFGVFVKLDNTVNVTGLAHITEIA 87.46
DP02513Q05022rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 1408 1336 1351 16 KASHFSKEAELASTTT 86.96
DP02514P36594DNA-directed RNA polymerase II subunit rpb1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1498 1752 1501 1509 9 DAAAFSPLV 86.96
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 247 255 9 EQVTIQVLP 96.32
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 279 286 8 EEFLFYLP 88.29
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 294 302 9 SSNTYTLTD 85.62
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 327 337 11 ITVHYLDLSLN 92.64
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 352 360 9 VSCTISASR 86.96
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 362 373 12 ATVVWMKDNIRL 90.64
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 386 395 10 DAGNYVCETA 91.97
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 444 450 7 AIQWTIT 97.13
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 452 458 7 SGSVINQ 86.62
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 466 477 12 NGRYYSKIIISP 87.07
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 499 506 8 NVSAISIP 92.31
DP02515Q13740CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) Homo sapiens (Human) 246 583 525 551 27 QAKLIVGIVVGLLLAALVAGVVYWLYM 93.35
DP02516P56287Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 443 678 461 474 14 ASGLIESTNELHLS 87.29
DP02516P56287Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 443 678 500 507 8 SANTINSE 92.64
DP02516P56287Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 443 678 553 566 14 VRSAIVLALLRRIM 85.57
DP02516P56287Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 443 678 603 612 10 TLQKYCVRLS 90.97
DP02516P56287Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 443 678 619 641 23 QLLGYFYQLEIAEENAIQEWYSD 90.36
DP02517Q64487Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) Mus musculus (Mouse) 585 854 605 614 10 MQSMFAKNFH 87.96
DP02517Q64487Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) Mus musculus (Mouse) 585 854 625 636 12 LSWEIPENYNSA 86.96
DP02517Q64487Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) Mus musculus (Mouse) 585 854 639 645 7 FKILYDD 86.96
DP02517Q64487Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) Mus musculus (Mouse) 585 854 657 665 9 TQKLIVNLK 88.63
DP02517Q64487Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) Mus musculus (Mouse) 585 854 722 734 13 ANENIKGYYIIIV 93.54
DP02517Q64487Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) Mus musculus (Mouse) 585 854 810 821 12 SGQEYVFFVLAV 88.66
DP02518Q8ZRW0LPS-assembly protein LptD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 224 14 20 7 ASALYSH 91.97
DP02518Q8ZRW0LPS-assembly protein LptD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 224 50 58 9 LPVTINADN 91.97
DP02518Q8ZRW0LPS-assembly protein LptD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 224 160 173 14 NRYTILENGSFTSC 85.62
DP02518Q8ZRW0LPS-assembly protein LptD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 224 194 201 8 QVAEIWNA 92.31
DP02518Q8ZRW0LPS-assembly protein LptD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 224 208 219 12 VPIFYSPYLQLP 87.29
DP02518Q8ZRW0LPS-assembly protein LptD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 24 224 50 58 9 LPVTINADN 91.97
DP02518Q8ZRW0LPS-assembly protein LptD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 24 224 160 173 14 NRYTILENGSFTSC 85.62
DP02518Q8ZRW0LPS-assembly protein LptD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 24 224 194 201 8 QVAEIWNA 92.31
DP02518Q8ZRW0LPS-assembly protein LptD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 24 224 208 219 12 VPIFYSPYLQLP 87.29
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 115 415 155 162 8 TDSAIDIV 90.97
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 115 415 198 209 12 VEQIYPIESIIP 89.8
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 115 415 212 225 14 ELQFIRVSSILKEA 87
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 115 415 230 243 14 KLELFPYQNNSKYV 87.43
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 115 415 258 274 17 KLQLLYYLSLLLGVYEN 87.61
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 115 415 327 337 11 KILCYILAIIM 94.1
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 115 415 339 348 10 LDNFIVEITP 97.32
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 115 415 360 385 26 VVSLFRVLGAIVKGATVAQAEAFGIP 89.68
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 116 415 155 162 8 TDSAIDIV 90.97
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 116 415 198 209 12 VEQIYPIESIIP 89.8
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 116 415 212 225 14 ELQFIRVSSILKEA 87
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 116 415 230 243 14 KLELFPYQNNSKYV 87.43
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 116 415 258 274 17 KLQLLYYLSLLLGVYEN 87.61
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 116 415 327 337 11 KILCYILAIIM 94.1
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 116 415 339 348 10 LDNFIVEITP 97.32
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 116 415 360 385 26 VVSLFRVLGAIVKGATVAQAEAFGIP 89.68
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 182 403 198 209 12 VEQIYPIESIIP 89.8
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 182 403 212 225 14 ELQFIRVSSILKEA 87
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 182 403 230 243 14 KLELFPYQNNSKYV 87.43
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 182 403 258 274 17 KLQLLYYLSLLLGVYEN 87.61
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 182 403 327 337 11 KILCYILAIIM 94.1
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 182 403 339 348 10 LDNFIVEITP 97.32
DP02519Q01080DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 182 403 360 385 26 VVSLFRVLGAIVKGATVAQAEAFGIP 89.68
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 55 75 21 HTVITNVLIANNGIAAVKEIR 96.46
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 78 86 9 RKWAYETFG 89.74
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 123 137 15 NNHNYANVELIVDVA 93.31
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 208 220 13 SEVHIDENGIVTV 90.97
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 306 314 9 YGNNISLFG 94.87
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 323 335 13 HQKIIEEAPVTIA 89.48
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 360 368 9 GTVEYLYSH 96.62
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 370 379 10 DDKFYFLELN 87.42
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 400 407 8 AQLQIAMG 91.64
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 416 422 7 IRLLYGV 86.62
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 430 436 7 IDFEFKN 88.29
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 483 490 8 NVWGYFSV 88.17
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 503 511 9 QFGHIFAYG 94.65
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 536 566 31 TTVEYLIKLLETQAFEENTITTGWLDELISK 91.49
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 575 587 13 TNLAIICGAVIRA 95.65
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 619 625 7 VDFIYEG 98.66
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 639 647 9 TYRLFINGS 91.16
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1 699 670 680 11 HNVYWKDEATG 87.29
DP02520G0S3L5Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 1114 1185 1129 1136 8 IDWDFALR 85.95
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 185 270 185 191 7 GDFTLTA 85.28
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 185 270 224 247 24 ESVKFNAYESERWNTNLVKIREYT 91.6
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 185 270 258 265 8 SAKNIFLA 88.71
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 1759 1798 40 SEQNIAFECFKLITHFADSFIDSLSRSAFLQLIIDEFSYK 91.02
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 1805 1814 10 LYDIIKNGYN 85.28
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 1861 1876 16 INLTITGYNRSITIIG 87.42
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 1879 1890 12 NKLTYAELCLTR 86.96
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 1917 1929 13 KIQTYPGNYYITY 90.04
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 1935 1949 15 HQFVYQIHSHESITR 97.66
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 1958 1967 10 RTRIYNEITP 89.77
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 1978 2001 24 GDQRILIRSLDYLNNDIFSLSRIK 85.95
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 2006 2023 18 EFATIKKAHFSKMVSFEG 86.23
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 2043 2063 21 LNLNYDNIRNSNLISFSKLIC 90.06
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 2094 2102 9 PIFNIYYSK 95.54
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 2125 2139 15 FEEAFTFSENGFISP 92.22
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 2148 2175 28 VVSLIKLLKTNEWSTVIDKCIHICLIKN 91.34
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 2197 2211 15 RDINWVMFREFINSL 87.29
DP02521A5HC98RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) Bunyavirus La Crosse 1751 2263 2230 2239 10 CIALINSKFE 92.98
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 809 822 14 DSLLIIQWNIRAFM 92.52
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 829 837 9 WMKLYFKIK 90.41
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 905 917 13 CDQLIKNKIQLEA 86.62
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 985 993 9 LDEIIAKLT 97.32
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1062 1068 7 TQESIMD 90.97
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1142 1148 7 ELEEISE 86.96
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1235 1241 7 MEQIIKA 91.97
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1294 1300 7 KEALISQ 91.97
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1304 1314 11 GKLTYTQQLED 85.28
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1421 1427 7 LQNEIED 91.64
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1445 1468 24 KQRNFDKILAEWKQKYEESQSELE 86.96
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1505 1515 11 LQEEISDLTEQ 91.97
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1561 1569 9 AQLEFNQIK 97.32
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1667 1675 9 LKENIAIVE 87.22
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1703 1711 9 EQELIETSE 91.97
DP02522Q9BE39Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) Bos taurus (Bovine) 807 1935 1848 1856 9 KELTYQTEE 90.3
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 485 149 156 8 LDEYIAIA 93.31
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 485 199 211 13 DKVLFEQAFSFHG 90.2
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 485 228 237 10 SLVKFYYSWK 95.15
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 485 351 361 11 QIQNIKQTNSA 94.31
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 485 394 402 9 AVQAIRKYG 90.64
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 485 404 414 11 DFQAISDVIGN 94.98
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 485 419 442 24 QVKNFFVNYRRRFNIDEVLQEWEA 89.76
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 307 149 156 8 LDEYIAIA 93.31
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 307 199 211 13 DKVLFEQAFSFHG 90.2
DP02523Q9UKL0REST corepressor 1 (Protein CoREST) Homo sapiens (Human) 1 307 228 237 10 SLVKFYYSWK 95.15
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1842 1568 1578 11 QLAVYEEFARN 90.45
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1842 1608 1621 14 VAQIYDKCITELEQ 97.99
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1842 1719 1734 16 DEYKYNVEAVELLIRN 89.17
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1842 1752 1772 21 NGLNYMAVAFAMQLVKILLVD 96.23
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1842 1784 1795 12 LFHTIETLMRIN 87.29
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1842 1813 1822 10 VRSNYEAMID 85.95
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1832 1568 1578 11 QLAVYEEFARN 90.45
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1832 1608 1621 14 VAQIYDKCITELEQ 97.99
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1832 1719 1734 16 DEYKYNVEAVELLIRN 89.17
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1832 1752 1772 21 NGLNYMAVAFAMQLVKILLVD 96.23
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1832 1784 1795 12 LFHTIETLMRIN 87.29
DP02524A5YKK6CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) Homo sapiens (Human) 1565 1832 1813 1822 10 VRSNYEAMID 85.95
DP02525P9WGI1RNA polymerase sigma factor SigA (Sigma-A) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 224 200 206 7 GDFVWDE 88.29
DP02526C4R4Y0DNA-directed RNA polymerase subunit (EC 2.7.7.6) Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) 1454 1743 1514 1526 13 GLTEYAGIQSPYQ 87.29
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 920 1229 927 933 7 GFVEICV 97.99
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 920 1229 944 956 13 SSQLYYFMTLTLA 97.61
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 920 1229 969 979 11 TQVTITGTNLN 97.99
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 920 1229 1029 1051 23 QDLVFQYVEDPTIVRIEPEWSIV 89.84
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 920 1229 1063 1069 7 HLDLIQN 86.96
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 920 1229 1080 1092 13 EHINICEVLNATE 86.62
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 920 1229 1116 1139 24 EFGFILDNVQSLLILNKTNFTYYP 90.26
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 920 1229 1176 1185 10 VKLNYTVLVG 87.02
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 1004 1229 1029 1051 23 QDLVFQYVEDPTIVRIEPEWSIV 89.84
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 1004 1229 1063 1069 7 HLDLIQN 86.96
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 1004 1229 1080 1092 13 EHINICEVLNATE 86.62
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 1004 1229 1116 1139 24 EFGFILDNVQSLLILNKTNFTYYP 90.26
DP02528Q80UG2Plexin-A4 Mus musculus (Mouse) 1004 1229 1176 1185 10 VKLNYTVLVG 87.02
DP02529Q92558Wiskott-Aldrich syndrome protein family member 1 (WASP family protein member 1) (Protein WAVE-1) (Verprolin homology domain-containing protein 1) Homo sapiens (Human) 185 494 300 306 7 ATGLIEN 88.29
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 5 14 10 LLCLFFLFLG 97.89
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 70 77 8 CQLNFIEN 88.21
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 80 87 8 SQVEILKN 96.99
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 100 112 13 DIVQIAPQSLILK 90.43
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 133 145 13 VDLYYLMDLSASM 86.6
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 209 218 10 GFKHILPLTN 86.62
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 242 248 7 GFDAIMQ 88.63
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 264 277 14 HLLVFVSDADSHFG 89.97
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 305 317 13 TVLEYPTIGQLID 88.76
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 322 346 25 NNVLLIFAVTQEQVHLYENYAKLIP 96.24
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 360 372 13 ILQLIISAYEELR 94.29
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 385 401 17 GLNLSFTAICNNGTLFQ 86.39
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 528 537 10 PYGNIYGPYC 91.37
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 652 660 9 AGATISEEE 87.29
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 676 687 12 NECLITFLITTD 89.55
DP02530P18564Integrin beta-6 Homo sapiens (Human) 1 788 715 737 23 VSLAILLIGVVLLCIWKLLVSFH 89.75
DP02530P18564Integrin beta-6 Homo sapiens (Human) 492 788 528 537 10 PYGNIYGPYC 91.37
DP02530P18564Integrin beta-6 Homo sapiens (Human) 492 788 652 660 9 AGATISEEE 87.29
DP02530P18564Integrin beta-6 Homo sapiens (Human) 492 788 676 687 12 NECLITFLITTD 89.55
DP02530P18564Integrin beta-6 Homo sapiens (Human) 492 788 715 737 23 VSLAILLIGVVLLCIWKLLVSFH 89.75
DP02531S6B291IgG H chain Homo sapiens (Human) 240 465 290 299 10 PEVKFNWYVD 95.15
DP02531S6B291IgG H chain Homo sapiens (Human) 240 465 322 335 14 VSVLTVLHQDWLNG 86.96
DP02531S6B291IgG H chain Homo sapiens (Human) 240 465 396 403 8 IAVEWESN 86.96
DP02531S6B291IgG H chain Homo sapiens (Human) 240 465 420 430 11 DGSFFLYSKLT 96.81
DP02533P56696Potassium voltage-gated channel subfamily KQT member 4 (KQT-like 4) (Potassium channel subunit alpha KvLQT4) (Voltage-gated potassium channel subunit Kv7.4) Homo sapiens (Human) 550 593 561 567 7 VIEQYSA 87.29
DP02536P1582550S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) 30 62 34 42 9 GVVNIAGIP 98.66
DP02536P1582550S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) 74 348 81 93 13 LNGYITGQVGLIG 88.83
DP02536P1582550S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) 74 348 98 107 10 PFSLFQELEA 88.29
DP02536P1582550S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) 74 348 199 205 7 DGVLFEP 91.97
DP02536P1582550S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) 74 348 257 263 7 LQAAIED 91.97
DP02539Q16611Bcl-2 homologous antagonist/killer (Apoptosis regulator BAK) (Bcl-2-like protein 7) (Bcl2-L-7) Homo sapiens (Human) 64 98 76 82 7 RQLAIIG 92.79
DP02547Q9Y6G9Cytoplasmic dynein 1 light intermediate chain 1 (LIC1) (Dynein light chain A) (DLC-A) (Dynein light intermediate chain 1; cytosolic) Homo sapiens (Human) 388 523 443 453 11 VLANFFNSLLS 93.34
DP02548P0AES9Acid stress chaperone HdeA (10K-S protein) Escherichia coli (strain K12) 22 110 52 62 11 TAVGFAEALNN 85.95
DP02552P43629Killer cell immunoglobulin-like receptor 3DL1 (CD158 antigen-like family member E) (HLA-BW4-specific inhibitory NK cell receptor) (MHC class I NK cell receptor) (Natural killer-associated transcript 3) (NKAT-3) (p70 natural killer cell receptor clones CL-2/CL-11) (p70 NK receptor CL-2/CL-11) (CD antigen CD158e) Homo sapiens (Human) 361 444 403 412 10 HCVFTQRKIT 85.95
DP02552P43629Killer cell immunoglobulin-like receptor 3DL1 (CD158 antigen-like family member E) (HLA-BW4-specific inhibitory NK cell receptor) (MHC class I NK cell receptor) (Natural killer-associated transcript 3) (NKAT-3) (p70 natural killer cell receptor clones CL-2/CL-11) (p70 NK receptor CL-2/CL-11) (CD antigen CD158e) Homo sapiens (Human) 361 444 424 431 8 DTILYTEL 87.25
DP02561P60880Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) Homo sapiens (Human) 83 141 125 135 11 EQMAISGGFIR 86.96
DP02561P60880Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) Homo sapiens (Human) 111 141 125 135 11 EQMAISGGFIR 86.96
DP02576P56777Photosystem II CP47 reaction center protein (PSII 47 kDa protein) (Protein CP-47) Arabidopsis thaliana (Mouse-ear cress) 480 508 488 499 12 AQVEFGAFQKLG 89.72
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 25 40 16 GGCLFDEPYSTCGYSQ 88.96
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 44 55 12 DDFNWEQVNTLT 88.74
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 97 106 10 IDFHYFVSSK 92.81
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 113 121 9 LLNVYVKVN 94.98
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 128 134 7 PIWNISG 96.32
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 143 164 22 AELAISTFWPNFYQVIFEVITS 91.38
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 187 210 24 HFLRIQNVEVNAGQFATFQCSAIG 88.29
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 241 252 12 FIASFNVVNTTK 89.07
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 269 278 10 GISNYAELVV 98.33
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 293 308 16 VGATYLWIQLNANSIN 89.17
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 347 357 11 TEYEISVLLTR 88.29
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 412 423 12 SYNLTVHYCYQV 90.47
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 456 463 8 SVKLILMN 85.95
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 470 478 9 SQELIVQTD 97.32
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 495 505 11 FEEKIFLQWRE 87.29
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 509 534 26 TYGVITLYEITYKAVSSFDPEIDLSN 87.61
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 546 555 10 THFLFFGLYP 93.81
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 619 627 9 SVYQIVVEE 85.28
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 651 666 16 NASLLNSQYYFAAEFP 94.5
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 684 691 8 YNGYWNTP 86.79
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 21 742 697 706 10 SYRIYFQAAS 87.76
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 589 742 619 627 9 SVYQIVVEE 85.28
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 589 742 651 666 16 NASLLNSQYYFAAEFP 94.5
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 589 742 684 691 8 YNGYWNTP 86.79
DP02580P28827Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) (EC 3.1.3.48) Homo sapiens (Human) 589 742 697 706 10 SYRIYFQAAS 87.76
DP02584F1QGH7Catenin beta-1 (Beta-catenin) Danio rerio (Zebrafish) (Brachydanio rerio) 1 126 26 32 7 QQQSYLD 86.57
DP02584F1QGH7Catenin beta-1 (Beta-catenin) Danio rerio (Zebrafish) (Brachydanio rerio) 1 126 59 75 17 NQVLYEWEQGFNQSFNQ 94.04
DP02588P47273Uncharacterized protein MG027 Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) 78 99 82 94 13 NQLEIQTKYNKIS 89.4
DP02590P47523Uncharacterized protein MG281 Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) 37 74 41 51 11 NQSGYALVASG 86.29
DP02590P47523Uncharacterized protein MG281 Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) 37 74 57 65 9 GFKLFSTQS 91.64
DP02590P47523Uncharacterized protein MG281 Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) 469 556 472 484 13 NGVTFDENIKRIT 89.43
DP02591P78362SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal Homo sapiens (Human) 231 511 286 292 7 RLQEIEE 86.62
DP02591P78362SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal Homo sapiens (Human) 231 511 302 308 7 IEENITS 91.97
DP02591P78362SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal Homo sapiens (Human) 231 511 369 380 12 ELANIDPTWIES 90.64
DP02591P78362SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal Homo sapiens (Human) 231 511 423 437 15 SDYTYSSSYEQFNGE 91.97
DP02592Q9H8Y8Golgi reassembly-stacking protein 2 (GRS2) (Golgi phosphoprotein 6) (GOLPH6) (Golgi reassembly-stacking protein of 55 kDa) (GRASP55) (p59) Homo sapiens (Human) 209 452 287 293 7 NQSLTSV 86.96
DP02593Q9ESJ0Exportin-4 (Exp4) Mus musculus (Mouse) 507 530 514 525 12 HQQQFLASPGSS 87.04
DP02597O49195Vegetative storage protein 1 Arabidopsis thaliana (Mouse-ear cress) 16 48 33 43 11 ESNTIFGNEAE 85.28
DP02605P02533Keratin; type I cytoskeletal 14 (Cytokeratin-14) (CK-14) (Keratin-14) (K14) Homo sapiens (Human) 295 331 302 314 13 AEEWFFTKTEELN 95.83
DP02607Q9UNA0A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAM-TS 5) (ADAM-TS5) (ADAMTS-5) (EC 3.4.24.-) (A disintegrin and metalloproteinase with thrombospondin motifs 11) (ADAM-TS 11) (ADAMTS-11) (ADMP-2) (Aggrecanase-2) Homo sapiens (Human) 557 628 585 592 8 GGVQFAYR 94.4
DP02608Q8IUQ4E3 ubiquitin-protein ligase SIAH1 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SIAH1) (Seven in absentia homolog 1) (Siah-1) (Siah-1a) Homo sapiens (Human) 90 124 92 101 10 NSVLFPCKYA 90.64
DP02619Q0WYX8MAM domain-containing glycosylphosphatidylinositol anchor protein 1 Gallus gallus (Chicken) 736 920 793 802 10 PEGYYMFIEA 86.92
DP02619Q0WYX8MAM domain-containing glycosylphosphatidylinositol anchor protein 1 Gallus gallus (Chicken) 736 920 811 846 36 KARLISPLYNITAKYYCVSFYYHMYGKHIGSLNLLV 89.92
DP02619Q0WYX8MAM domain-containing glycosylphosphatidylinositol anchor protein 1 Gallus gallus (Chicken) 736 920 856 863 8 TQVWSLSG 93.31
DP02619Q0WYX8MAM domain-containing glycosylphosphatidylinositol anchor protein 1 Gallus gallus (Chicken) 736 920 881 889 9 PFQIIFEGV 96.62
DP02619Q0WYX8MAM domain-containing glycosylphosphatidylinositol anchor protein 1 Gallus gallus (Chicken) 736 920 896 906 11 GDIAIDDVTLK 91.97
DP02620Q14194Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (Inactive dihydropyrimidinase) (Unc-33-like phosphoprotein 3) (ULIP-3) Homo sapiens (Human) 497 572 535 548 14 HQSNFSLSGAQIDD 96.32
DP02626Q9QUG2DNA polymerase kappa (EC 2.7.7.7) (DINB protein) (DINP) Mus musculus (Mouse) 546 616 590 597 8 QALQILEP 86.75
DP02644Q9SUM3NADPH--cytochrome P450 reductase 2 (CPR 2) (P450R 2) (EC 1.6.2.4) Arabidopsis thaliana (Mouse-ear cress) 73 303 103 112 10 KKVTIFFGTQ 88.29
DP02644Q9SUM3NADPH--cytochrome P450 reductase 2 (CPR 2) (P450R 2) (EC 1.6.2.4) Arabidopsis thaliana (Mouse-ear cress) 73 303 158 169 12 EDVAFFFLATYG 92
DP02644Q9SUM3NADPH--cytochrome P450 reductase 2 (CPR 2) (P450R 2) (EC 1.6.2.4) Arabidopsis thaliana (Mouse-ear cress) 73 303 177 186 10 AARFYKWFTE 89.43
DP02644Q9SUM3NADPH--cytochrome P450 reductase 2 (CPR 2) (P450R 2) (EC 1.6.2.4) Arabidopsis thaliana (Mouse-ear cress) 73 303 276 286 11 AAVLEYRVSIH 88.14
DP02644Q9SUM3NADPH--cytochrome P450 reductase 2 (CPR 2) (P450R 2) (EC 1.6.2.4) Arabidopsis thaliana (Mouse-ear cress) 73 303 289 298 10 EDAKFNDINM 85.28
DP02644Q9SUM3NADPH--cytochrome P450 reductase 2 (CPR 2) (P450R 2) (EC 1.6.2.4) Arabidopsis thaliana (Mouse-ear cress) 263 303 276 286 11 AAVLEYRVSIH 88.14
DP02644Q9SUM3NADPH--cytochrome P450 reductase 2 (CPR 2) (P450R 2) (EC 1.6.2.4) Arabidopsis thaliana (Mouse-ear cress) 263 303 289 298 10 EDAKFNDINM 85.28
DP02652Q96FQ6Protein S100-A16 (Aging-associated gene 13 protein) (Protein S100-F) (S100 calcium-binding protein A16) Homo sapiens (Human) 51 71 59 66 8 ADKLIQNL 86.91
DP02656P08294Extracellular superoxide dismutase Cu-Zn (EC-SOD) (EC 1.15.1.1) Homo sapiens (Human) 19 54 31 37 7 SAEWIRD 90.97
DP02656P08294Extracellular superoxide dismutase Cu-Zn (EC-SOD) (EC 1.15.1.1) Homo sapiens (Human) 19 54 42 49 8 VTEIWQEV 86.96
DP02679Q8R464Cell adhesion molecule 4 (Immunoglobulin superfamily member 4C) (IgSF4C) (Nectin-like protein 4) (NECL-4) (TSLC1-like protein 2) Mus musculus (Mouse) 25 120 38 44 7 GVAEITC 87.96
DP02679Q8R464Cell adhesion molecule 4 (Immunoglobulin superfamily member 4C) (IgSF4C) (Nectin-like protein 4) (NECL-4) (TSLC1-like protein 2) Mus musculus (Mouse) 25 120 49 69 21 YDGSIVVIQNPARQTLFFNGT 93.82
DP02679Q8R464Cell adhesion molecule 4 (Immunoglobulin superfamily member 4C) (IgSF4C) (Nectin-like protein 4) (NECL-4) (TSLC1-like protein 2) Mus musculus (Mouse) 25 120 103 110 8 FCQLYTED 96.66
DP02690F4JL28Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS) Arabidopsis thaliana (Mouse-ear cress) 197 234 218 229 12 RLSLFSHLLYRC 88.46
DP02690F4JL28Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS) Arabidopsis thaliana (Mouse-ear cress) 200 234 218 229 12 RLSLFSHLLYRC 88.46
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 62 81 20 QGYVYAQSVDITSSWDFGIR 87.63
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 138 144 7 KQSILSV 85.28
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 156 164 9 PFNEYSKFD 86.62
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 203 217 15 VQDLIGLICWQYTSE 89.97
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 226 235 10 NVSAYCLHIA 91.71
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 276 284 9 KESLFVRIN 95.21
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 288 294 7 GFSLIQV 97.99
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 345 352 8 SAWEFCLV 91.97
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 359 374 16 ADGVFEEDSQIDIATV 85.28
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 421 427 7 TKFWIKQ 90.97
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 451 462 12 AIFKLTYLSNHD 85.4
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 1 522 464 489 26 KHLYFESDAATVNEIVLKVNYILESR 91.93
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 248 522 276 284 9 KESLFVRIN 95.21
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 248 522 288 294 7 GFSLIQV 97.99
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 248 522 345 352 8 SAWEFCLV 91.97
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 248 522 359 374 16 ADGVFEEDSQIDIATV 85.28
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 248 522 421 427 7 TKFWIKQ 90.97
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 248 522 451 462 12 AIFKLTYLSNHD 85.4
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 248 522 464 489 26 KHLYFESDAATVNEIVLKVNYILESR 91.93
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 360 522 421 427 7 TKFWIKQ 90.97
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 360 522 451 462 12 AIFKLTYLSNHD 85.4
DP02693Q9BPZ7Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1) Homo sapiens (Human) 360 522 464 489 26 KHLYFESDAATVNEIVLKVNYILESR 91.93
DP02703O00411DNA-directed RNA polymerase; mitochondrial (MtRPOL) (EC 2.7.7.6) Homo sapiens (Human) 1086 1108 1094 1101 8 GIQSITYT 87.88
DP02711Q9V6K1Tripeptidyl-peptidase 2 (TPP-2) (EC 3.4.14.10) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase II) (TPP-II) (dTPP II) Drosophila melanogaster (Fruit fly) 1027 1098 1034 1052 19 TLDFYENYNQCIVGGRKYV 88.66
DP02711Q9V6K1Tripeptidyl-peptidase 2 (TPP-2) (EC 3.4.14.10) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase II) (TPP-II) (dTPP II) Drosophila melanogaster (Fruit fly) 1027 1098 1060 1069 10 TRVLYIAPIT 95.35
DP02711Q9V6K1Tripeptidyl-peptidase 2 (TPP-2) (EC 3.4.14.10) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase II) (TPP-II) (dTPP II) Drosophila melanogaster (Fruit fly) 1027 1098 1080 1093 14 AQCAWLSGNLVFPQ 91.97
DP02713P18615Negative elongation factor E (NELF-E) (RNA-binding protein RD) Homo sapiens (Human) 139 363 261 269 9 GNTLYVYGE 90.49
DP02713P18615Negative elongation factor E (NELF-E) (RNA-binding protein RD) Homo sapiens (Human) 139 363 282 289 8 PFGNIIDL 90.93
DP02713P18615Negative elongation factor E (NELF-E) (RNA-binding protein RD) Homo sapiens (Human) 139 363 318 330 13 TQVESVQLKVNIA 89.55
DP02722P33334Pre-mRNA-splicing factor 8 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 2087 2147 2129 2142 14 QGEEIVVVASADYE 85.98
DP02726Q42521Glutamate decarboxylase 1 (GAD 1) (EC 4.1.1.15) Arabidopsis thaliana (Mouse-ear cress) 1 57 14 23 10 VHSTFASRYV 86.69
DP02726Q42521Glutamate decarboxylase 1 (GAD 1) (EC 4.1.1.15) Arabidopsis thaliana (Mouse-ear cress) 1 57 39 52 14 KEAAYQIINDELML 96.44
DP02736Q04049DNA polymerase eta (EC 2.7.7.7) (Radiation-sensitive protein 30) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 510 632 521 529 9 NQVHTFKSS 87.63
DP02736Q04049DNA polymerase eta (EC 2.7.7.7) (Radiation-sensitive protein 30) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 510 632 555 561 7 YQVTFTD 97.99
DP02741P09951Synapsin-1 (Synapsin I) Rattus norvegicus (Rat) 2 111 73 84 12 GGGFFSSLSNAV 86.96
DP02741P09951Synapsin-1 (Synapsin I) Rattus norvegicus (Rat) 2 111 91 99 9 AAATFSEQV 91.97
DP02744Q92574Hamartin (Tuberous sclerosis 1 protein) Homo sapiens (Human) 939 992 955 967 13 TQVFELEILDLYG 87.19
DP02746Q14565Meiotic recombination protein DMC1/LIM15 homolog Homo sapiens (Human) 1 82 17 25 9 EESLFQDID 88.29
DP02756P21447ATP-dependent translocase ABCB1 (ATP-binding cassette sub-family B member 1A) (MDR1A) (Multidrug resistance protein 1A) (EC 7.6.2.2) (Multidrug resistance protein 3) (P-glycoprotein 3) (Phospholipid transporter ABCB1) (EC 7.6.2.1) Mus musculus (Mouse) 627 686 627 637 11 AGNEIELGNEA 85.62
DP02756P21447ATP-dependent translocase ABCB1 (ATP-binding cassette sub-family B member 1A) (MDR1A) (Multidrug resistance protein 1A) (EC 7.6.2.2) (Multidrug resistance protein 3) (P-glycoprotein 3) (Phospholipid transporter ABCB1) (EC 7.6.2.1) Mus musculus (Mouse) 627 683 627 637 11 AGNEIELGNEA 85.62
DP02761P25299"mRNA 3-end-processing protein RNA15" "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 127 232 136 146 11 GNANFLSQKFP 86.2
DP02761P25299"mRNA 3-end-processing protein RNA15" "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 127 232 152 160 9 IDVNINMTT 98.66
DP02761P25299"mRNA 3-end-processing protein RNA15" "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 127 232 176 190 15 VQLKFLQKFQEWTRA 88.49
DP02761P25299"mRNA 3-end-processing protein RNA15" "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 127 232 211 219 9 ELLLTNGIC 85.28
DP02764Q13162Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4) Homo sapiens (Human) 1 271 24 32 9 PLLLFLLPA 85.58
DP02764Q13162Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4) Homo sapiens (Human) 1 271 109 123 15 KYLVFFFYPLDFTFV 97.66
DP02764Q13162Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4) Homo sapiens (Human) 1 271 156 162 7 HLAWINT 98.33
DP02764Q13162Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4) Homo sapiens (Human) 1 271 187 194 8 DYGVYLED 86.96
DP02764Q13162Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4) Homo sapiens (Human) 1 271 200 207 8 RGLFIIDD 97.16
DP02764Q13162Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4) Homo sapiens (Human) 1 271 231 239 9 LVQAFQYTD 91.82
DP02764Q13162Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4) Homo sapiens (Human) 1 75 24 32 9 PLLLFLLPA 85.58
DP02768P099505-aminolevulinate synthase; mitochondrial (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 83 113 89 104 16 SYRYFNNINRLAKEFP 97.41
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1 26 1 9 9 MFVFLVLLP 93.65
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1 26 14 20 7 QCVNLTT 86.62
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 319 541 338 356 19 FGEVFNATRFASVYAWNRK 87.61
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 319 541 365 381 17 YSVLYNSASFSTFKCYG 92.48
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 319 541 388 404 17 NDLCFTNVYADSFVIRG 87.33
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 319 541 430 442 13 TGCVIAWNSNNLD 89.32
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 319 541 445 457 13 VGGNYNYLYRLFR 89.35
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 319 541 469 475 7 STEIYQA 91.97
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 319 541 485 520 36 GFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHA 86.26
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 437 508 445 457 13 VGGNYNYLYRLFR 89.35
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 437 508 469 475 7 STEIYQA 91.97
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 437 508 485 503 19 GFNCYFPLQSYGFQPTNGV 86.31
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 455 490 469 475 7 STEIYQA 91.97
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1147 1208 1175 1184 10 SVVNIQKEID 97.66
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1147 1208 1194 1203 10 NESLIDLQEL 93.65
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1148 1273 1175 1184 10 SVVNIQKEID 97.66
DP02772P0DTC2"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1148 1273 1194 1233 40 NESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIM 93.72
DP02782Q9NPI8Fanconi anemia group F protein (Protein FACF) Homo sapiens (Human) 156 357 197 211 15 PQNNFLKVIAVALLQ 86.53
DP02782Q9NPI8Fanconi anemia group F protein (Protein FACF) Homo sapiens (Human) 156 357 236 252 17 VLVHWLLGNSEVFAAFC 91.97
DP02782Q9NPI8Fanconi anemia group F protein (Protein FACF) Homo sapiens (Human) 156 357 343 352 10 GLSIWTDLLL 88.63
DP02787P45523FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (PPIase) (EC 5.2.1.8) (Rotamase) Escherichia coli (strain K12) 15 114 94 109 16 SDQEIEQTLQAFEARV 89.92
DP02791O08908Phosphatidylinositol 3-kinase regulatory subunit beta (PI3-kinase regulatory subunit beta) (PI3K regulatory subunit beta) (PtdIns-3-kinase regulatory subunit beta) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta) (PI3-kinase subunit p85-beta) (PtdIns-3-kinase regulatory subunit p85-beta) Mus musculus (Mouse) 576 607 584 593 10 KINEWLGIKN 85.28
DP02795Q9NV23S-acyl fatty acid synthase thioesterase; medium chain (EC 3.1.2.14) (Augmented in rheumatoid arthritis 1) (AURA1) (Oleoyl-ACP hydrolase) (Thioesterase 2) (TE2) (Thioesterase II) (Thioesterase domain-containing protein 1) Homo sapiens (Human) 1 24 11 19 9 RNENIFNCL 91.9
DP02796Q56026Cell invasion protein SipD (Salmonella invasion protein D) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 110 132 113 121 9 TSALFSASP 87.29
DP02800P63028Translationally-controlled tumor protein (TCTP) (21 kDa polypeptide) (p21) (p23) Mus musculus (Mouse) 39 66 39 56 18 TEGAIDDSLIGGNASAEG 89.24
DP02801P05452Tetranectin (TN) (C-type lectin domain family 3 member B) (Plasminogen kringle 4-binding protein) Homo sapiens (Human) 1 49 3 22 20 LWGAYLLLCLFSLLTQVTTE 87.88
DP02806P0CY08Mating-type protein ALPHA2 (MATalpha2 protein) (Alpha-2 repressor) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 103 132 112 127 16 DGLVFNVVTQDMINKS 85.28
DP02820Q62264Thyroid hormone-inducible hepatic protein (Spot 14 protein) (S14) (SPOT14) Mus musculus (Mouse) 1 150 55 70 16 DLYTYFTMLKSICVEV 92.12
DP02822Q8IVH8Mitogen-activated protein kinase kinase kinase kinase 3 (EC 2.7.11.1) (Germinal center kinase-related protein kinase) (GLK) (MAPK/ERK kinase kinase kinase 3) (MEK kinase kinase 3) (MEKKK 3) Homo sapiens (Human) 315 380 362 375 14 SEEIYYTARSNLDL 88.08
DP02826P40344Autophagy-related protein 3 (Autophagy-related E2-like conjugation enzyme ATG3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 84 162 104 110 7 DVLEYIG 94.51
DP02826P40344Autophagy-related protein 3 (Autophagy-related E2-like conjugation enzyme ATG3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 84 162 132 142 11 IDELIQDMEIK 92.98
DP02826P40344Autophagy-related protein 3 (Autophagy-related E2-like conjugation enzyme ATG3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 84 128 104 110 7 DVLEYIG 94.51
DP02832Q7L2J07SK snRNA methylphosphate capping enzyme (MePCE) (EC 2.1.1.-) (Bicoid-interacting protein 3 homolog) (Bin3 homolog) Homo sapiens (Human) 400 689 414 426 13 QYGNYCKYYGYRN 88.6
DP02832Q7L2J07SK snRNA methylphosphate capping enzyme (MePCE) (EC 2.1.1.-) (Bicoid-interacting protein 3 homolog) (Bin3 homolog) Homo sapiens (Human) 400 689 457 466 10 LTLSIACKWG 86.96
DP02832Q7L2J07SK snRNA methylphosphate capping enzyme (MePCE) (EC 2.1.1.-) (Bicoid-interacting protein 3 homolog) (Bin3 homolog) Homo sapiens (Human) 400 689 486 495 10 NIRHYLSEEL 87.29
DP02832Q7L2J07SK snRNA methylphosphate capping enzyme (MePCE) (EC 2.1.1.-) (Bicoid-interacting protein 3 homolog) (Bin3 homolog) Homo sapiens (Human) 400 689 551 564 14 NNVVFVTGNYVLDR 92.45
DP02832Q7L2J07SK snRNA methylphosphate capping enzyme (MePCE) (EC 2.1.1.-) (Bicoid-interacting protein 3 homolog) (Bin3 homolog) Homo sapiens (Human) 400 689 629 641 13 LTETIYKNYYRIQ 87.68
DP02832Q7L2J07SK snRNA methylphosphate capping enzyme (MePCE) (EC 2.1.1.-) (Bicoid-interacting protein 3 homolog) (Bin3 homolog) Homo sapiens (Human) 400 689 657 667 11 GFSSYELVATP 91.64
DP02836P24785Dosage compensation regulator (EC 3.6.4.13) (ATP-dependent RNA helicase mle) (Protein male-less) (Protein maleless) (Protein no action potential) Drosophila melanogaster (Fruit fly) 1 142 4 17 14 KSFLYQFCAKSQIE 95.65
DP02836P24785Dosage compensation regulator (EC 3.6.4.13) (ATP-dependent RNA helicase mle) (Protein male-less) (Protein maleless) (Protein no action potential) Drosophila melanogaster (Fruit fly) 1 142 63 71 9 DFVNYLVRV 88.26
DP02836P24785Dosage compensation regulator (EC 3.6.4.13) (ATP-dependent RNA helicase mle) (Protein male-less) (Protein maleless) (Protein no action potential) Drosophila melanogaster (Fruit fly) 1 104 4 17 14 KSFLYQFCAKSQIE 95.65
DP02836P24785Dosage compensation regulator (EC 3.6.4.13) (ATP-dependent RNA helicase mle) (Protein male-less) (Protein maleless) (Protein no action potential) Drosophila melanogaster (Fruit fly) 1 104 63 71 9 DFVNYLVRV 88.26
DP02836P24785Dosage compensation regulator (EC 3.6.4.13) (ATP-dependent RNA helicase mle) (Protein male-less) (Protein maleless) (Protein no action potential) Drosophila melanogaster (Fruit fly) 81 164 136 144 9 RYSVIDRIQ 85.95
DP02836P24785Dosage compensation regulator (EC 3.6.4.13) (ATP-dependent RNA helicase mle) (Protein male-less) (Protein maleless) (Protein no action potential) Drosophila melanogaster (Fruit fly) 81 164 151 159 9 EAEAFDVNA 85.95
DP02839O43070DNA repair and telomere maintenance protein nbs1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 330 553 337 348 12 IQKNIVDDLFSV 88.43
DP02839O43070DNA repair and telomere maintenance protein nbs1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 330 553 429 439 11 TKVEYVSYNSV 94.59
DP02839O43070DNA repair and telomere maintenance protein nbs1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 330 553 491 500 10 GSVEYIRIMS 88.36
DP02839O43070DNA repair and telomere maintenance protein nbs1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 330 553 510 516 7 HTSKYYS 86.96
DP02839O43070DNA repair and telomere maintenance protein nbs1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 330 553 533 542 10 PLQAFLSLSE 86.89
DP02839O43070DNA repair and telomere maintenance protein nbs1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 474 531 491 500 10 GSVEYIRIMS 88.36
DP02839O43070DNA repair and telomere maintenance protein nbs1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 474 531 510 516 7 HTSKYYS 86.96
DP02839O43070DNA repair and telomere maintenance protein nbs1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 477 526 491 500 10 GSVEYIRIMS 88.36
DP02839O43070DNA repair and telomere maintenance protein nbs1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 477 526 510 516 7 HTSKYYS 86.96
DP02847P47110DNA polymerase delta subunit 3 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 117 350 212 220 9 LNNLFVEDD 93.65
DP02847P47110DNA polymerase delta subunit 3 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 117 350 294 301 8 EDGYIVTK 91.97
DP02848P15436"DNA polymerase delta catalytic subunit (EC 2.7.7.7) (3-5 exodeoxyribonuclease) (EC 3.1.11.-) (DNA polymerase III)" "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1007 1051 1031 1042 12 SGELYIKALYDV 91.64
DP02850O60239SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK) Homo sapiens (Human) 266 452 306 314 9 SCSNFVSED 91.97
DP02850O60239SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK) Homo sapiens (Human) 266 452 424 437 14 GQALENRMKQLSLQ 85.62
DP02853Q99P68Sclerostin Mus musculus (Mouse) 1 51 6 19 14 APCLICLLVHAAFC 87.22
DP02854Q9BYF1Angiotensin-converting enzyme 2 (EC 3.4.17.23) (Angiotensin-converting enzyme homolog) (ACEH) (Angiotensin-converting enzyme-related carboxypeptidase) (ACE-related carboxypeptidase) (EC 3.4.17.-) (Metalloprotease MPROT15) Cleaved into: Processed angiotensin-converting enzyme 2 Homo sapiens (Human) 769 805 794 800 7 GFQNTDD 87.29
DP02862P08670Vimentin Homo sapiens (Human) 99 144 113 137 25 RFANYIDKVRFLEQQNKILLAELEQ 93.97
DP02863P62558Protein SopB (Plasmid partition protein B) Escherichia coli (strain K12) 272 323 310 318 9 KIEAILKEL 91.97
DP02863P62558Protein SopB (Plasmid partition protein B) Escherichia coli (strain K12) 275 323 310 318 9 KIEAILKEL 91.97
DP02869Q16630Cleavage and polyadenylation specificity factor subunit 6 (Cleavage and polyadenylation specificity factor 68 kDa subunit) (CPSF 68 kDa subunit) (Cleavage factor Im complex 68 kDa subunit) (CFIm68) (Pre-mRNA cleavage factor Im 68 kDa subunit) (Protein HPBRII-4/7) Homo sapiens (Human) 13 80 14 25 12 VGEEFNQEAEYG 86.96
DP02869Q16630Cleavage and polyadenylation specificity factor subunit 6 (Cleavage and polyadenylation specificity factor 68 kDa subunit) (CPSF 68 kDa subunit) (Cleavage factor Im complex 68 kDa subunit) (CFIm68) (Pre-mRNA cleavage factor Im 68 kDa subunit) (Protein HPBRII-4/7) Homo sapiens (Human) 13 80 29 39 11 QIDLYDDVISP 88.29
DP02878Q8XAD5Uncharacterized protein Escherichia coli O157:H7 1 63 8 33 26 MVSEFETIEQENSYNEWLRAKVATSL 89.16
DP02878Q8XAD5Uncharacterized protein Escherichia coli O157:H7 5 49 8 33 26 MVSEFETIEQENSYNEWLRAKVATSL 89.16
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1 260 1 12 12 MFIFLLFLTLTS 92.64
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1 260 38 65 28 RGVYYPDEIFRSDTLYLTQDLFLPFYSN 88.69
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1 260 68 77 10 GFHTINHTFG 92.64
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1 260 84 96 13 KDGIYFAATEKSN 90.97
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1 260 111 139 29 SQSVIIINNSTNVVIRACNFELCDNPFFA 90.27
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1 260 149 172 24 HTMIFDNAFNCTFEYISDAFSLDV 94.7
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1 260 191 204 14 DGFLYVYKGYQPID 88.72
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1 260 224 239 16 LGINITNFRAILTAFS 89.86
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1 260 248 255 8 SAAAYFVG 94.23
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1059 1196 1075 1121 47 GVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYD 91.74
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1059 1196 1157 1166 10 SVVNIQKEID 97.66
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1059 1196 1176 1191 16 NESLIDLQELGKYEQY 93.39
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1105 1193 1108 1121 14 CDVVIGIINNTVYD 89.25
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1105 1193 1157 1166 10 SVVNIQKEID 97.66
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1105 1193 1176 1188 13 NESLIDLQELGKY 93.57
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1120 1196 1157 1166 10 SVVNIQKEID 97.66
DP02879P59594"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Severe acute respiratory syndrome coronavirus (SARS-CoV) 1120 1196 1176 1191 16 NESLIDLQELGKYEQY 93.39
DP02880K9N5Q8"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) 1207 1294 1207 1217 11 PQVTYQNISTN 88.66
DP02880K9N5Q8"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) 1207 1294 1235 1282 48 LDEFFKNVSTSIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYID 90.3
DP02889P03407"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein" Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) (HIV-1) 45 71 57 66 10 ADCAWLEAQE 87.96
DP02889P03407"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein" Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) (HIV-1) 45 69 57 64 8 ADCAWLEA 87.96
DP02894Q9BZZ5-2Apoptosis inhibitor 5 (API-5) (Antiapoptosis clone 11 protein) (AAC-11) (Cell migration-inducing gene 8 protein) (Fibroblast growth factor 2-interacting factor) (FIF) (Protein XAGL) Homo sapiens (Human) 455 504 491 499 9 NLGNFNYER 96.84
DP02900P0A968Cold shock-like protein CspD (CSP-D) Escherichia coli (strain K12) 1 74 4 11 8 GTVKWFNN 91.39
DP02900P0A968Cold shock-like protein CspD (CSP-D) Escherichia coli (strain K12) 1 74 24 35 12 GEDIFAHYSTIQ 90.72
DP02901J7QA90DUF1778 domain-containing protein (Hypothetical protein) (Toxin-antitoxin system antitoxin component) (Toxin-antitoxin system protein) (Toxin-antitoxin system; antitoxin component) (Toxin-antitoxin system; antitoxin component; ribbon-helix-helix fold protein) (Uncharacterized protein conserved in bacteria;Protein of uncharacterized function (DUF1778)) (Ybl13) Escherichia coli 44 88 44 50 7 AAEVIEQ 87.15
DP02903P78953Anillin-related medial ring protein mid1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 452 2 9 8 KEQEFSYR 86.96
DP02903P78953Anillin-related medial ring protein mid1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 452 21 28 8 LENSFLSS 85.95
DP02903P78953Anillin-related medial ring protein mid1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 452 355 362 8 YDELYLQS 97.32
DP02903P78953Anillin-related medial ring protein mid1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 452 369 391 23 EISTIINDSLQQENMDEDISATS 87.41
DP02903P78953Anillin-related medial ring protein mid1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 452 402 409 8 GSVTYHEV 87.29
DP02903P78953Anillin-related medial ring protein mid1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 452 438 446 9 NLSAILSSE 94.31
DP02903P78953Anillin-related medial ring protein mid1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 308 2 9 8 KEQEFSYR 86.96
DP02903P78953Anillin-related medial ring protein mid1 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 308 21 28 8 LENSFLSS 85.95
DP02913P04004Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B Homo sapiens (Human) 1 130 11 24 14 ALLAWVALADQESC 92.31
DP02913P04004Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B Homo sapiens (Human) 1 130 42 48 7 ELCSYYQ 95.32
DP02913P04004Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B Homo sapiens (Human) 1 71 11 24 14 ALLAWVALADQESC 92.31
DP02913P04004Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B Homo sapiens (Human) 1 71 42 48 7 ELCSYYQ 95.32
DP02913P04004Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B Homo sapiens (Human) 22 58 42 48 7 ELCSYYQ 95.32
DP02915P48443Retinoic acid receptor RXR-gamma (Nuclear receptor subfamily 2 group B member 3) (Retinoid X receptor gamma) Homo sapiens (Human) 2 127 4 12 9 NYSHFMKFP 91.97
DP02915P48443Retinoic acid receptor RXR-gamma (Nuclear receptor subfamily 2 group B member 3) (Retinoid X receptor gamma) Homo sapiens (Human) 2 127 101 109 9 NVVNSVSSS 89.97
DP02917Q02521Pre-mRNA-splicing factor SPP2 (Spliceosome maturation protein SPP2) (Suppressor of PRP protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 10 185 29 45 17 KANLFDWDDAETASLSH 91.97
DP02917Q02521Pre-mRNA-splicing factor SPP2 (Spliceosome maturation protein SPP2) (Suppressor of PRP protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 10 185 52 60 9 KIQSIDKFD 87.96
DP02917Q02521Pre-mRNA-splicing factor SPP2 (Spliceosome maturation protein SPP2) (Suppressor of PRP protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 10 185 87 100 14 PLVEYVTEKEYNEV 91.97
DP02917Q02521Pre-mRNA-splicing factor SPP2 (Spliceosome maturation protein SPP2) (Suppressor of PRP protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 10 150 29 45 17 KANLFDWDDAETASLSH 91.97
DP02917Q02521Pre-mRNA-splicing factor SPP2 (Spliceosome maturation protein SPP2) (Suppressor of PRP protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 10 150 52 60 9 KIQSIDKFD 87.96
DP02917Q02521Pre-mRNA-splicing factor SPP2 (Spliceosome maturation protein SPP2) (Suppressor of PRP protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 10 150 87 100 14 PLVEYVTEKEYNEV 91.97
DP02920Q05753Ankyrin repeat domain-containing protein; chloroplastic (AKRP) (Protein EMBRYO DEFECTIVE 2036) Arabidopsis thaliana (Mouse-ear cress) 37 231 51 69 19 GDDFIVGDCLVYEDGVFED 86.69
DP02920Q05753Ankyrin repeat domain-containing protein; chloroplastic (AKRP) (Protein EMBRYO DEFECTIVE 2036) Arabidopsis thaliana (Mouse-ear cress) 37 231 153 159 7 NDFLTYK 91.11
DP02920Q05753Ankyrin repeat domain-containing protein; chloroplastic (AKRP) (Protein EMBRYO DEFECTIVE 2036) Arabidopsis thaliana (Mouse-ear cress) 37 231 214 225 12 HVAKFFNSDKYD 87.37
DP02924P0C6X7"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.69) (PL2-PRO) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 2.1.1.-) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" Severe acute respiratory syndrome coronavirus (SARS-CoV) 129 179 157 164 8 YEQNWNTK 92.31
DP02925P0DTD1"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1 148 67 73 7 PYVFIKR 87.96
DP02925P0DTD1"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1 147 67 73 7 PYVFIKR 87.96
DP02925P0DTD1"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1 127 67 73 7 PYVFIKR 87.96
DP02925P0DTD1"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 3943 4020 3944 3966 23 IASEFSSLPSYAAFATAQEAYEQ 90.58
DP02925P0DTD1"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 3948 4020 3953 3966 14 SYAAFATAQEAYEQ 92.69
DP02929P0A2N1MAPK phosphothreonine lyase (EC 4.2.3.-) (27.5 kDa virulence protein) (Secreted effector protein SpvC) Salmonella enteritidis 1 26 8 21 14 LNLNIPPLNIVAAY 88.15
DP02936A0A3S5Y0Q5Virulence associated protein VapG Rhodococcus hoagii (strain 103S) (Rhodococcus equi) 27 66 42 51 10 AANTYDFAEA 94.31
DP02946Q2VL32Aip56 Photobacterium damsela subsp. piscicida (Pasteurella piscicida) 278 314 297 305 9 GGGAFFLPS 88.07
DP02949O25555Uncharacterized protein Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 96 125 107 113 7 DFSSYSN 88.63
DP02964M0Y2D5NAC domain-containing protein Hordeum vulgare subsp. vulgare (Domesticated barley) 172 355 239 245 7 LAQLFDD 96.32
DP02964M0Y2D5NAC domain-containing protein Hordeum vulgare subsp. vulgare (Domesticated barley) 172 250 239 245 7 LAQLFDD 96.32
DP02964M0Y2D5NAC domain-containing protein Hordeum vulgare subsp. vulgare (Domesticated barley) 173 355 239 245 7 LAQLFDD 96.32
DP02965F6IAY2NAC transcription factor Hordeum vulgare subsp. vulgare (Domesticated barley) 177 346 198 204 7 SFGFISD 92.98
DP02965F6IAY2NAC transcription factor Hordeum vulgare subsp. vulgare (Domesticated barley) 177 346 224 239 16 VDQVIDFNSNSAYATG 88.63
DP02965F6IAY2NAC transcription factor Hordeum vulgare subsp. vulgare (Domesticated barley) 177 346 311 318 8 GCAEISSA 87.29
DP02965F6IAY2NAC transcription factor Hordeum vulgare subsp. vulgare (Domesticated barley) 250 346 311 318 8 GCAEISSA 87.29
DP02982O01479Tropomodulin (Tmod-like protein) (cTmd1) (Uncoordinated protein 94) Caenorhabditis elegans 196 221 201 210 10 TFNGIMQSYV 87.16
DP02985P0A6Y8Chaperone protein DnaK (HSP70) (Heat shock 70 kDa protein) (Heat shock protein 70) Escherichia coli (strain K12) 606 638 627 633 7 VDAEFEE 85.95
DP02989Q03611Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) Caenorhabditis elegans 1 105 37 45 9 KFSILTKFL 85.95
DP02989Q03611Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) Caenorhabditis elegans 1 105 56 66 11 AQQNEFMQKYM 89.84
DP02989Q03611Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) Caenorhabditis elegans 1 103 37 45 9 KFSILTKFL 85.95
DP02989Q03611Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) Caenorhabditis elegans 1 103 56 66 11 AQQNEFMQKYM 89.84
DP02989Q03611Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) Caenorhabditis elegans 620 733 633 645 13 TVEEIAEHLNNAV 89.3
DP02989Q03611Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) Caenorhabditis elegans 620 733 652 660 9 MARLIVEHS 90.64
DP02989Q03611Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) Caenorhabditis elegans 621 733 633 645 13 TVEEIAEHLNNAV 89.3
DP02989Q03611Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) Caenorhabditis elegans 621 733 652 660 9 MARLIVEHS 90.64
DP03003P0DTC3ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1 41 6 21 16 RIFTIGTVTLKQGEIK 92.98
DP03003P0DTC3ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) 1 39 6 21 16 RIFTIGTVTLKQGEIK 92.98
DP03018P10565Binary larvicide subunit BinB (63 kDa toxin crystal protein) (Binary paracrystalline larvicide subunit BinB) (Larvicidal toxin 51.4 kDa protein) Lysinibacillus sphaericus (Bacillus sphaericus) 1 34 17 26 10 KFTNYPLNTT 86.62
DP03019P30996Botulinum neurotoxin type F (BoNT/F) (Bontoxilysin-F) Cleaved into: Botulinum neurotoxin F light chain (LC) (EC 3.4.24.69); Botulinum neurotoxin F heavy chain (HC) Clostridium botulinum 416 439 421 432 12 LVEKIVKFCKSV 91.47
DP03021F2WK69Toxin CdiA Escherichia coli O157:H7 88 164 89 95 7 NQSLTFD 87.96
DP03021F2WK69Toxin CdiA Escherichia coli O157:H7 88 164 136 142 7 EAQVIDK 86.96
DP03022I1WVY3tRNA nuclease CdiA-2 (tRNase CdiA-2) (EC 3.1.-.-) (CdiA-Bp1026b) (Toxin CdiA-2) (Toxin CdiA-II) Burkholderia pseudomallei (strain 1026b) 2948 2987 2957 2964 8 NAILSNSN 86.62
DP03026A0A384E149Catalytic domain of botulinum neurotoxin X Clostridium botulinum 414 439 415 423 9 ALRAFIKIC 90.64
DP03026A0A384E149Catalytic domain of botulinum neurotoxin X Clostridium botulinum 414 439 426 434 9 NGLLYNAIY 91.64
DP03092O00308NEDD4-like E3 ubiquitin-protein ligase WWP2 (EC 2.3.2.26) (Atrophin-1-interacting protein 2) (AIP2) (HECT-type E3 ubiquitin transferase WWP2) (WW domain-containing protein 2) Homo sapiens (Human) 662 702 667 680 14 GLELYFIQDMEILG 92.93
DP03254P52848Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 (EC 2.8.2.8) (Glucosaminyl N-deacetylase/N-sulfotransferase 1) (NDST-1) (N-heparan sulfate sulfotransferase 1) (N-HSST 1) (Heparan sulfate-glucosamine N-sulfotransferase 1) (HSNST 1) Includes: Heparan sulfate N-deacetylase 1 (EC 3.-.-.-); Heparan sulfate N-sulfotransferase 1 (EC 2.8.2.-) Homo sapiens (Human) 558 578 566 573 8 LAQKYFQI 95.44
DP03311P00740Coagulation factor IX (EC 3.4.21.22) (Christmas factor) (Plasma thromboplastin component) (PTC) Cleaved into: Coagulation factor IXa light chain; Coagulation factor IXa heavy chain Homo sapiens (Human) 47 93 51 61 11 KLEEFVQGNLE 88.63
DP03312P10619Lysosomal protective protein (EC 3.4.16.5) (Carboxypeptidase C) (Carboxypeptidase L) (Cathepsin A) (Protective protein cathepsin A) (PPCA) (Protective protein for beta-galactosidase) Cleaved into: Lysosomal protective protein 32 kDa chain; Lysosomal protective protein 20 kDa chain Homo sapiens (Human) 288 327 300 308 9 DLGNIFTRL 91.97
DP03335P42573Cell death protein 3 (EC 3.4.22.60) (Caspase ced-3) Cleaved into: Cell death protein 3 subunit p17; Cell death protein 3 subunit p15; Cell death protein 3 subunit p13 Caenorhabditis elegans 370 406 390 396 7 PLFNFLG 91.97
DP03338Q9A8N4PopZ Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 133 9 22 14 TMEEILASIRRIIS 86.62
DP03338Q9A8N4PopZ Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) 1 133 116 128 13 AASAFGSLSSALL 90.97
DP03350P03316Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Sindbis virus (SINV) 1 113 2 10 9 NRGFFNMLG 87.18
DP03350P03316Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Sindbis virus (SINV) 1 113 42 56 15 IQQLTTAVSALVIGQ 86.8
DP03354P63144Voltage-gated potassium channel subunit beta-1 (EC 1.1.1.-) (K(+) channel subunit beta-1) (Kv-beta-1) Rattus norvegicus (Rat) 1 62 41 54 14 RTVAIIARSLGTFT 91.42
DP03356A0A1L8HX71XPA_C domain-containing protein Xenopus laevis (African clawed frog) 1 84 64 72 9 GGGFFIEEE 90.08
DP03359P9WJD9ESX-1 secretion-associated protein EspB (Antigen MTB48) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 290 460 336 342 7 AAQLTSA 87.29
DP03359P9WJD9ESX-1 secretion-associated protein EspB (Antigen MTB48) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 290 460 433 450 18 DEALYTEDRAWTEAVIGN 90.97