Waltz threshold =80

Waltz thresholds: 85 73.5

DisProt ID UniProt Acc Protein Organism Start
(IDR)
End
(IDR)
Start
(CAR)
End
(CAR)
CAR Length Sequence Waltz Score
DP00004P49913Cathelicidin antimicrobial peptide (18 kDa cationic antimicrobial protein) (CAP-18) (hCAP-18) Cleaved into: Antibacterial peptide FALL-39 (FALL-39 peptide antibiotic); Antibacterial peptide LL-37 Homo sapiens (Human) 134 170 158 165 8 KDFLRNLV 80.27
DP00005P03045Antitermination protein N (Regulatory protein N) (PN) Escherichia phage lambda (Bacteriophage lambda) 1 107 59 75 17 VLAEYHKQIESNLQRIE 82.83
DP00006P00004Cytochrome c Equus caballus (Horse) 1 104 45 55 11 PGFTYTDANKN 80.69
DP00006P00004Cytochrome c Equus caballus (Horse) 1 104 64 71 8 TLMEYLEN 82.02
DP00006P00004Cytochrome c Equus caballus (Horse) 1 104 79 87 9 TKMIFAGIK 80.27
DP00006P00004Cytochrome c Equus caballus (Horse) 1 104 92 99 8 REDLIAYL 89.05
DP00008Q64693POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) Mus musculus (Mouse) 1 256 56 63 8 PLATYSTV 82.27
DP00008Q64693POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) Mus musculus (Mouse) 1 256 137 143 7 SSVLTYA 90.97
DP00008Q64693POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) Mus musculus (Mouse) 1 256 206 213 8 VQLPISIP 80.6
DP00008Q64693POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) Mus musculus (Mouse) 1 256 228 251 24 SSLTIDKLLLEEEESNTYELNHTL 81.72
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 654 838 698 715 18 KNSILNPINSIRKFSIVQ 80.27
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 654 838 744 757 14 QGEAILPRISVIST 84.11
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 654 838 768 774 7 SVLNLMT 80.94
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 654 838 779 785 7 QGQNIHR 84.62
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 654 838 804 810 7 ELDIYSR 86.96
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 654 838 816 828 13 TGLEISEEINEED 84.92
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 708 831 709 715 7 RKFSIVQ 80.27
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 708 831 744 757 14 QGEAILPRISVIST 84.11
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 708 831 768 774 7 SVLNLMT 80.94
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 708 831 779 785 7 QGQNIHR 84.62
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 708 831 804 810 7 ELDIYSR 86.96
DP00012P13569Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) Homo sapiens (Human) 708 831 816 826 11 TGLEISEEINE 84.68
DP00014P05371Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain Rattus norvegicus (Rat) 66 97 68 75 8 SLLNSLEE 80.27
DP00014P05371Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain Rattus norvegicus (Rat) 386 447 403 409 7 VVVKLFD 84.71
DP00015P61926cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform) Oryctolagus cuniculus (Rabbit) 1 76 2 15 14 TDVETTYADFIASG 82.75
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 1 164 47 57 11 ERWNFDFVTET 81.64
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 1 164 61 68 8 GDFAWERV 91.64
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 1 164 148 159 12 TDFYHSKRRLIF 81.44
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 1 94 47 57 11 ERWNFDFVTET 81.64
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 1 94 61 68 8 GDFAWERV 91.64
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 9 84 47 57 11 ERWNFDFVTET 81.64
DP00016P38936Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) Homo sapiens (Human) 9 84 61 68 8 GDFAWERV 91.64
DP00017P49918Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) Homo sapiens (Human) 1 316 76 82 7 RLQWTEV 86.62
DP00017P49918Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) Homo sapiens (Human) 1 316 271 277 7 LISDFFA 80.6
DP00017P49918Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) Homo sapiens (Human) 27 97 76 82 7 RLQWTEV 86.62
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 1 198 58 68 11 RKWNFDFQNHK 86.96
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 1 198 70 79 10 LEGKYEWQEV 80.27
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 22 105 58 68 11 RKWNFDFQNHK 86.96
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 22 105 70 79 10 LEGKYEWQEV 80.27
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 22 97 58 68 11 RKWNFDFQNHK 86.96
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 22 97 70 79 10 LEGKYEWQEV 80.27
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 25 93 58 68 11 RKWNFDFQNHK 86.96
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 25 93 70 79 10 LEGKYEWQEV 80.27
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 55 95 58 68 11 RKWNFDFQNHK 86.96
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 55 95 70 79 10 LEGKYEWQEV 80.27
DP00018P46527Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) Homo sapiens (Human) 66 88 70 79 10 LEGKYEWQEV 80.27
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 123 92 106 15 ATANIASTSGASVTE 93.65
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 210 359 246 255 10 KTEIISTNTN 91.97
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 210 359 290 296 7 TASITSG 82.61
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 210 359 300 306 7 DLVQIEQ 81.08
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 594 674 598 604 7 RARNYSS 84.95
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 594 674 624 634 11 AAAASNSYAIP 81.91
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 594 674 642 650 9 DTMNFISSL 83.65
DP00020P11938DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 594 674 653 669 17 DLSNISNSLPFEYPHEI 83.89
DP00024P03129Protein E7 Human papillomavirus type 16 1 40 7 13 7 TLHEYML 86.96
DP00024P03129Protein E7 Human papillomavirus type 16 1 40 19 30 12 TTDLYCYEQLND 80.43
DP00024P03129Protein E7 Human papillomavirus type 16 16 40 19 30 12 TTDLYCYEQLND 80.43
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 745 874 749 756 8 GNQSFEED 80.6
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 745 874 766 778 13 QGGNIVDIDFDSV 87.52
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 745 874 787 794 8 GNQSFEED 80.6
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 745 874 804 816 13 HGGNIIDIDFDSV 82.51
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 745 874 825 832 8 HTEIIEED 90.64
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 746 858 749 756 8 GNQSFEED 80.6
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 746 858 766 778 13 QGGNIVDIDFDSV 87.52
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 746 858 787 794 8 GNQSFEED 80.6
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 746 858 804 816 13 HGGNIIDIDFDSV 82.51
DP00025P14738Fibronectin-binding protein A (FnbpA) Staphylococcus aureus (strain NCTC 8325 / PS 47) 746 858 825 832 8 HTEIIEED 90.64
DP00026P06179Flagellin (Phase 1-I flagellin) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 65 1 33 33 MAQVINTNSLSLLTQNNLNKSQSALGTAIERLS 86.34
DP00026P06179Flagellin (Phase 1-I flagellin) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 65 46 59 14 AGQAIANRFTANIK 89.25
DP00027P26477Negative regulator of flagellin synthesis (Anti-sigma-28 factor) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 97 54 61 8 GVSDINME 80.94
DP00027P26477Negative regulator of flagellin synthesis (Anti-sigma-28 factor) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 97 83 92 10 ADSLIREAQS 90.3
DP00027P26477Negative regulator of flagellin synthesis (Anti-sigma-28 factor) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 41 97 54 61 8 GVSDINME 80.94
DP00027P26477Negative regulator of flagellin synthesis (Anti-sigma-28 factor) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 41 97 83 92 10 ADSLIREAQS 90.3
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 1 118 39 47 9 GGTLFSTTP 83.61
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 1 118 49 62 14 GTRIIYDRKFLMEC 87.63
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 1 55 39 47 9 GGTLFSTTP 83.61
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 5 118 39 47 9 GGTLFSTTP 83.61
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 5 118 49 62 14 GTRIIYDRKFLMEC 87.63
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 49 83 49 62 14 GTRIIYDRKFLMEC 87.63
DP00028Q13541Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) Homo sapiens (Human) 50 84 50 62 13 TRIIYDRKFLMEC 87.63
DP00030P04150Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) Homo sapiens (Human) 77 262 81 91 11 AVSLSMGLYMG 89.02
DP00030P04150Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) Homo sapiens (Human) 77 262 106 114 9 QQGQISLSS 81.49
DP00030P04150Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) Homo sapiens (Human) 77 262 122 132 11 LEESIANLNRS 85.16
DP00030P04150Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) Homo sapiens (Human) 77 262 180 202 23 NVKLYTTDQSTFDILQDLEFSSG 88.43
DP00030P04150Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) Homo sapiens (Human) 77 262 215 227 13 SDLLIDENCLLSP 93.65
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 271 299 29 IIFGIFGLTVMLFVFLFSKQQRIKMLILP 90.61
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 320 330 11 EEVNTILAIHD 87.35
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 341 351 11 SWVEFIELDID 87.41
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 397 407 11 TDFNANDIHEG 80.27
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 469 477 9 QAAHIQLSN 87.63
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 480 494 15 SLSNIDFYAQVSDIT 91.97
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 524 538 15 CQENFLMDNAYFCEA 85.46
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 561 575 15 NQEDIYITTESLTTA 84.57
DP00033P10912Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) Homo sapiens (Human) 270 620 604 613 10 PQGLILNATA 81.54
DP00036P22121Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) 1 195 10 22 13 MDEISNPNNILLP 85.54
DP00036P22121Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) 1 195 61 69 9 LIEDIVNPS 82.27
DP00036P22121Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) 1 195 89 101 13 LQQPISLDHVITR 80.76
DP00036P22121Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) 1 195 105 118 14 AGGVYSIGNSSTSS 86.55
DP00037Q9Y9L0Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin) Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) 197 250 208 216 9 LDWWFCWDT 98.66
DP00037Q9Y9L0Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin) Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) 197 250 238 245 8 AKLLYEEA 88.29
DP00041P07746High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) 1 204 11 22 12 KMSSYAYFVQTR 94.2
DP00041P07746High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) 1 204 33 41 9 ASVNFSEFS 94.31
DP00041P07746High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) 1 204 98 107 10 SSAFFIFCAD 97.29
DP00047P02687Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) Bos taurus (Bovine) 1 169 84 93 10 PVVHFFKNIV 88.09
DP00047P02687Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) Bos taurus (Bovine) 1 169 148 156 9 TLSKIFKLG 90.97
DP00047P02687Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) Bos taurus (Bovine) 1 109 84 93 10 PVVHFFKNIV 88.09
DP00049P70475Myelin transcription factor 1-like protein Rattus norvegicus 487 606 558 565 8 GHVNSNRN 86.62
DP00051P07805Ornithine decarboxylase (ODC) (EC 4.1.1.17) Trypanosoma brucei brucei 1 35 13 21 9 FLEGFNTRD 80.27
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 24 39 16 VAEEIVEEETVVEETG 91.97
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 120 128 9 SSCHFFATK 83.13
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 141 152 12 HLDYIGPCKYIA 86.62
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 173 180 8 VLVTLYER 87.88
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 219 235 17 FEKNYNMYIFPVHWQFG 85.87
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 267 273 7 RFFETCD 80.27
DP00052P07214SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) Mus musculus (Mouse) 18 302 276 297 22 NDKYIALEEWAGCFGIKEQDIN 88.13
DP00053P27001Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) Thermus thermophilus 1 101 5 13 9 ALAAIQNAR 92.98
DP00053P27001Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) Thermus thermophilus 1 101 53 67 15 ELNAIKAALEAALEA 85.28
DP00053P27001Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) Thermus thermophilus 1 84 5 13 9 ALAAIQNAR 92.98
DP00053P27001Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) Thermus thermophilus 1 84 53 67 15 ELNAIKAALEAALEA 85.28
DP00054P78356Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta) Homo sapiens (Human) 304 342 316 322 7 LLCSYGT 86.96
DP00054P78356Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta) Homo sapiens (Human) 304 342 328 337 10 GNLLSFPRFF 80.87
DP00055P106881-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1) Rattus norvegicus (Rat) 130 202 140 147 8 KLQHWIHS 87.08
DP00055P106881-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1) Rattus norvegicus (Rat) 130 202 170 188 19 KELNIQVDDGYARKIFREC 86.75
DP00062P19793Retinoic acid receptor RXR-alpha (Nuclear receptor subfamily 2 group B member 1) (Retinoid X receptor alpha) Homo sapiens (Human) 1 130 13 21 9 TQVNSSLTS 88.29
DP00063P49799Regulator of G-protein signaling 4 (RGP4) (RGS4) Rattus norvegicus (Rat) 1 50 23 31 9 LGFLLQKSD 82.94
DP00064P03607Capsid protein (Coat protein) Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea)) 1 64 13 21 9 EIRAFVMAT 85.28
DP00064P03607Capsid protein (Coat protein) Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea)) 1 64 28 36 9 LAQAIQNTL 87.55
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 571 580 10 KIGNYVWEDT 92.58
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 616 624 9 EDGSYLIPN 85.47
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 630 638 9 YRVEFSNLP 86.96
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 659 665 7 LSSVITV 84.9
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 673 679 7 ADLGIYK 86.91
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 685 692 8 GDYVWEDT 86.2
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 727 735 9 ADGKYKFTD 80.94
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 741 748 8 YKVEFTTP 85.95
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 771 803 33 TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDT 88.02
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 838 859 22 KDGKYQFTGLENGTYKVEFETP 81.54
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 906 913 8 GDYVWEDT 86.2
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 951 969 19 KYQFTDLNNGTYKVEFETP 81.38
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 1017 1023 7 GDYVWYD 96.99
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 1072 1079 8 KYKVIFEK 90.26
DP00065O86488Serine-aspartate repeat-containing protein D Staphylococcus aureus (strain Newman) 569 1123 1102 1108 7 VDVTITD 97.32
DP00066P27285Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus) 1 113 2 10 9 NRGFFNMLG 87.18
DP00066P27285Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus) 1 113 38 56 19 LASQIQQLTTAVSALVIGQ 81.66
DP00067Q57733Small heat shock protein HSP16.5 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 1 32 7 22 16 FDSLFERMFKEFFATP 87.4
DP00068P60881Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) Rattus norvegicus (Rat) 1 206 125 135 11 EQMAISGGFIR 86.96
DP00068P60881Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) Rattus norvegicus (Rat) 1 206 153 161 9 VSGIIGNLR 86.29
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 140 35 41 7 EGVLYVG 97.32
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 140 50 58 9 HGVATVAEK 80.6
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 140 84 98 15 GAGSIAAATGFVKKD 85.95
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 140 121 127 7 DNEAYEM 81.27
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 103 35 41 7 EGVLYVG 97.32
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 103 50 58 9 HGVATVAEK 80.6
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 103 84 98 15 GAGSIAAATGFVKKD 85.95
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 102 35 41 7 EGVLYVG 97.32
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 102 50 58 9 HGVATVAEK 80.6
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 1 102 84 97 14 GAGSIAAATGFVKK 85.95
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 42 92 50 58 9 HGVATVAEK 80.6
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 61 95 84 90 7 GAGSIAA 85.95
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 101 140 121 127 7 DNEAYEM 81.27
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 103 140 121 127 7 DNEAYEM 81.27
DP00070P37840Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) Homo sapiens (Human) 104 140 121 127 7 DNEAYEM 81.27
DP00071P23441Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) Rattus norvegicus (Rat) 1 156 64 72 9 VTAAYHMTA 80.27
DP00071P23441Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) Rattus norvegicus (Rat) 58 78 64 72 9 VTAAYHMTA 80.27
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 9951 9960 10 APEIIDVSSK 86.96
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 9962 9970 9 EEVKIMTIT 88.52
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 9979 9985 7 KEAVYEK 82.61
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 9993 10013 21 KRVFIESFEEPYDELEVEPYT 82.8
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10027 10033 7 DYEEIKV 80.6
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10049 10061 13 EGQEYYEREEGYD 97.12
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10112 10120 9 VIEKIEKTS 87.29
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10151 10157 7 QEEVIEV 83.04
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10166 10181 16 KMVISEEKMFFASHTE 80.27
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10191 10208 18 VQKEIVTEEKIHVAISKR 89.19
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10308 10318 11 TEEKITIVTQR 80.94
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10418 10426 9 AEEEWSYSE 89
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10429 10438 10 EGVSISVYRE 85.89
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10447 10472 26 AEVTEYEVMEEPEEYVVEEKLHIISK 84.35
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10653 10663 11 KERAYTLEEEA 80.27
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10668 10707 40 REEEYEEYEEYDYKEFEEYEPTEEYDQYEEYEEREYERYE 87.02
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10709 10715 7 HEEYITE 93.31
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 10833 10867 35 EEVAFEEEVVTHVEEYLVEEEEEYIHEEEEFITEE 83.29
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 11032 11041 10 EEVLFEEEIV 90.3
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 11312 11333 22 EVEEYFEEGEFHEVEEFIKLEQ 89.37
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 11348 11360 13 VIEVFEAEEVEVF 81.58
DP00072Q8WZ42Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Homo sapiens (Human) 9880 12031 11821 11830 10 KEKIFQLKAI 80.6
DP00074P03372Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) Homo sapiens (Human) 1 184 39 45 7 LGEVYLD 87.48
DP00074P03372Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) Homo sapiens (Human) 1 184 50 75 26 AVYNYPEGAAYEFNAAAAANAQVYGQ 90.85
DP00074P03372Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) Homo sapiens (Human) 1 184 85 92 8 EAAAFGSN 82.27
DP00074P03372Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) Homo sapiens (Human) 1 184 126 136 11 QQVPYYLENEP 87.11
DP00075P11387DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) Homo sapiens (Human) 1 206 8 19 12 NDSQIEADFRLN 80.27
DP00075P11387DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) Homo sapiens (Human) 1 174 8 19 12 NDSQIEADFRLN 80.27
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 631 651 638 644 7 IDLAFSK 91.97
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 634 681 638 644 7 IDLAFSK 91.97
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1070 1105 1075 1085 11 IAEQINDVKGA 85.28
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1071 1105 1075 1085 11 IAEQINDVKGA 85.28
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1225 1239 15 NFERILLEQKLVTKS 86.96
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1269 1277 9 SSSSIFDIK 86.21
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1285 1301 17 ELSKISNKFKKISTIFD 83.43
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1356 1366 11 SDLEILDSYTD 84.8
DP00076P06786DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1203 1428 1397 1417 21 SYVETLELSDDSFIEDDEEEN 85.71
DP00078P01100Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) Homo sapiens (Human) 216 380 235 245 11 SEEAFTLPLLN 86.62
DP00078P01100Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) Homo sapiens (Human) 216 380 270 276 7 DDFLFPA 91.97
DP00078P01100Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) Homo sapiens (Human) 216 380 295 306 12 SGSFYAADWEPL 90.97
DP00078P01100Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) Homo sapiens (Human) 216 380 333 346 14 SCTAYTSSFVFTYP 87.51
DP00079Q92731Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) Homo sapiens (Human) 1 103 27 37 11 HGSIYIPSSYV 87.72
DP00079Q92731Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) Homo sapiens (Human) 1 103 45 60 16 AMTFYSPAVMNYSIPS 91.3
DP00081P51123Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230) Drosophila melanogaster (Fruit fly) 11 77 21 29 9 TGILFGNID 92.2
DP00081P51123Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230) Drosophila melanogaster (Fruit fly) 11 77 52 60 9 LRENIGSLS 80.94
DP00082P39935Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 393 490 393 401 9 LEAEIETTT 84.95
DP00082P39935Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 393 490 410 420 11 TVSHILNVLKD 88.63
DP00082P39935Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 393 490 425 433 9 EDVFSFNYP 90.78
DP00082P39935Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 393 490 446 462 17 EHVKYTYGPTFLLQFKD 81.19
DP00082P39935Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 393 490 468 481 14 ADAEWVQSTASKIV 88.25
DP00083P03069General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 101 134 106 115 10 PMFEYENLED 86.62
DP00083P03069General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 101 134 118 129 12 KEWTSLFDNDIP 89.19
DP00084P61244Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) Homo sapiens (Human) 2 110 66 75 10 KATEYIQYMR 87.12
DP00084P61244Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) Homo sapiens (Human) 2 110 92 98 7 NALLEQQ 80.27
DP00085Q04206Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) Homo sapiens (Human) 428 551 441 447 7 LQLQFDD 85.95
DP00085Q04206Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) Homo sapiens (Human) 428 551 474 484 11 FQQLLNQGIPV 90.97
DP00085Q04206Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) Homo sapiens (Human) 428 551 533 546 14 DFSSIADMDFSALL 87.86
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 93 15 26 12 SQETFSDLWKLL 90.97
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 93 50 56 7 IEQWFTE 88.34
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 73 15 26 12 SQETFSDLWKLL 90.97
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 73 50 56 7 IEQWFTE 88.34
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 1 39 15 26 12 SQETFSDLWKLL 90.97
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 14 60 15 26 12 SQETFSDLWKLL 90.97
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 20 73 50 56 7 IEQWFTE 88.34
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 41 62 50 56 7 IEQWFTE 88.34
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 320 393 323 334 12 LDGEYFTLQIRG 81.94
DP00086P04637Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) Homo sapiens (Human) 325 356 325 334 10 GEYFTLQIRG 80.6
DP00087P68336Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) 350 394 367 380 14 TRNNYGSTIEGLLD 85.52
DP00087P68336Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) 413 490 471 481 11 DDFEFEQMFTD 86.32
DP00088P0ABI8Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) Escherichia coli (strain K12) 1 51 17 46 30 VMVTIAGIILGGLALVGLITYFGKWTYLWK 89.6
DP00088P0ABI8Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) Escherichia coli (strain K12) 553 663 562 568 7 DAFWEMK 87.29
DP00088P0ABI8Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) Escherichia coli (strain K12) 553 663 579 585 7 HYEEIHM 80.94
DP00088P0ABI8Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) Escherichia coli (strain K12) 553 663 591 638 48 AGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYV 89.33
DP00088P0ABI8Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) Escherichia coli (strain K12) 553 663 647 656 10 ENQHFDEITK 80.74
DP00089P0ABJ1Cytochrome bo(3) ubiquinol oxidase subunit 2 (Cytochrome b562-o complex subunit II) (Cytochrome o ubiquinol oxidase subunit 2) (Cytochrome o subunit 2) (Oxidase bo(3) subunit 2) (Ubiquinol oxidase chain B) (Ubiquinol oxidase polypeptide II) (Ubiquinol oxidase subunit 2) Escherichia coli (strain K12) 1 26 2 21 20 RLRKYNKSLGWLSLFAGTVL 87.12
DP00091P27088DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog) Xenopus laevis (African clawed frog) 1 84 14 28 15 EEEKILSAAVRAKIE 80.27
DP00091P27088DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog) Xenopus laevis (African clawed frog) 1 84 66 75 10 GGGFFIEEEE 90.07
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 521 399 424 26 KIRAIGKMARVFSVLREESESVLTLK 80.37
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 521 444 462 19 LQSATVEAIEADEAIKGFS 87.36
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 521 492 508 17 SDANLNSINKALTSETN 89.91
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 468 399 424 26 KIRAIGKMARVFSVLREESESVLTLK 80.37
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 468 444 462 19 LQSATVEAIEADEAIKGFS 87.36
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 466 399 424 26 KIRAIGKMARVFSVLREESESVLTLK 80.37
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 373 466 444 461 18 LQSATVEAIEADEAIKGF 87.33
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 374 468 399 424 26 KIRAIGKMARVFSVLREESESVLTLK 80.37
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 374 468 444 462 19 LQSATVEAIEADEAIKGFS 87.36
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 390 414 399 409 11 KIRAIGKMARV 80.51
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 467 521 492 508 17 SDANLNSINKALTSETN 89.91
DP00092Q08209Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Homo sapiens (Human) 487 521 492 508 17 SDANLNSINKALTSETN 89.91
DP00094P04177Tyrosine 3-monooxygenase (EC 1.14.16.2) (Tyrosine 3-hydroxylase) (TH) Rattus norvegicus (Rat) 1 71 38 44 7 RQSLIED 91.97
DP00099P50440Glycine amidinotransferase; mitochondrial (EC 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) Homo sapiens (Human) 38 63 39 46 8 TQAATASS 80.27
DP00100P0A6H5ATP-dependent protease ATPase subunit HslU (Heat shock protein HslU) (Unfoldase HslU) Escherichia coli (strain K12) 175 209 182 188 7 MGVEIMA 91.97
DP00103P09372Protein GrpE (HSP-70 cofactor) (HSP24) (Heat shock protein B25.3) Escherichia coli (strain K12) 1 32 14 27 14 PEEIIMDQHEEIEA 83.61
DP00104P32773Transcription initiation factor IIA large subunit (TFIIA large subunit) (TFIIA 32 kDa subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 210 240 227 233 7 DDYLISE 94.31
DP00107P69924Ribonucleoside-diphosphate reductase 1 subunit beta (EC 1.17.4.1) (Protein B2) (Protein R2) (Ribonucleotide reductase 1) Escherichia coli (strain K12) 342 376 353 363 11 EVSSYLVGQID 80.78
DP00110P40881Carbonic anhydrase (EC 4.2.1.1) Methanosarcina thermophila 1 37 4 20 17 NKQIFTILILSLSLALA 84.03
DP00111P27577Protein C-ets-1 (p54) Mus musculus (Mouse) 244 301 254 260 7 SVESYDS 83.61
DP00111P27577Protein C-ets-1 (p54) Mus musculus (Mouse) 244 301 265 278 14 TQSWSSQSSFNSLQ 88.89
DP00112P22239Desiccation-related protein clone PCC6-19 (CDET6-19) Craterostigma plantagineum (Blue gem) (Torenia plantagineum) 1 155 121 127 7 DQQQYGT 82.61
DP00116P81455Osteocalcin (Bone Gla protein) (BGP) (Gamma-carboxyglutamic acid-containing protein) Canis lupus familiaris (Dog) (Canis familiaris) 1 49 38 44 7 FQEAYQR 91.11
DP00118P05059Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor Bos taurus (Bovine) 1 449 4 21 18 AAVLALLLCAGQVIALPV 83.11
DP00118P05059Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor Bos taurus (Bovine) 1 449 36 42 7 IVEVISD 86.72
DP00118P05059Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor Bos taurus (Bovine) 1 449 62 79 18 GDERILSILRHQNLLKEL 86.18
DP00118P05059Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor Bos taurus (Bovine) 1 449 428 436 9 SLSAIEAEL 88.29
DP00119P10163Basic salivary proline-rich protein 4 (Salivary proline-rich protein Po) (Parotid o protein) (Salivary proline-rich protein II-1) Cleaved into: Protein N1; Glycosylated protein A; Peptide P-D (Proline-rich peptide IB-5) Homo sapiens (Human) 17 310 26 34 9 EESLFLISG 88.37
DP00120P12957Caldesmon (CDM) Gallus gallus (Chicken) 636 771 637 647 11 LEQYTSAVVGN 85.28
DP00120P12957Caldesmon (CDM) Gallus gallus (Chicken) 636 771 703 710 8 RINEWLTK 83.86
DP00122P15146Microtubule-associated protein 2 (MAP-2) Rattus norvegicus (Rat) 1 135 95 108 14 VQVVTAEAVAVLKG 87.29
DP00122P15146Microtubule-associated protein 2 (MAP-2) Rattus norvegicus (Rat) 136 297 226 256 31 FAQTFGTNLEDIKQITEPSITVPSIGLSAEP 89.3
DP00122P15146Microtubule-associated protein 2 (MAP-2) Rattus norvegicus (Rat) 136 297 263 269 7 KDWFIEM 97.32
DP00122P15146Microtubule-associated protein 2 (MAP-2) Rattus norvegicus (Rat) 298 467 342 349 8 APVFFQSD 91.97
DP00122P15146Microtubule-associated protein 2 (MAP-2) Rattus norvegicus (Rat) 298 467 399 410 12 AVEGFVGENISG 86.32
DP00123P01730T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4) Homo sapiens (Human) 398 458 406 420 15 AGLLLFIGLGIFFCV 86.64
DP00125P63292Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH) Bos taurus (Bovine) 30 60 31 41 11 YADAIFTNSYR 82.52
DP00128P40357Protein transport protein SEC9 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 401 651 403 411 9 GYKTFEEIQ 88.07
DP00128P40357Protein transport protein SEC9 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 401 651 556 562 7 ANNNISE 93.31
DP00128P40357Protein transport protein SEC9 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 401 651 578 584 7 RYQFEND 80.27
DP00128P40357Protein transport protein SEC9 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 401 651 590 608 19 MELEIDRNLDQIQQVSNRL 84.33
DP00128P40357Protein transport protein SEC9 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 401 651 625 633 9 RLNNIEEST 90.3
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 11 21 11 VALLLLLVLGS 87.11
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 40 67 28 VDRVINVNAKNYKNVFKKYEVLALLYHE 85.4
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 81 95 15 MEELILELAAQVLED 86.69
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 120 140 21 EDSIYVFKEDEVIEYDGEFSA 86.89
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 142 160 19 TLVEFLLDVLEDPVELIEG 84.97
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 163 181 19 ELQAFENIEDEIKLIGYFK 91.09
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 194 209 16 AAEEFHPYIPFFATFD 85.74
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 219 231 13 KLNEIDFYEAFME 89.99
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 242 253 12 SEEEIVNFVEEH 95.57
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 266 272 7 MYETWED 82.61
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 275 286 12 DGIHIVAFAEEA 94.4
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 289 300 12 DGYEFLEILKSV 89.27
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 309 317 9 DLSIIWIDP 95.95
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 322 337 16 LLVPYWEKTFDIDLSA 83.61
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 348 355 8 ADSVWMEM 87.29
DP00132P07221Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) Oryctolagus cuniculus (Rabbit) 1 395 368 383 16 EDWLEDVLEGEINTED 84.36
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 300 25 41 17 GSLAIEEAMAAWSEISD 86.19
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 300 64 72 9 CLSAIGSTE 81.94
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 300 99 115 17 NLQASSTGLQCYYVYDH 85.58
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 300 161 167 7 EGYAITD 83.18
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 300 243 249 7 IASLLTG 80.27
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 300 278 287 10 NAALIQEWTP 89.5
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 230 25 41 17 GSLAIEEAMAAWSEISD 86.19
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 230 64 72 9 CLSAIGSTE 81.94
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 230 99 115 17 NLQASSTGLQCYYVYDH 85.58
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 230 161 167 7 EGYAITD 83.18
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 229 25 41 17 GSLAIEEAMAAWSEISD 86.19
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 229 64 72 9 CLSAIGSTE 81.94
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 229 99 115 17 NLQASSTGLQCYYVYDH 85.58
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 229 161 167 7 EGYAITD 83.18
DP00133P03422Phosphoprotein (Protein P) Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) 1 50 25 41 17 GSLAIEEAMAAWSEISD 86.19
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 281 422 300 309 10 NGKLIQEIVD 91.84
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 281 422 376 382 7 VLVASSV 85.62
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 281 422 397 417 21 GMVPFVFVGTKDSIANATVLL 86.61
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 444 632 594 600 7 TLQNTSS 85.28
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 445 632 594 600 7 TLQNTSS 85.28
DP00134Q06787Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) Homo sapiens (Human) 516 632 594 600 7 TLQNTSS 85.28
DP00135P10961Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 167 31 37 7 DIEKILQ 87.29
DP00135P10961Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 167 39 45 7 NDIFTTD 80.89
DP00135P10961Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 167 56 62 7 AIEDIIN 86.57
DP00135P10961Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 167 98 108 11 PLGIYQTNLYG 89.54
DP00135P10961Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 260 332 268 274 7 LLEKIIR 87.29
DP00135P10961Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 260 332 308 327 20 SNNNISSSNSFFNNGHLLQG 90.7
DP00136P15865Histone H1.4 (H1d) Rattus norvegicus (Rat) 31 119 40 52 13 VSELITKAVAASK 89.3
DP00140P0A7L850S ribosomal protein L27 (Large ribosomal subunit protein bL27) Escherichia coli (strain K12) 1 85 32 38 7 LAGSIIV 94.41
DP00141O95405Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation) Homo sapiens (Human) 663 751 676 682 7 GQFGISA 82.7
DP00141O95405Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation) Homo sapiens (Human) 663 751 737 743 7 CKLLYMD 82.61
DP00146P0A7T730S ribosomal protein S18 (Small ribosomal subunit protein bS18) Escherichia coli (strain K12) 1 75 9 15 7 KFCRFTA 80.6
DP00146P0A7T730S ribosomal protein S18 (Small ribosomal subunit protein bS18) Escherichia coli (strain K12) 1 75 17 45 29 GVQEIDYKDIATLKNYITESGKIVPSRIT 88.94
DP00152Q13426DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4) Homo sapiens (Human) 178 202 178 187 10 KRFILVLNEK 81.07
DP00152Q13426DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4) Homo sapiens (Human) 203 265 213 221 9 GETAICSEM 80.94
DP00152Q13426DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4) Homo sapiens (Human) 203 265 254 260 7 DDSIISS 93.65
DP00156P54725UV excision repair protein RAD23 homolog A (HR23A) (hHR23A) Homo sapiens (Human) 283 316 300 311 12 EVGAIGEEAPQM 82.86
DP00157P0CL52Cell invasion protein SipA (Effector protein SipA) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 425 512 462 470 9 QTAEIVNVK 86.96
DP00157P0CL52Cell invasion protein SipA (Effector protein SipA) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 446 512 462 470 9 QTAEIVNVK 86.96
DP00157P0CL52Cell invasion protein SipA (Effector protein SipA) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 658 684 671 679 9 VDRVITTVD 80.27
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 732 884 751 759 9 RDNVYYYDE 96.84
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 732 884 808 818 11 EIGNFIDENLK 87.66
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 732 884 829 839 11 YDSLLVFDYEG 85.68
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 732 884 844 853 10 AASLSSLNSS 82.27
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 732 884 859 872 14 QDYDYLNEWGNRFK 80.51
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 736 884 751 759 9 RDNVYYYDE 96.84
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 736 884 808 818 11 EIGNFIDENLK 87.66
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 736 884 829 839 11 YDSLLVFDYEG 85.68
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 736 884 844 853 10 AASLSSLNSS 82.27
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 736 884 859 872 14 QDYDYLNEWGNRFK 80.51
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 778 884 808 818 11 EIGNFIDENLK 87.66
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 778 884 829 839 11 YDSLLVFDYEG 85.68
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 778 884 844 853 10 AASLSSLNSS 82.27
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 778 884 859 872 14 QDYDYLNEWGNRFK 80.51
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 784 852 808 818 11 EIGNFIDENLK 87.66
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 784 852 829 839 11 YDSLLVFDYEG 85.68
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 812 884 829 839 11 YDSLLVFDYEG 85.68
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 812 884 844 853 10 AASLSSLNSS 82.27
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 812 884 859 872 14 QDYDYLNEWGNRFK 80.51
DP00159P09803Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 Mus musculus (Mouse) 855 881 859 872 14 QDYDYLNEWGNRFK 80.51
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 8 19 12 KQELEVLESIYP 87.01
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 34 42 9 FEVAIKLEL 91.97
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 54 68 15 EHTIIAEFKLPENYP 82.47
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 70 89 20 EPCLISLEAQEVALNDNEED 84.65
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 127 153 27 TVQLESQIETDMLLGMQMCFALISSIK 81.92
DP00163Q03768Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 265 156 175 20 CEQWYSEQLNKLEKQYELEA 85.48
DP00164P0531860S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 106 5 23 19 SALSYAALILADSEIEISS 88.28
DP00164P0531860S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 106 36 48 13 PVENIWADIFAKA 88.11
DP00164P0531860S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 106 57 65 9 LLVNFSAGA 82.27
DP00173O00273DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD) Homo sapiens (Human) 1 116 72 79 8 DDDYFLCL 83.61
DP00173O00273DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD) Homo sapiens (Human) 1 116 84 100 17 KFVALASNEKWAYNNSD 84.06
DP00173O00273DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD) Homo sapiens (Human) 1 116 102 111 10 GTAWISQESF 87.06
DP00174P16949Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17) Homo sapiens (Human) 1 149 16 26 11 SGQAFELILSP 82.55
DP00174P16949Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17) Homo sapiens (Human) 1 149 83 102 20 LQKAIEENNNFSKMAEEKLT 85.85
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 130 15 23 9 NDELISFKD 96.32
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 130 42 60 19 ADVKSSLVNESETNQNSSS 82.73
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 130 102 109 8 GYPFIMIP 86.96
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 56 15 23 9 NDELISFKD 96.32
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 56 42 51 10 ADVKSSLVNE 81.94
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 53 15 23 9 NDELISFKD 96.32
DP00175Q9NQB0Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) Homo sapiens (Human) 1 53 42 48 7 ADVKSSL 81.22
DP00179P01094Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 68 7 16 10 KVSEIFQSSK 88.46
DP00179P01094Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 68 53 61 9 YQEQYNKLK 91.3
DP00179P01094Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 2 34 7 16 10 KVSEIFQSSK 88.46
DP00179P01094Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 2 32 7 16 10 KVSEIFQSSK 88.46
DP00179P01094Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 33 68 53 61 9 YQEQYNKLK 91.3
DP00180P19972Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain) Millerozyma farinosa (Yeast) (Pichia farinosa) 146 222 198 209 12 KDVYMIKFSLAG 84.03
DP00184P11473Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) Homo sapiens (Human) 16 125 32 40 9 TGFHFNAMT 91.97
DP00184P11473Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) Homo sapiens (Human) 16 125 90 97 8 MKEFILTD 82.11
DP00184P11473Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) Homo sapiens (Human) 120 164 127 138 12 EQQRIIAILLDA 83.7
DP00184P11473Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) Homo sapiens (Human) 120 164 143 152 10 YDPTYSDFCQ 80.27
DP00186Q95V77Late embryogenesis abundant protein 1 (Aavlea1) Aphelenchus avenae (Mycophagous nematode worm) 1 143 14 20 7 QEQGYME 80.6
DP00186Q95V77Late embryogenesis abundant protein 1 (Aavlea1) Aphelenchus avenae (Mycophagous nematode worm) 1 143 26 33 8 VVNAWEST 81.52
DP00187P04273Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230) Mesocricetus auratus (Golden hamster) 23 106 29 39 11 GGWNTGGSRYP 80.94
DP00188P12359Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) Spinacia oleracea (Spinach) 85 332 88 103 16 KRLTYDEIQSKTYLEV 80.27
DP00188P12359Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) Spinacia oleracea (Spinach) 85 332 125 138 14 KPGKYTAKKFCLEP 82.61
DP00188P12359Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) Spinacia oleracea (Spinach) 85 332 163 174 12 TRLTYTLDEIEG 83.61
DP00188P12359Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) Spinacia oleracea (Spinach) 85 332 207 220 14 VPFLFTIKQLVASG 87.63
DP00188P12359Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) Spinacia oleracea (Spinach) 85 332 297 305 9 VIGVFQSLQ 87.29
DP00188P12359Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) Spinacia oleracea (Spinach) 85 332 317 327 11 KDVKIEGVWYA 86.44
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 63 71 9 GITIISASQ 93.65
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 99 118 20 GDYKFKQIASEKLLIVVTST 82.76
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 130 138 9 ALHKFLFSK 89.97
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 142 163 22 KLENTAFAVFSLGDSSYEFFCQ 87.18
DP00190P38038Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) Escherichia coli (strain K12) 52 224 186 199 14 ADVEYQAAASEWRA 97.66
DP00192P02668Kappa-casein Cleaved into: Casoxin-C; Casoxin-6; Casoxin-A; Casoxin-B; Casoplatelin Bos taurus (Bovine) 1 21 2 16 15 MKSFFLVVTILALTL 84.26
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 2 12 11 KCLLLALALTC 81.73
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 14 22 9 AQALIVTQT 98.33
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 31 49 19 VAGTWYSLAMAASDISLLD 84.1
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 57 63 7 VYVEELK 80.6
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 68 79 12 GDLEILLQKWEN 81.44
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 83 91 9 AQKKIIAEK 80.94
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 96 106 11 AVFKIDALNEN 94.98
DP00193P02754Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) Bos taurus (Bovine) 1 178 117 125 9 KYLLFCMEN 94.98
DP00194P0AFZ3Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB) Escherichia coli (strain K12) 111 165 124 134 11 ADNETVMSVID 83.37
DP00194P0AFZ3Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB) Escherichia coli (strain K12) 118 165 124 134 11 ADNETVMSVID 83.37
DP00196P20810Calpastatin (Calpain inhibitor) (Sperm BS-17 component) Homo sapiens (Human) 137 277 186 195 10 MSSTYIEELG 86.62
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 28 60 30 55 26 KLCYLLDGILFIYGVILTALFLRVKF 86.72
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 52 164 68 78 11 QNQLYNELNLG 83.37
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 52 164 107 115 9 QEGLYNELQ 83.8
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 52 164 119 127 9 MAEAYSEIG 91.75
DP00200P20963T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) Homo sapiens (Human) 52 164 138 147 10 HDGLYQGLST 91.97
DP00201P02721ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) Bos taurus (Bovine) 33 108 39 51 13 VQKLFVDKIREYR 91.97
DP00201P02721ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) Bos taurus (Bovine) 33 108 85 97 13 ADMNTFPNFTFED 81.04
DP00201P02721ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) Bos taurus (Bovine) 84 108 85 97 13 ADMNTFPNFTFED 81.04
DP00205Q82S91Metal-binding protein SmbP Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) 1 117 5 26 22 LIKVIAASVTALFLSMQVYASG 84.14
DP00205Q82S91Metal-binding protein SmbP Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) 1 117 50 57 8 TDQLLEHA 80.27
DP00205Q82S91Metal-binding protein SmbP Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) 1 117 102 110 9 AQEAIEHLR 94.31
DP00207P21513Ribonuclease E (RNase E) (EC 3.1.26.12) Escherichia coli (strain K12) 498 1061 528 535 8 ALATFAMP 93.31
DP00207P21513Ribonuclease E (RNase E) (EC 3.1.26.12) Escherichia coli (strain K12) 498 1061 570 584 15 LLSRFFGALKALFSG 84.46
DP00207P21513Ribonuclease E (RNase E) (EC 3.1.26.12) Escherichia coli (strain K12) 498 1061 840 849 10 GKVWIRYPIV 81.37
DP00207P21513Ribonuclease E (RNase E) (EC 3.1.26.12) Escherichia coli (strain K12) 498 1061 876 882 7 VAAAIEP 88.29
DP00207P21513Ribonuclease E (RNase E) (EC 3.1.26.12) Escherichia coli (strain K12) 498 1061 920 946 27 AAVTEQPQVITESDVAVAQEVAEQAEP 80.42
DP00207P21513Ribonuclease E (RNase E) (EC 3.1.26.12) Escherichia coli (strain K12) 498 1061 1031 1037 7 PTFAFEG 80.6
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 2 18 17 RIAVICFCLLGITCAIP 83.26
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 29 37 9 EKQLYNKYP 86.85
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 39 46 8 AVATWLNP 81.69
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 142 148 7 ATEVFTP 86.62
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 161 169 9 DSVVYGLRS 86.62
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 1 314 198 206 9 LNGAYKAIP 80.27
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 17 314 29 37 9 EKQLYNKYP 86.85
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 17 314 39 46 8 AVATWLNP 81.69
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 17 314 142 148 7 ATEVFTP 86.62
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 17 314 161 169 9 DSVVYGLRS 86.62
DP00214P10451Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) Homo sapiens (Human) 17 314 198 206 9 LNGAYKAIP 80.27
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 41 51 11 GAVFLAACSSG 81.48
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 64 76 13 ADINYANVDGLTA 97.99
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 87 101 15 DMVKFLVENGANINQ 89.79
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 117 128 12 GYLDIAEYLISQ 83.17
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 154 168 15 LLQNEVNRQGVDIEA 84.62
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 181 191 11 ARQWLNSGHIN 83.61
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 215 235 21 LKLLIQARYDVNIKDYDGWTP 92.08
DP00218Q90623Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) Gallus gallus (Chicken) 1 299 265 284 20 GQTAFDVADEDILGYLEELQ 83.61
DP00219O60927E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3) Homo sapiens (Human) 1 126 40 46 7 KVEWTSD 80.55
DP00219O60927E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3) Homo sapiens (Human) 1 126 59 65 7 KCCCIYE 86.29
DP00220P17810Peripherin-2 (Retinal degeneration slow protein) Bos taurus (Bovine) 284 346 317 323 7 KAFLESV 85.05
DP00221P07476Involucrin Homo sapiens (Human) 1 585 88 103 16 QQQHWEQHEEYQKAEN 83.82
DP00221P07476Involucrin Homo sapiens (Human) 1 585 241 247 7 GQLELSE 80.27
DP00221P07476Involucrin Homo sapiens (Human) 1 585 251 257 7 GQLELSE 80.27
DP00221P07476Involucrin Homo sapiens (Human) 1 585 281 287 7 GQLKYLE 94.31
DP00221P07476Involucrin Homo sapiens (Human) 1 585 368 375 8 QQVLQLKQ 82.27
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 6 20 15 ADAQIQRETYDSNES 81.05
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 63 73 11 QASSFSFLNRA 86.62
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 122 133 12 RYELYIKNILEA 91.11
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 185 192 8 SDSVFSFG 87.21
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 281 288 8 AEASFTFG 89.88
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 316 326 11 SSFTFGSTTIE 86.96
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 352 358 7 FSFSIPS 80.27
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 415 423 9 AFNLISNAG 82.61
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 439 446 8 SFGISNGS 82.94
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 474 484 11 FSFGINTNTTK 80.94
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 491 506 16 PTFTFGSSALADNKED 80.27
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 548 556 9 TGFKFSLPF 87.29
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 605 612 8 DEVALFSQ 81.61
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 615 627 13 KLMTFNAETKSYD 87.63
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 656 671 16 GNVLLNATVVDSFKYE 83.84
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 720 691 700 10 KLVTYIVKFK 92.71
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 185 192 8 SDSVFSFG 87.21
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 281 288 8 AEASFTFG 89.88
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 316 326 11 SSFTFGSTTIE 86.96
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 352 358 7 FSFSIPS 80.27
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 415 423 9 AFNLISNAG 82.61
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 439 446 8 SFGISNGS 82.94
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 474 484 11 FSFGINTNTTK 80.94
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 185 527 491 506 16 PTFTFGSSALADNKED 80.27
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 562 720 605 612 8 DEVALFSQ 81.61
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 562 720 615 627 13 KLMTFNAETKSYD 87.63
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 562 720 656 671 16 GNVLLNATVVDSFKYE 83.84
DP00222P32499Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 562 720 691 700 10 KLVTYIVKFK 92.71
DP00223P14635G2/mitotic-specific cyclin-B1 Homo sapiens (Human) 1 78 7 20 14 RNSKINAENKAKIN 80.6
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 329 336 8 DIFATASA 86.62
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 488 495 8 ELDLFAMK 83.28
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 525 535 11 AVAATAATTTA 80.27
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 558 568 11 ALDIFGDLFDS 87.29
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 583 592 10 SIDLFGTDAF 81.61
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 625 638 14 HVPLFFTAVDAFAA 83.3
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 655 671 17 VIDLFGDAFGSSASETQ 86.62
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 705 722 18 AQNNLLQPNFEAAFGTTP 84.8
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 790 797 8 GDLQWNAG 80.6
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 896 803 809 7 GGANWQP 80.94
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 329 336 8 DIFATASA 86.62
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 488 495 8 ELDLFAMK 83.28
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 525 535 11 AVAATAATTTA 80.27
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 558 568 11 ALDIFGDLFDS 87.29
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 583 592 10 SIDLFGTDAF 81.61
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 625 638 14 HVPLFFTAVDAFAA 83.3
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 655 671 17 VIDLFGDAFGSSASETQ 86.62
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 328 745 705 722 18 AQNNLLQPNFEAAFGTTP 84.8
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 745 896 790 797 8 GDLQWNAG 80.6
DP00225Q05140Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) Rattus norvegicus (Rat) 745 896 803 809 7 GGANWQP 80.94
DP00226Q9CXW3Calcyclin-binding protein (CacyBP) (Siah-interacting protein) Mus musculus (Mouse) 178 229 195 201 7 VLKKIYE 80.27
DP00230Q14449Growth factor receptor-bound protein 14 (GRB14 adapter protein) Homo sapiens (Human) 361 435 361 367 7 SSQSISP 80.27
DP00231P14859POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) Homo sapiens (Human) 1 200 35 49 15 VGGAISTAQAQAFLG 82.99
DP00231P14859POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) Homo sapiens (Human) 1 200 64 75 12 AAQSLNVQSKSN 80.27
DP00231P14859POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) Homo sapiens (Human) 1 200 118 142 25 QQQLLLQQAQAQAQLLAAAVQQHSA 86.14
DP00231P14859POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) Homo sapiens (Human) 1 200 149 157 9 AGATISASA 87.29
DP00231P14859POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) Homo sapiens (Human) 1 200 183 195 13 QQQNLNLQQFVLV 88.04
DP00233P14448Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Gallus gallus (Chicken) 238 504 248 256 9 AMSAFNNIK 95.65
DP00233P14448Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Gallus gallus (Chicken) 238 504 258 264 7 MQVVLER 80.6
DP00233P14448Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Gallus gallus (Chicken) 238 504 282 289 8 TGKLITSS 80.27
DP00233P14448Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Gallus gallus (Chicken) 238 504 351 357 7 STYHFSG 82.94
DP00233P14448Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Gallus gallus (Chicken) 238 504 370 384 15 DLESFFTHDSVSTSS 91.55
DP00233P14448Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Gallus gallus (Chicken) 238 504 440 451 12 KTVLTSSSSSFN 81.61
DP00233P14448Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain Gallus gallus (Chicken) 238 504 453 460 8 GGSTFETK 83.95
DP00236P02686Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) Homo sapiens (Human) 134 304 144 155 12 HGSKYLATASTM 81.1
DP00236P02686Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) Homo sapiens (Human) 134 304 219 228 10 PVVHFFKNIV 88.09
DP00236P02686Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) Homo sapiens (Human) 134 304 283 291 9 TLSKIFKLG 90.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 101 108 8 YANSYNFA 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 120 128 9 DEVSIIQSM 91.45
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 153 165 13 SVQLSNLGTVRTL 83.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 175 184 10 KTSVYIELGS 94.85
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 192 199 8 NKATYCSV 80.27
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 203 209 7 ELLQITP 80.27
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 224 236 13 AACEFSETDVTNT 90.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 244 250 7 NDLNTTE 82.61
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 369 388 20 DVPWITLNSSIQKVNEWFSR 85.08
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 410 424 15 ADVLDVLNEVDEYSG 80.6
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 437 445 9 HEALICKSE 91.64
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 452 466 15 VESNIEDKIFGKTYR 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 478 494 17 TENLIIGAFVTEPQIIQ 84.85
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 544 552 9 QVMNITNSG 85.62
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 576 604 29 KESAFKTKAEPISSSISNMELELNIHNSK 82.78
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 637 643 7 TELQIDS 80.27
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 779 792 14 TQESISLLEVSTLG 81.99
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 804 810 7 QCAAFEN 85.95
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 852 862 11 LDAQYLQNTFK 86.11
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 881 889 9 ECATFSAHS 83.61
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 921 927 7 QTVNITA 86.96
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 962 968 7 ETGLITP 85.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 999 1008 10 LEENFEEHSM 89.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1022 1052 31 TVSTISRNNIRENVFKEASSSNINEVGSSTN 91.69
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1054 1062 9 VGSSINEIG 87.07
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1064 1073 10 SDENIQAELG 83.78
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1118 1135 18 QTVNTDFSPYLISDNLEQ 83.72
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1227 1238 12 QHLLFGKVNNIP 87.46
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1271 1279 9 SNQVILAKA 94.02
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1292 1319 28 SASLFSSQCSELEDLTANTNTQDPFLIG 90.9
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1401 1420 20 QHNLIKLQQEMAELEAVLEQ 84.72
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1452 1458 7 KAVLTSQ 87.29
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 100 1649 1567 1573 7 GISLFSD 97.32
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 175 303 175 184 10 KTSVYIELGS 94.85
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 175 303 192 199 8 NKATYCSV 80.27
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 175 303 203 209 7 ELLQITP 80.27
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 175 303 224 236 13 AACEFSETDVTNT 90.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 175 303 244 250 7 NDLNTTE 82.61
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 224 236 13 AACEFSETDVTNT 90.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 244 250 7 NDLNTTE 82.61
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 369 388 20 DVPWITLNSSIQKVNEWFSR 85.08
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 410 424 15 ADVLDVLNEVDEYSG 80.6
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 437 445 9 HEALICKSE 91.64
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 452 466 15 VESNIEDKIFGKTYR 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 219 498 478 493 16 TENLIIGAFVTEPQII 84.93
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 304 394 369 388 20 DVPWITLNSSIQKVNEWFSR 85.08
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 433 511 437 445 9 HEALICKSE 91.64
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 433 511 452 466 15 VESNIEDKIFGKTYR 91.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 433 511 478 494 17 TENLIIGAFVTEPQIIQ 84.85
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 498 663 544 552 9 QVMNITNSG 85.62
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 498 663 576 604 29 KESAFKTKAEPISSSISNMELELNIHNSK 82.78
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 498 663 637 643 7 TELQIDS 80.27
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 779 792 14 TQESISLLEVSTLG 81.99
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 804 810 7 QCAAFEN 85.95
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 852 862 11 LDAQYLQNTFK 86.11
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 881 889 9 ECATFSAHS 83.61
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 921 927 7 QTVNITA 86.96
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 962 968 7 ETGLITP 85.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 999 1008 10 LEENFEEHSM 89.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 1022 1052 31 TVSTISRNNIRENVFKEASSSNINEVGSSTN 91.69
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 1054 1062 9 VGSSINEIG 87.07
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 740 1083 1064 1073 10 SDENIQAELG 83.78
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 779 792 14 TQESISLLEVSTLG 81.99
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 804 810 7 QCAAFEN 85.95
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 852 862 11 LDAQYLQNTFK 86.11
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 881 889 9 ECATFSAHS 83.61
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 921 927 7 QTVNITA 86.96
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 962 968 7 ETGLITP 85.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 999 1008 10 LEENFEEHSM 89.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 758 1064 1022 1052 31 TVSTISRNNIRENVFKEASSSNINEVGSSTN 91.69
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 936 1057 962 968 7 ETGLITP 85.28
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 936 1057 999 1008 10 LEENFEEHSM 89.97
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 936 1057 1022 1052 31 TVSTISRNNIRENVFKEASSSNINEVGSSTN 91.69
DP00238P38398Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) Homo sapiens (Human) 1343 1440 1401 1420 20 QHNLIKLQQEMAELEAVLEQ 84.72
DP00240P35611Alpha-adducin (Erythrocyte adducin subunit alpha) Homo sapiens (Human) 430 737 485 495 11 VPNLFVPLNTN 87.29
DP00240P35611Alpha-adducin (Erythrocyte adducin subunit alpha) Homo sapiens (Human) 430 737 542 560 19 SKAIIEKEYQPHVIVSTTG 80.51
DP00241P35612Beta-adducin (Erythrocyte adducin subunit beta) Homo sapiens (Human) 409 726 436 443 8 TPNTYLRV 81.27
DP00241P35612Beta-adducin (Erythrocyte adducin subunit beta) Homo sapiens (Human) 409 726 485 491 7 FVPLYTD 82.94
DP00241P35612Beta-adducin (Erythrocyte adducin subunit beta) Homo sapiens (Human) 409 726 493 503 11 QEVLEMRNKIR 85.95
DP00241P35612Beta-adducin (Erythrocyte adducin subunit beta) Homo sapiens (Human) 409 726 518 526 9 QLLASVIAE 89.11
DP00241P35612Beta-adducin (Erythrocyte adducin subunit beta) Homo sapiens (Human) 409 726 657 664 8 TAEEILSK 83.32
DP00242P0AG6330S ribosomal protein S17 (Small ribosomal subunit protein uS17) Escherichia coli (strain K12) 1 83 21 29 9 IVVAIERFV 90.08
DP00242P0AG6330S ribosomal protein S17 (Small ribosomal subunit protein uS17) Escherichia coli (strain K12) 1 83 33 39 7 IYGKFIK 80.94
DP00242P0AG6330S ribosomal protein S17 (Small ribosomal subunit protein uS17) Escherichia coli (strain K12) 1 83 57 63 7 DVVEIRE 86.96
DP00242P0AG6330S ribosomal protein S17 (Small ribosomal subunit protein uS17) Escherichia coli (strain K12) 4 83 21 29 9 IVVAIERFV 90.08
DP00242P0AG6330S ribosomal protein S17 (Small ribosomal subunit protein uS17) Escherichia coli (strain K12) 4 83 33 39 7 IYGKFIK 80.94
DP00242P0AG6330S ribosomal protein S17 (Small ribosomal subunit protein uS17) Escherichia coli (strain K12) 4 83 57 63 7 DVVEIRE 86.96
DP00245P00514cAMP-dependent protein kinase type I-alpha regulatory subunit Cleaved into: cAMP-dependent protein kinase type I-alpha regulatory subunit; N-terminally processed Bos taurus (Bovine) 91 112 98 106 9 AISAEVYTE 86.55
DP00249P63315Troponin C; slow skeletal and cardiac muscles (TN-C) Bos taurus (Bovine) 103 161 108 130 23 ADGYIDLEELKIMLQATGETITE 88.63
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 44 50 7 GQSEYFD 88.87
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 53 61 9 TQMNINLYD 97.44
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 76 86 11 GYVSTSISLRS 80.94
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 90 122 33 VGQTILSGHSTYYIYVIATAPNMFNVNDVLGAY 86.95
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 139 154 16 YSQIYGWYRVHFGVLD 85.95
DP00250P01555Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 19 212 164 174 11 RDRYYSNLDIA 82.58
DP00251O88339Epsin-1 (EPS-15-interacting protein 1) Rattus norvegicus (Rat) 144 575 188 195 8 LQLALAMS 84.62
DP00251O88339Epsin-1 (EPS-15-interacting protein 1) Rattus norvegicus (Rat) 144 575 213 221 9 LQLALSLSR 82.27
DP00251O88339Epsin-1 (EPS-15-interacting protein 1) Rattus norvegicus (Rat) 144 575 238 246 9 LQMAIEESK 87.63
DP00251O88339Epsin-1 (EPS-15-interacting protein 1) Rattus norvegicus (Rat) 144 575 261 267 7 ADVFTTP 90.3
DP00251O88339Epsin-1 (EPS-15-interacting protein 1) Rattus norvegicus (Rat) 144 575 525 535 11 ATLTLNQLRLS 80.27
DP00256P40316Securin "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 110 8 24 17 KENNIVYTGNESSGINF 88.53
DP00256P40316Securin "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 110 59 65 7 NTLKYIQ 87.82
DP00256P40316Securin "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 110 96 102 7 SKSFIFP 87.63
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 167 3 17 15 LNVSFTNRNYDLDYD 83.1
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 167 19 34 16 VQPYFYCDEEENFYQQ 88.46
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 167 96 107 12 ADQLEMVTELLG 85.95
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 167 120 154 35 DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQA 89.62
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 143 3 17 15 LNVSFTNRNYDLDYD 83.1
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 143 19 34 16 VQPYFYCDEEENFYQQ 88.46
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 143 96 107 12 ADQLEMVTELLG 85.95
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 143 120 138 19 DDETFIKNIIIQDCMWSGF 90.02
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 88 3 17 15 LNVSFTNRNYDLDYD 83.1
DP00260P01106Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) Homo sapiens (Human) 1 88 19 34 16 VQPYFYCDEEENFYQQ 88.46
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 405 416 12 GDTIISLDFGSN 91.97
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 427 437 11 EVPLYNDVMLP 84.62
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 442 450 9 KLQNINLAM 97.99
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 484 491 8 SLELSFTM 80.98
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 517 524 8 SEYCFYVD 94.61
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 403 603 527 543 17 MVNEFKLELVEKLFAED 83.79
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 530 698 536 543 8 VEKLFAED 86.62
DP00262Q16665Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) Homo sapiens (Human) 530 698 633 642 10 EDIKILIASP 87.02
DP00265P04925Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230) Mus musculus (Mouse) 23 120 29 39 11 GGWNTGGSRYP 80.94
DP00269Q24298DE-cadherin (Protein shotgun) Drosophila melanogaster (Fruit fly) 1350 1507 1366 1374 9 RETIINYED 83.69
DP00269Q24298DE-cadherin (Protein shotgun) Drosophila melanogaster (Fruit fly) 1350 1507 1391 1401 11 TQPFYEEKLYK 82.94
DP00269Q24298DE-cadherin (Protein shotgun) Drosophila melanogaster (Fruit fly) 1350 1507 1443 1461 19 RHYAYEGDGNSDGSLSSLA 80.94
DP00269Q24298DE-cadherin (Protein shotgun) Drosophila melanogaster (Fruit fly) 1350 1507 1467 1478 12 GDLNFDYLSNFG 90.02
DP00278P08050Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein) Rattus norvegicus (Rat) 255 316 264 271 8 KYAYFNGC 97.32
DP00282Q04656Copper-transporting ATPase 1 (EC 7.2.2.8) (Copper pump 1) (Menkes disease-associated protein) Homo sapiens (Human) 1125 1176 1131 1143 13 HKNNWNIEDNNIK 89.99
DP00282Q04656Copper-transporting ATPase 1 (EC 7.2.2.8) (Copper pump 1) (Menkes disease-associated protein) Homo sapiens (Human) 1125 1176 1146 1171 26 SLVQIDASNEQSSTSSSMIIDAQISN 85.19
DP00284P16009Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C Enterobacteria phage T4 (Bacteriophage T4) 129 179 136 155 20 GEVGYDSSSNVIQDSNLDTA 83.63
DP00284P16009Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C Enterobacteria phage T4 (Bacteriophage T4) 339 389 370 384 15 NDSRILFKEPVSSYK 82.27
DP00285P10388Glutenin; high molecular weight subunit DX5 Triticum aestivum (Wheat) 147 440 270 276 7 GQQGYYP 91.3
DP00285P10388Glutenin; high molecular weight subunit DX5 Triticum aestivum (Wheat) 147 440 300 306 7 GQSGYYP 81.75
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 1 59 4 13 10 RAENWDEAEV 80.6
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 72 80 9 SQVIFCNRS 98.33
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 85 92 8 LPVWLNFD 88.29
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 114 120 7 GHLWLFR 95.37
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 125 140 16 HDGLLVNQTELFVPSL 86.85
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 54 213 144 158 15 GQPIFANITLPVYTL 84.26
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 67 117 72 80 9 SQVIFCNRS 98.33
DP00287P40337von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) Homo sapiens (Human) 67 117 85 92 8 LPVWLNFD 88.29
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 73 2 21 20 QSINFRTARGNLSEVLNNVE 80.6
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 73 24 30 7 EEVEITR 90.64
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 73 52 64 13 LDAEFASLFDTLD 90.74
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 58 2 21 20 QSINFRTARGNLSEVLNNVE 80.6
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 58 24 30 7 EEVEITR 90.64
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 57 2 21 20 QSINFRTARGNLSEVLNNVE 80.6
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 1 57 24 30 7 EEVEITR 90.64
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 41 73 52 64 13 LDAEFASLFDTLD 90.74
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 51 73 52 64 13 LDAEFASLFDTLD 90.74
DP00288Q06253Antitoxin phd (Addiction protein pdh) (Prevent host death protein) Escherichia phage P1 (Bacteriophage P1) 52 73 52 64 13 LDAEFASLFDTLD 90.74
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 113 124 12 TFKLIYSQFFPQ 84.89
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 126 139 14 DATTYAHFLFNAFD 90.73
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 144 177 34 GAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDIN 86.77
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 186 196 11 EMLAIMKSIYD 87.41
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 214 223 10 HVERFFQKMD 82.98
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 228 239 12 GVVTIDEFLETC 84.45
DP00291Q9QXT8Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) Mus musculus (Mouse) 65 256 241 251 11 KDENIMNSMQL 91.52
DP00298Q07817Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X) Homo sapiens (Human) 28 80 47 54 8 TPSAINGN 84.95
DP00303P02185Myoglobin Physeter macrocephalus (Sperm whale) (Physeter catodon) 1 153 9 18 10 QLVLHVWAKV 82.94
DP00303P02185Myoglobin Physeter macrocephalus (Sperm whale) (Physeter catodon) 1 153 27 35 9 QDILIRLFK 87.51
DP00303P02185Myoglobin Physeter macrocephalus (Sperm whale) (Physeter catodon) 1 153 67 77 11 VTVLTALGAIL 89.84
DP00303P02185Myoglobin Physeter macrocephalus (Sperm whale) (Physeter catodon) 1 153 103 117 15 KYLEFISEAIIHVLH 85.86
DP00306Q07108Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69) Homo sapiens (Human) 1 84 3 14 12 SENCFVAENSSL 80.52
DP00306Q07108Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69) Homo sapiens (Human) 1 84 46 76 31 MNVVFITILIIALIALSVGQYNCPGQYTFSM 89.61
DP00324P09651Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed Homo sapiens (Human) 186 320 218 224 7 RGGNFSG 80.27
DP00324P09651Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed Homo sapiens (Human) 186 320 286 292 7 SYDSYNN 80.27
DP00324P09651Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed Homo sapiens (Human) 186 320 302 315 14 SGSNFGGGGSYNDF 85.81
DP00324P09651Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed Homo sapiens (Human) 193 250 218 224 7 RGGNFSG 80.27
DP00324P09651Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed Homo sapiens (Human) 257 305 286 292 7 SYDSYNN 80.27
DP00325P01099Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1) Oryctolagus cuniculus (Rabbit) 1 166 38 44 7 TLVLTSD 90.64
DP00328Q08605Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein) Drosophila melanogaster (Fruit fly) 281 348 294 300 7 ATGEITP 83.95
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 1 15 15 MKVLILACLVALALA 83.19
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 34 58 25 SEESITRINKKIEKFQSEEQQQTED 84.08
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 137 150 14 SQSLTLTDVENLHL 82.94
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 154 160 7 LLQSWMH 86.62
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 175 182 8 QSVLSLSQ 80.27
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 224 201 210 10 PIQAFLLYQE 94.88
DP00329P02666Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin Bos taurus (Bovine) 1 25 1 15 15 MKVLILACLVALALA 83.19
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 2 21 20 KTALILLSILGMACAFSMKN 82.64
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 35 54 20 GVFKYRPRYYLYKHAYFYPH 91.24
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 126 132 7 GLAAIQL 91.97
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 255 282 28 TTVEYEGEYEYTGANEYDNGYEIYESEN 92.76
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 1 317 289 312 24 NYRAYEDEYSYFKGQGYDGYDGQN 89.52
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 258 317 259 282 24 YEGEYEYTGANEYDNGYEIYESEN 92.89
DP00332P21815Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) Homo sapiens (Human) 258 317 289 312 24 NYRAYEDEYSYFKGQGYDGYDGQN 89.52
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 19 40 22 PAVYFKEQFLDGDGWTSRWIES 84.95
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 45 58 14 DFGKFVLSSGKFYG 89.32
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 71 85 15 DARFYALSASFEPFS 81.87
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 91 104 14 LVVQFTVKHEQNID 89.61
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 108 117 10 GYVKLFPNSL 86.29
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 124 133 10 GDSEYNIMFG 94.45
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 143 160 18 KVHVIFNYKGKNVLINKD 97.21
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 168 175 8 FTHLYTLI 90.93
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 178 187 10 PDNTYEVKID 87.29
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 417 302 348 47 DPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWG 87.22
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 19 40 22 PAVYFKEQFLDGDGWTSRWIES 84.95
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 45 58 14 DFGKFVLSSGKFYG 89.32
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 71 85 15 DARFYALSASFEPFS 81.87
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 91 104 14 LVVQFTVKHEQNID 89.61
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 108 117 10 GYVKLFPNSL 86.29
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 124 133 10 GDSEYNIMFG 94.45
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 143 160 18 KVHVIFNYKGKNVLINKD 97.21
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 168 175 8 FTHLYTLI 90.93
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 18 307 178 187 10 PDNTYEVKID 87.29
DP00333P27797Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) Homo sapiens (Human) 308 417 315 348 34 GLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWG 86.77
DP00334Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 1 24 12 19 8 GAVTTSQI 86.62
DP00334Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 210 304 242 254 13 SDQFSVEFEVESL 85.41
DP00334Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 210 304 272 283 12 DDEVYQVTVYQA 82.16
DP00340P62965Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) Mus musculus (Mouse) 1 137 12 21 10 SSENFDELLK 84.28
DP00340P62965Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) Mus musculus (Mouse) 1 137 48 59 12 GDQFYIKTSTTV 97.32
DP00340P62965Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) Mus musculus (Mouse) 1 137 62 68 7 TEINFKV 87.29
DP00340P62965Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) Mus musculus (Mouse) 1 137 116 124 9 NDELILTFG 91.71
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 1 133 21 36 16 AVSHWQQQSYLDSGIH 85.51
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 1 133 60 76 17 SQVLYEWEQGFSQSFTQ 83.38
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 1 133 82 89 8 IDGQYAMT 80.27
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 17 48 21 36 16 AVSHWQQQSYLDSGIH 85.51
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 664 781 679 686 8 TSSLFRTE 80.94
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 664 781 688 694 7 MAWNETA 85.62
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 672 781 679 686 8 TSSLFRTE 80.94
DP00341Q02248Catenin beta-1 (Beta-catenin) Mus musculus (Mouse) 672 781 688 694 7 MAWNETA 85.62
DP00343Q9Y6Q9Nuclear receptor coactivator 3 (NCoA-3) (EC 2.3.1.48) (ACTR) (Amplified in breast cancer 1 protein) (AIB-1) (CBP-interacting protein) (pCIP) (Class E basic helix-loop-helix protein 42) (bHLHe42) (Receptor-associated coactivator 3) (RAC-3) (Steroid receptor coactivator protein 3) (SRC-3) (Thyroid hormone receptor activator molecule 1) (TRAM-1) Homo sapiens (Human) 1018 1088 1058 1065 8 HTLLSNTD 80.52
DP00345P16535Leukotoxin (Lkt) Mannheimia haemolytica (Pasteurella haemolytica) 884 953 896 904 9 VVDNYELLK 81.2
DP00345P16535Leukotoxin (Lkt) Mannheimia haemolytica (Pasteurella haemolytica) 884 953 913 927 15 LDKLISSVSAFTSSN 84.06
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2059 2118 2084 2094 11 QQQVLNILKSN 85.07
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2059 2118 2097 2113 17 LMAAFIKQRTAKYVANQ 83.85
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2059 2117 2084 2094 11 QQQVLNILKSN 85.07
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2059 2117 2097 2112 16 LMAAFIKQRTAKYVAN 84.05
DP00348P45481Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) Mus musculus (Mouse) 2113 2152 2139 2147 9 SLQNLNAMQ 86.62
DP00349P06709Bifunctional ligase/repressor BirA (Biotin operon repressor) (Biotin--acetyl-CoA-carboxylase ligase) (EC 6.3.4.15) (Biotin--protein ligase) (Biotin-acetyl-CoA carboxylase synthetase) Escherichia coli (strain K12) 212 234 220 229 10 NQGWITLQEA 88.03
DP00351Q27974Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) Bos taurus (Bovine) 547 813 592 604 13 LLGSFLNTASASS 86.26
DP00351Q27974Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) Bos taurus (Bovine) 547 813 624 630 7 PAVNIQP 91.97
DP00351Q27974Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) Bos taurus (Bovine) 547 813 723 732 10 GGYNWQQTQS 85.95
DP00351Q27974Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) Bos taurus (Bovine) 547 813 749 756 8 YNVSFSSM 88.29
DP00352O33599Glycyl-glycine endopeptidase LytM (EC 3.4.24.75) (Autolysin LytM) Staphylococcus aureus (strain NCTC 8325 / PS 47) 147 182 150 157 8 NNQAYNSH 95.65
DP00352O33599Glycyl-glycine endopeptidase LytM (EC 3.4.24.75) (Autolysin LytM) Staphylococcus aureus (strain NCTC 8325 / PS 47) 147 182 161 167 7 GKVNYPN 87.29
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 90 8 54 47 QVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSN 87.37
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 90 73 81 9 NENNIKNTL 89.97
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 89 8 54 47 QVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSN 87.37
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 89 73 81 9 NENNIKNTL 89.97
DP00353P23202Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 273 294 278 286 9 NAAAYSAGT 85.51
DP00356Q99967Cbp/p300-interacting transactivator 2 (MSG-related protein 1) (MRG-1) (P35srj) Homo sapiens (Human) 220 269 229 235 7 MSLVIEM 86.34
DP00356Q99967Cbp/p300-interacting transactivator 2 (MSG-related protein 1) (MRG-1) (P35srj) Homo sapiens (Human) 220 269 249 258 10 GQNEFDFMTD 86.62
DP00359A6Q0K5Calvin cycle protein CP12; chloroplastic (CP12 domain-containing protein) (Chloroplast protein 12) Chlamydomonas reinhardtii (Chlamydomonas smithii) 1 50 5 11 7 KSVVISR 87.96
DP00365P53041Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) Homo sapiens (Human) 19 147 34 41 8 QANDYFKA 80.27
DP00365P53041Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) Homo sapiens (Human) 19 147 44 101 58 YENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYR 84.7
DP00372Q9NR00Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) Homo sapiens (Human) 1 106 7 16 10 HQAVIMSTSL 83.85
DP00372Q9NR00Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) Homo sapiens (Human) 1 106 35 56 22 AVGNIFENTDQESLERLFRNSG 83.14
DP00372Q9NR00Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) Homo sapiens (Human) 1 106 63 77 15 RAKIIFAIDQDVEEK 96.3
DP00372Q9NR00Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) Homo sapiens (Human) 1 106 89 101 13 KDKLFQFLKLRKY 81.58
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 153 215 157 163 7 NQQVLTG 87.15
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 153 215 170 193 24 NIQYQVIPQFQTVDGQQLQFAATG 86.41
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 153 215 202 208 7 GQIQIIP 93.55
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 342 488 366 382 17 DALNIQQNQTSGGSLQA 91.97
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 342 488 395 403 9 QQQQILIQP 95.13
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 342 488 411 417 7 ALQALQA 81.61
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 342 488 421 442 22 SGQTFTTQAISQETLQNLQLQA 82.96
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 342 488 460 476 17 GQVSWQTLQLQNLQVQN 86.23
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 366 382 17 DALNIQQNQTSGGSLQA 91.97
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 395 403 9 QQQQILIQP 95.13
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 411 417 7 ALQALQA 81.61
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 421 442 22 SGQTFTTQAISQETLQNLQLQA 82.96
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 460 476 17 GQVSWQTLQLQNLQVQN 86.23
DP00378P08047Transcription factor Sp1 Homo sapiens (Human) 349 495 478 485 8 QAQTITLA 82.02
DP00381P35869Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) Homo sapiens (Human) 545 713 557 563 7 QNEKFFR 81.27
DP00381P35869Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) Homo sapiens (Human) 545 713 578 585 8 TDEILTYV 92.31
DP00381P35869Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) Homo sapiens (Human) 545 713 605 611 7 LALNSSC 80.27
DP00381P35869Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) Homo sapiens (Human) 545 713 645 663 19 MQVNGMFENWNSNQFVPFN 85.62
DP00381P35869Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) Homo sapiens (Human) 545 713 671 688 18 QYNVFTDLHGISQEFPYK 82.03
DP00381P35869Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) Homo sapiens (Human) 545 713 696 704 9 YTQNFISCN 83.72
DP00387P25814Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) Bacillus subtilis (strain 168) 1 116 26 34 9 RQFVLYTLD 87.33
DP00387P25814Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) Bacillus subtilis (strain 168) 1 116 64 72 9 IRQAFLEEK 81.35
DP00387P25814Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) Bacillus subtilis (strain 168) 1 116 78 85 8 KDYIIIAR 96.82
DP00387P25814Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) Bacillus subtilis (strain 168) 1 116 88 97 10 ASQLTYEETK 90.87
DP00387P25814Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) Bacillus subtilis (strain 168) 1 116 100 111 12 LQHLFRKSSLYK 85.62
DP00389P09983Hemolysin; chromosomal Escherichia coli 962 1023 962 994 33 DALAYGSQGNLNPLINEISKIISAAGNFDVKEE 86.69
DP00389P09983Hemolysin; chromosomal Escherichia coli 962 1023 997 1005 9 AASLLQLSG 81.38
DP00389P09983Hemolysin; chromosomal Escherichia coli 962 1023 1008 1018 11 SDFSYGRNSIT 90.3
DP00396O74718Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF3) (ERF2) (Polypeptide release factor 3) (Translation release factor 3) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 280 307 282 296 15 KESWYLSWALDSTSE 85.98
DP00398P07342Acetolactate synthase catalytic subunit; mitochondrial (EC 2.2.1.6) (Acetohydroxy-acid synthase catalytic subunit) (AHAS) (ALS) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 647 687 661 668 8 LDEFINFD 94.57
DP00399P50097"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) 102 221 112 124 13 PDQTFADVLAISQ 82.48
DP00399P50097"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) 102 221 140 155 16 HGVLLGLVTQRDYPID 80.27
DP00399P50097"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) 102 221 184 192 9 EANKIIWEK 82.27
DP00399P50097"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) 102 221 205 213 9 HLRYIVFRK 91.97
DP00410P12497Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-) Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) 108 143 128 138 11 VSQNYPIVQNL 83.92
DP00410P12497Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-) Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) 123 143 128 138 11 VSQNYPIVQNL 83.92
DP00418P78504Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339) Homo sapiens (Human) 1094 1218 1172 1179 8 KQPAYTLV 80.27
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 30 38 9 LNVAWLESS 86.73
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 46 54 9 SAATYYPFV 83.09
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 60 77 18 TEQKIYTEDMAFGASTFP 86.88
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 81 96 16 LSSEITLHPYAYSPYT 81.92
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 100 106 7 TQNVYSV 87.86
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 108 115 8 GSQYLYNQ 96.4
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 164 173 10 ADGTISSEIK 90.97
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 179 189 11 HHLSIYAENSL 96.69
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 214 221 8 PEFEFTTL 81.86
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 262 275 14 AAVLSKGEIVVKNN 85.28
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 319 332 14 VTSMINLKTIASSA 86.74
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 388 397 10 STSKYEVLTV 86.69
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 1 600 584 590 7 MDELIST 94.65
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 776 854 780 786 7 VQQELVG 82.61
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 776 854 819 825 7 HYIEIWK 87.72
DP00420Q96T21Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) Homo sapiens (Human) 776 854 827 849 23 HLEAYSGCTLELEESLEASTSQM 92.98
DP00421P07516Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein) Bos taurus (Bovine) 1 202 81 97 17 AVQRIAESHLQSISNLG 87.72
DP00422P0A6R3DNA-binding protein Fis (Factor-for-inversion stimulation protein) (Hin recombinational enhancer-binding protein) Escherichia coli (strain K12) 1 23 8 18 11 SDVLTVSTVNS 89.3
DP00423P53551Histone H1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 166 252 176 188 13 SSLTYKEMILKSM 80.27
DP00423P53551Histone H1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 166 252 201 212 12 VLKKYVKDTFSS 82.94
DP00423P53551Histone H1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 166 252 216 229 14 TSSNFDYLFNSAIK 85.67
DP00423P53551Histone H1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 171 258 176 188 13 SSLTYKEMILKSM 80.27
DP00423P53551Histone H1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 171 258 201 212 12 VLKKYVKDTFSS 82.94
DP00423P53551Histone H1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 171 258 216 229 14 TSSNFDYLFNSAIK 85.67
DP00427P0AFG8Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1) Escherichia coli (strain K12) 1 55 17 26 10 WLQAIESVIR 81.81
DP00427P0AFG8Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1) Escherichia coli (strain K12) 1 55 33 44 12 AQYLIDQLLAEA 89.63
DP00435Q01853Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Mus musculus (Mouse) 736 806 754 764 11 KYEMFAQTLQQ 86.29
DP00435Q01853Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Mus musculus (Mouse) 736 806 767 774 8 GFGSFRFP 80.27
DP00435Q01853Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) Mus musculus (Mouse) 736 806 792 799 8 GGSVYTED 83.15
DP00436P50477Canavalin Canavalia ensiformis (Jack bean) (Dolichos ensiformis) 1 45 8 29 22 PLWLLLGVVLLASVSASFAHSG 81.61
DP00437P43351DNA repair protein RAD52 homolog Homo sapiens (Human) 1 23 4 10 7 TEEAILG 89.97
DP00438Q05158Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2) Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) 82 117 106 112 7 NTSKFAQ 85.91
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 20 29 10 FLESIKGKFT 80.27
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 37 46 10 KDSIISVNST 95.32
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 58 64 7 SNSTIIN 87.67
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 105 125 21 TIETFDNNEEESSYSYEEIND 89.2
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 141 157 17 KLSEILGMLHTLVVASA 87.23
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 177 194 18 MIEKIRTEALMTNDRLEA 80.94
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 241 222 230 9 KLNNLLEGN 80.27
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 118 20 29 10 FLESIKGKFT 80.27
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 118 37 46 10 KDSIISVNST 95.32
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 118 58 64 7 SNSTIIN 87.67
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 118 105 113 9 TIETFDNNE 91.64
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 102 20 29 10 FLESIKGKFT 80.27
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 102 37 46 10 KDSIISVNST 95.32
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 1 102 58 64 7 SNSTIIN 87.67
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 161 241 177 194 18 MIEKIRTEALMTNDRLEA 80.94
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 161 241 222 230 9 KLNNLLEGN 80.27
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 164 241 177 194 18 MIEKIRTEALMTNDRLEA 80.94
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 164 241 222 230 9 KLNNLLEGN 80.27
DP00447P12579Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain Long) 198 241 222 230 9 KLNNLLEGN 80.27
DP00449P53563Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X) Rattus norvegicus (Rat) 31 80 47 54 8 TPSAINGN 84.95
DP00455P84092AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein) Rattus norvegicus (Rat) 130 158 130 140 11 KTFITQQGIKS 83.95
DP00455P84092AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein) Rattus norvegicus (Rat) 130 158 147 153 7 EQSQITS 80.27
DP00455P84092AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein) Rattus norvegicus (Rat) 135 158 147 153 7 EQSQITS 80.27
DP00458P37727Rab proteins geranylgeranyltransferase component A 1 (Choroideremia protein homolog) (Rab escort protein 1) (REP-1) Rattus norvegicus (Rat) 108 208 128 141 14 AQSAEAAEAAETSC 80.27
DP00461P08083Colicin-N Escherichia coli 1 90 42 48 7 NGWSWSN 82.04
DP00461P08083Colicin-N Escherichia coli 1 90 60 67 8 GSYHITFH 85.95
DP00461P08083Colicin-N Escherichia coli 2 90 42 48 7 NGWSWSN 82.04
DP00461P08083Colicin-N Escherichia coli 2 90 60 67 8 GSYHITFH 85.95
DP00461P08083Colicin-N Escherichia coli 40 76 42 48 7 NGWSWSN 82.04
DP00461P08083Colicin-N Escherichia coli 40 76 60 67 8 GSYHITFH 85.95
DP00462P11157Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit) Mus musculus (Mouse) 353 390 359 371 13 KTNFFEKRVGEYQ 83.87
DP00463Q9Z0U4Gamma-aminobutyric acid type B receptor subunit 1 (GABA-B receptor 1) (GABA-B-R1) (GABA-BR1) (GABABR1) (Gb1) Rattus norvegicus (Rat) 17 98 49 65 17 QVKAINFLPVDYEIEYV 91.32
DP00466P04156Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230) Homo sapiens (Human) 23 124 29 39 11 GGWNTGGSRYP 80.94
DP00468P25963NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) Homo sapiens (Human) 1 66 38 54 17 KDEEYEQMVKELQEIRL 84.48
DP00468P25963NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) Homo sapiens (Human) 276 317 285 311 27 DEESYDTESEFTEFTEDELPYDDCVFG 81.05
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 20 26 7 LAGHFTQ 84.28
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 61 69 9 ELVAEFLQD 86.51
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 91 100 10 MQQIEQSNFR 85.55
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 110 125 16 ADLALSENWAQEFLAA 84.82
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 131 148 18 VTQDYNETDWSQEFISEV 82.57
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 159 166 8 WAEEYLEQ 81.69
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 181 189 9 TDRWYDEYH 91.97
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 211 223 13 ANSEFLKFVRQIG 90.64
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 225 231 7 GQVSLES 80.27
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 324 243 298 56 WAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEM 80.81
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 110 20 26 7 LAGHFTQ 84.28
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 110 61 69 9 ELVAEFLQD 86.51
DP00472P50542Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) Homo sapiens (Human) 1 110 91 100 10 MQQIEQSNFR 85.55
DP00473Q49AN0Cryptochrome-2 Homo sapiens (Human) 490 593 496 522 27 SRLNIERMKQIYQQLSRYRGLCLLASV 85.94
DP00474Q43125Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2) Arabidopsis thaliana (Mouse-ear cress) 506 681 514 524 11 AEVEEAPIEFP 80.27
DP00474Q43125Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2) Arabidopsis thaliana (Mouse-ear cress) 506 681 604 619 16 MIPEFNIRIVAESTED 83.78
DP00474Q43125Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2) Arabidopsis thaliana (Mouse-ear cress) 506 681 660 676 17 TTSSYLQNHHEILNWRR 83.77
DP00485Q9UBE0SUMO-activating enzyme subunit 1 (Ubiquitin-like 1-activating enzyme E1A) Cleaved into: SUMO-activating enzyme subunit 1; N-terminally processed Homo sapiens (Human) 289 311 290 299 10 DFVRYCFSEM 88.96
DP00486Q9UBT2SUMO-activating enzyme subunit 2 (EC 2.3.2.-) (Anthracycline-associated resistance ARX) (Ubiquitin-like 1-activating enzyme E1B) (Ubiquitin-like modifier-activating enzyme 2) Homo sapiens (Human) 551 640 585 593 9 DDVLIVDSD 98.33
DP00487P09938Ribonucleoside-diphosphate reductase small chain 1 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 1) (Ribonucleotide reductase small subunit 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 41 15 33 19 SDLEIKDSKSNLNKELETL 82.61
DP00488P49723Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 51 6 12 7 QFLKTFQ 80.27
DP00488P49723Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 51 23 31 9 KDEILLMEN 80.27
DP00488P49723Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 51 34 46 13 RFVMFPIKYHEIW 84.9
DP00491Q62165Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) Mus musculus (Mouse) 654 750 654 662 9 VVEWTNNTL 88.29
DP00491Q62165Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) Mus musculus (Mouse) 654 750 669 677 9 KEQIIGLSR 91.97
DP00491Q62165Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) Mus musculus (Mouse) 654 750 699 708 10 KALSIAVTGS 87.29
DP00491Q62165Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) Mus musculus (Mouse) 654 750 713 719 7 HLQFIPV 81.89
DP00492P10275Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) Homo sapiens (Human) 142 485 305 311 7 DTAEYSP 80.94
DP00492P10275Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) Homo sapiens (Human) 142 485 355 369 15 EAAAYQSRDYYNFPL 86.35
DP00492P10275Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) Homo sapiens (Human) 142 485 395 402 8 YGSAWAAA 80.6
DP00492P10275Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) Homo sapiens (Human) 142 485 404 416 13 AQCRYGDLASLHG 86.29
DP00492P10275Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) Homo sapiens (Human) 142 485 435 449 15 WHTLFTAEEGQLYGP 83.88
DP00499Q9Z2F5C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) Rattus norvegicus (Rat) 306 430 310 316 7 EQASIEM 80.32
DP00499Q9Z2F5C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) Rattus norvegicus (Rat) 306 430 364 372 9 NGAAYSRYP 82.72
DP00499Q9Z2F5C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) Rattus norvegicus (Rat) 306 430 386 399 14 AVEGIVPSAMSLSH 81.27
DP00505P04234T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d) Homo sapiens (Human) 127 171 145 151 7 NDQVYQP 91.97
DP00510O60356Nuclear protein 1 (Candidate of metastasis 1) (Protein p8) Homo sapiens (Human) 1 82 27 38 12 SDLYSLAHSYLG 80.6
DP00518O54918Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) Mus musculus (Mouse) 1 113 73 79 7 SPLFIFV 94.94
DP00518O54918Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) Mus musculus (Mouse) 1 113 89 97 9 SSGYFSFDT 91.6
DP00518O54918Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) Mus musculus (Mouse) 85 113 89 97 9 SSGYFSFDT 91.6
DP00518O54918Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) Mus musculus (Mouse) 139 171 157 166 10 FNETYTRRVF 87.29
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1362 1745 1470 1484 15 AAVNAAVQRVQVLPD 80.27
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1362 1745 1487 1495 9 TLLHFATES 91.97
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1362 1745 1570 1582 13 DDIEILEECIISA 89.27
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1362 1745 1647 1662 16 TPINFSTATSLSDLTI 84.74
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1362 1745 1724 1731 8 LAECINSA 87.29
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1459 1532 1470 1484 15 AAVNAAVQRVQVLPD 80.27
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1459 1532 1487 1495 9 TLLHFATES 91.97
DP00519P25054Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) Homo sapiens (Human) 1614 1679 1647 1662 16 TPINFSTATSLSDLTI 84.74
DP00520Q969F2Protein naked cuticle homolog 2 (Naked-2) (hNkd2) Homo sapiens (Human) 1 217 23 32 10 SFVASAYASG 93.38
DP00520Q969F2Protein naked cuticle homolog 2 (Naked-2) (hNkd2) Homo sapiens (Human) 1 217 105 113 9 QRLNIDALQ 86.29
DP00520Q969F2Protein naked cuticle homolog 2 (Naked-2) (hNkd2) Homo sapiens (Human) 1 217 123 134 12 RQEWTFTLYDFD 91.44
DP00520Q969F2Protein naked cuticle homolog 2 (Naked-2) (hNkd2) Homo sapiens (Human) 1 217 147 155 9 LMHTIYEVV 82.61
DP00521O95997Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) Homo sapiens (Human) 1 202 1 8 8 MATLIYVD 97.37
DP00521O95997Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) Homo sapiens (Human) 1 202 113 121 9 EIEKFFPFN 87.74
DP00521O95997Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) Homo sapiens (Human) 1 202 123 129 7 LDFESFD 84.85
DP00521O95997Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) Homo sapiens (Human) 1 202 155 162 8 LEKLFQLG 82.61
DP00527P02783Seminal vesicle secretory protein 4 (Androgen-dependent protein) (ADP) (Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV) (SVS protein S) Rattus norvegicus (Rat) 1 70 3 21 19 STSLFLCSLLLLLVTGAIG 85
DP00527P02783Seminal vesicle secretory protein 4 (Androgen-dependent protein) (ADP) (Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV) (SVS protein S) Rattus norvegicus (Rat) 1 70 35 42 8 VSESFASG 80.27
DP00530P12950Dehydrin DHN1 (M3) (RAB-17 protein) Zea mays (Maize) 1 168 139 146 8 TGGAYATG 86.62
DP00531Q08655Abscisic stress-ripening protein 1 Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 115 45 53 9 AAGAYALHE 92.98
DP00531Q08655Abscisic stress-ripening protein 1 Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 115 69 79 11 IEEEIAAAAAV 87.29
DP00531Q08655Abscisic stress-ripening protein 1 Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 1 115 82 89 8 GGFAFHEH 86.96
DP00531Q08655Abscisic stress-ripening protein 1 Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 61 115 69 79 11 IEEEIAAAAAV 87.29
DP00531Q08655Abscisic stress-ripening protein 1 Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 61 115 82 89 8 GGFAFHEH 86.96
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 309 321 13 SKELIVSEEIPIN 86.62
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 356 365 10 GRENFVYANN 88.36
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 386 392 7 SDEAIIP 85.05
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 415 426 12 ETQEFSKNYTTE 80.94
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 463 469 7 IDFATLS 85.28
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 474 483 10 KYQIILDRFA 88.06
DP00533P06701Regulatory protein SIR3 (Silent information regulator 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 216 549 521 540 20 GRETILSNFNADINLEESIR 85.59
DP00534Q9LZP9Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2) Arabidopsis thaliana (Mouse-ear cress) 1 131 6 20 15 TGLNIATQRVFVTSE 88.43
DP00537O43236Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2) Homo sapiens (Human) 1 119 33 41 9 ELSKFVKDF 86.96
DP00537O43236Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2) Homo sapiens (Human) 1 119 88 95 8 DNQQYFCA 95.78
DP00539P51608Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) Homo sapiens (Human) 168 486 310 319 10 ETVSIEVKEV 80.9
DP00539P51608Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) Homo sapiens (Human) 168 486 323 329 7 LLVSTLG 80.6
DP00539P51608Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) Homo sapiens (Human) 261 330 310 319 10 ETVSIEVKEV 80.9
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 16 28 13 VDNAWSMKIPAFR 86.96
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 38 60 23 EESSFATLFPKYRERYLKEVWPL 80.27
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 90 98 9 WDPYIIIKA 85.02
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 123 133 11 GCDIIKIGNLV 81.73
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 156 179 24 SIELLTDCYVLVQGNTVSALGPYK 81.9
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 186 193 8 DIVLETMN 85.28
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 195 207 13 VHPIYNIKALMIK 85.18
DP00540Q9VPU8KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) Drosophila melanogaster (Fruit fly) 1 345 265 274 10 ASGEYFLNQE 86.29
DP00541Q91V27Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) Mus musculus (Mouse) 147 403 223 232 10 LQSLSGEPYS 80.27
DP00541Q91V27Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) Mus musculus (Mouse) 147 403 338 344 7 TQILELN 80.94
DP00541Q91V27Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) Mus musculus (Mouse) 147 403 353 361 9 LLVHLENTV 82.5
DP00541Q91V27Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) Mus musculus (Mouse) 147 403 391 398 8 LTSNISGS 91.97
DP00543Q14061Cytochrome c oxidase copper chaperone Homo sapiens (Human) 1 63 34 40 7 DACIIEK 91.97
DP00543Q14061Cytochrome c oxidase copper chaperone Homo sapiens (Human) 25 63 34 40 7 DACIIEK 91.97
DP00543Q14061Cytochrome c oxidase copper chaperone Homo sapiens (Human) 25 60 34 40 7 DACIIEK 91.97
DP00544B0FRH7Protein LLP (Protein LAPS18-like) "Aplysia kurodai (Kurodas sea hare)" 1 120 49 55 7 SAEEIKN 80.27
DP00544B0FRH7Protein LLP (Protein LAPS18-like) "Aplysia kurodai (Kurodas sea hare)" 1 120 81 94 14 TQQNEDGHYPQWMN 80.27
DP00546Q9NX55Huntingtin-interacting protein K (Huntingtin yeast partner K) Homo sapiens (Human) 1 129 13 23 11 GDVELELETET 80.27
DP00546Q9NX55Huntingtin-interacting protein K (Huntingtin yeast partner K) Homo sapiens (Human) 1 129 63 69 7 AMSVIGD 86.62
DP00546Q9NX55Huntingtin-interacting protein K (Huntingtin yeast partner K) Homo sapiens (Human) 1 129 94 105 12 DLELIMTEMEIS 87.79
DP00549O00488Zinc finger protein 593 (Zinc finger protein T86) Homo sapiens (Human) 36 77 65 72 8 ACARYFID 87.04
DP00550P02628Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3) Esox lucius (Northern pike) 1 108 19 33 15 AEGSFNHKKFFALVG 88.52
DP00550P02628Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3) Esox lucius (Northern pike) 1 108 53 70 18 ASGFIEEEELKFVLKSFA 85.8
DP00550P02628Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3) Esox lucius (Northern pike) 1 108 92 103 12 GDGKIGIDEFET 80.6
DP00551P16860Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29) Homo sapiens (Human) 1 77 10 24 15 ALLLLLFLHLAFLGG 87.54
DP00553Q9NZ94Neuroligin-3 (Gliotactin homolog) Homo sapiens (Human) 731 848 826 838 13 PYNTFAAGFNSTG 83.53
DP00555Q16143Beta-synuclein Homo sapiens (Human) 1 134 35 41 7 EGVLYVG 97.32
DP00555Q16143Beta-synuclein Homo sapiens (Human) 1 134 67 87 21 GGAVFSGAGNIAAATGLVKRE 90.41
DP00555Q16143Beta-synuclein Homo sapiens (Human) 1 134 123 129 7 PQEEYQE 85.14
DP00563Q61337Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) Mus musculus (Mouse) 1 204 40 50 11 AQSMFQIPEFE 88.96
DP00563Q61337Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) Mus musculus (Mouse) 1 204 183 196 14 WTRIIQSWWDRNLG 90.64
DP00564Q6P8Z1Protein B-Myc Mus musculus (Mouse) 2 169 63 69 7 HAGLYSP 92.98
DP00564Q6P8Z1Protein B-Myc Mus musculus (Mouse) 2 169 86 92 7 DSFSIAD 86.62
DP00564Q6P8Z1Protein B-Myc Mus musculus (Mouse) 2 169 111 140 30 DDETFVKNIILQDCMWNGFSASAKLVSKLD 83.55
DP00566P13102Hemagglutinin Cleaved into: Hemagglutinin HA1 chain; Hemagglutinin HA2 chain Influenza A virus (strain A/Whale/Maine/328/1984 H13N2) 141 175 156 169 14 GTNSFYRNLVWFVK 93.07
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 174 361 174 183 10 ADQLLQMIRV 83.68
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 174 361 284 292 9 RREAYFEKQ 86.21
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 174 361 342 351 10 AAVTMSLETV 80.27
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 194 361 284 292 9 RREAYFEKQ 86.21
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 194 361 342 351 10 AAVTMSLETV 80.27
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 224 348 284 292 9 RREAYFEKQ 86.21
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 262 361 284 292 9 RREAYFEKQ 86.21
DP00576P54252Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) Homo sapiens (Human) 262 361 342 351 10 AAVTMSLETV 80.27
DP00583P16006Deoxycytidylate deaminase (EC 3.5.4.12) (dCMP deaminase) (dCD) Enterobacteria phage T4 (Bacteriophage T4) 63 83 64 70 7 KHAIIQG 87.63
DP00584A2VD23Protein starmaker Danio rerio (Zebrafish) (Brachydanio rerio) 1 613 7 21 15 FVPLILAFVGVSISA 88.03
DP00584A2VD23Protein starmaker Danio rerio (Zebrafish) (Brachydanio rerio) 1 613 37 49 13 DQRHIFTVQFNVG 85.31
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 14 29 16 ALESIYPDSFTVLSES 86.33
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 31 40 10 PSFTITVTSE 80.3
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 50 61 12 TTLKFTYSEKYP 89.3
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 65 77 13 PLYEIFSQENLED 96.06
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 96 120 25 GMVMIFTLVTAVQEKLNEIVDQIKT 90.19
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 144 166 23 TPVTIENFLSWKAKFDAELLEIK 83.58
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 183 203 21 GKQLFETDHNLDTSDIQFLED 82.78
DP00587Q9CQK7RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) Mus musculus (Mouse) 1 243 211 225 15 DESLFQEMDDLELED 88.29
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1009 1015 7 HVQHIIG 91.26
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1026 1034 9 AHDNFLAGG 80.6
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1064 1077 14 DDVFLQDLGVWSNQ 86.29
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1121 1127 7 ALNLFSV 97.66
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1129 1137 9 HVKNIENLH 82.27
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1186 1193 8 GNDIFLQD 80.85
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1246 1253 8 LGVDYYDN 87.54
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1257 1271 15 VENVIGTSMKDVLIG 90.9
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1273 1279 7 AQANTLM 86.96
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1328 1334 7 GNDWFGQ 80.6
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1369 1376 8 GLGILADL 81.27
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1460 1466 7 GDDWFFQ 96.27
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1498 1505 8 KGVFLSLG 87.29
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1520 1531 12 VLRNIENAVGSA 86.96
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1586 1605 20 GDDTYLFGVGYGHDTIYESG 87.49
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1617 1624 8 ADQLWFAR 97.78
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1627 1635 9 NDLEIRILG 81.68
DP00591J7QLC0Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) 1006 1706 1651 1662 12 HRVEIIHAANQA 85.01
DP00592P48539Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4) Homo sapiens (Human) 1 62 26 33 8 VQEEFDID 89.97
DP00592P48539Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4) Homo sapiens (Human) 1 62 42 54 13 AAVAIQSQFRKFQ 89.81
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 578 597 20 GGYNYHGHFNAINASANLSP 85.64
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 601 610 10 ASSLYEYNGV 93.85
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 612 619 8 AADNFYGQ 95.23
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 624 643 20 QQQSYQQHNYNSHNGERYSL 94.73
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 645 667 23 TFPTISELAAATAAVEAAAAATV 80.85
DP00594P49869Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) Drosophila melanogaster (Fruit fly) 523 753 695 702 8 KLAKITLN 85.28
DP00605Q24246Cytoplasmic dynein 1 intermediate chain (DH IC) (Dynein intermediate chain; cytosolic) (Protein short wing) Drosophila melanogaster (Fruit fly) 109 135 109 121 13 NLSVYNVQATNIP 87.21
DP00605Q24246Cytoplasmic dynein 1 intermediate chain (DH IC) (Dynein intermediate chain; cytosolic) (Protein short wing) Drosophila melanogaster (Fruit fly) 109 135 124 130 7 ETLVYTK 86.67
DP00606P42759Dehydrin ERD10 (Low-temperature-induced protein LTI45) Arabidopsis thaliana (Mouse-ear cress) 1 260 1 9 9 MAEEYKNTV 84.95
DP00606P42759Dehydrin ERD10 (Low-temperature-induced protein LTI45) Arabidopsis thaliana (Mouse-ear cress) 1 260 31 38 8 GMFDFLKK 80.6
DP00606P42759Dehydrin ERD10 (Low-temperature-induced protein LTI45) Arabidopsis thaliana (Mouse-ear cress) 1 260 209 224 16 QVVNTTPLVETATPIA 87.29
DP00607Q16595Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN) Homo sapiens (Human) 42 86 61 79 19 GLNQIWNVKKQSVYLMNLR 85.07
DP00608Q13573SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) Homo sapiens (Human) 59 129 84 102 19 NALAIQVDSEGKIKYDAIA 89.7
DP00608Q13573SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) Homo sapiens (Human) 59 129 109 117 9 DKVIYSKYT 89.97
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 210 223 14 SDNVIEEEGVELTD 83.52
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 225 232 8 GDVIVNSS 88.21
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 269 278 10 VANKFDQIGD 86.62
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 344 361 18 KGMTYAEVIKAASAVADN 83.2
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 392 402 11 DSSAIEAVNVD 80.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 417 427 11 SEVLETDGNIP 83
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 475 482 8 VDADINVA 80.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 506 515 10 VDKTISNIEE 91
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 519 535 17 LTAAYDGNFELAVKEIS 85.46
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 636 644 9 TEEMIFGSS 81.49
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 649 656 8 QFLAELEK 80.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 666 674 9 DEANISNNM 81.46
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 678 686 9 IDGQIVTDS 80.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 1 727 705 712 8 ALAALLKA 80.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 163 374 210 223 14 SDNVIEEEGVELTD 83.52
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 163 374 225 232 8 GDVIVNSS 88.21
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 163 374 269 278 10 VANKFDQIGD 86.62
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 163 374 344 361 18 KGMTYAEVIKAASAVADN 83.2
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 408 627 417 427 11 SEVLETDGNIP 83
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 408 627 475 482 8 VDADINVA 80.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 408 627 506 515 10 VDKTISNIEE 91
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 408 627 519 535 17 LTAAYDGNFELAVKEIS 85.46
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 649 656 8 QFLAELEK 80.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 666 674 9 DEANISNNM 81.46
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 678 686 9 IDGQIVTDS 80.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 705 712 8 ALAALLKA 80.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 720 729 10 EGGNFTITSQ 81.67
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 731 738 8 GTKLFSMD 82.27
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 759 783 25 NRSNIFSNSNVTMADETEINLSEEE 84.07
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 793 802 10 LRVKFLRLLQ 84.95
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 813 825 13 AAQVLYRLALLAG 97.25
DP00609O81283Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) Arabidopsis thaliana (Mouse-ear cress) 639 839 828 834 7 AGQLFSL 87.15
DP00610Q9SLF3Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) Arabidopsis thaliana (Mouse-ear cress) 1 455 44 56 13 EDEVFEEAIGSEN 84.9
DP00610Q9SLF3Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) Arabidopsis thaliana (Mouse-ear cress) 1 455 123 133 11 GEAEFDVLATK 85.28
DP00610Q9SLF3Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) Arabidopsis thaliana (Mouse-ear cress) 1 455 264 271 8 SKNLFEKQ 80.27
DP00610Q9SLF3Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) Arabidopsis thaliana (Mouse-ear cress) 1 455 284 291 8 KDLFENGS 80.27
DP00610Q9SLF3Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) Arabidopsis thaliana (Mouse-ear cress) 1 455 306 320 15 TGAAYTSNIVTNASG 91.75
DP00610Q9SLF3Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) Arabidopsis thaliana (Mouse-ear cress) 1 455 368 375 8 TEVHSNSG 80.27
DP00611P30291Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) Homo sapiens (Human) 1 292 22 29 8 RQKLIFSP 87.29
DP00611P30291Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) Homo sapiens (Human) 1 292 129 139 11 AAPYFLGSSFS 83.31
DP00611P30291Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) Homo sapiens (Human) 1 292 231 239 9 PQVNINPFT 97.32
DP00613Q22472Resistance to inhibitors of cholinesterase protein 3 Caenorhabditis elegans 1 378 42 70 29 LGLVFGVIVVCFAMLYPTLFHPMLMGFLG 87.18
DP00613Q22472Resistance to inhibitors of cholinesterase protein 3 Caenorhabditis elegans 1 378 125 147 23 GMFTWMLPVYTIGVVLFLLYTLF 90.17
DP00613Q22472Resistance to inhibitors of cholinesterase protein 3 Caenorhabditis elegans 1 378 199 210 12 AMSKILEQLESV 87.29
DP00613Q22472Resistance to inhibitors of cholinesterase protein 3 Caenorhabditis elegans 1 378 245 251 7 NEQYIKD 92.64
DP00613Q22472Resistance to inhibitors of cholinesterase protein 3 Caenorhabditis elegans 1 378 255 267 13 ALKEFQSLSKEYD 80.27
DP00613Q22472Resistance to inhibitors of cholinesterase protein 3 Caenorhabditis elegans 1 378 294 300 7 ELSEIEE 85.28
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2213 2308 2223 2235 13 DADLIEANLLWRQ 82.81
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2213 2308 2237 2243 7 MGGNITR 86.62
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2213 2308 2248 2258 11 NKVVILDSFEP 87.29
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2218 2314 2223 2235 13 DADLIEANLLWRQ 82.81
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2218 2314 2237 2243 7 MGGNITR 86.62
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2218 2314 2248 2258 11 NKVVILDSFEP 87.29
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2221 2314 2223 2235 13 DADLIEANLLWRQ 82.81
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2221 2314 2237 2243 7 MGGNITR 86.62
DP00615Q9WMX2Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (isolate Con1) (HCV) 2221 2314 2248 2258 11 NKVVILDSFEP 87.29
DP00621P00736Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain Homo sapiens (Human) 193 305 194 211 18 SSELYTEASGYISSLEYP 89.67
DP00621P00736Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain Homo sapiens (Human) 193 305 218 226 9 LRCNYSIRV 87.29
DP00621P00736Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain Homo sapiens (Human) 193 305 232 241 10 LHLKFLEPFD 82.61
DP00621P00736Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain Homo sapiens (Human) 193 305 253 267 15 DQLQIYANGKNIGEF 84.24
DP00621P00736Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain Homo sapiens (Human) 193 305 283 291 9 VDLLFFTDE 89.22
DP00623P83949Homeotic protein ultrabithorax Drosophila melanogaster (Fruit fly) 1 174 1 13 13 MNSYFEQASGFYG 87.86
DP00623P83949Homeotic protein ultrabithorax Drosophila melanogaster (Fruit fly) 1 174 36 47 12 AAAAYRGFPLSL 87.96
DP00623P83949Homeotic protein ultrabithorax Drosophila melanogaster (Fruit fly) 1 174 66 79 14 YDASITAACNKIYG 85.91
DP00625P45976Pre-mRNA polyadenylation factor FIP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 80 195 80 88 9 DLEVIISLG 96.99
DP00625P45976Pre-mRNA polyadenylation factor FIP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 80 195 99 109 11 LDSYSTAATSS 80.6
DP00625P45976Pre-mRNA polyadenylation factor FIP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 80 195 111 125 15 KDVISVATDVSNTIT 87.76
DP00625P45976Pre-mRNA polyadenylation factor FIP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 80 195 168 181 14 KEGIFDSVGITTID 87.29
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 8 27 20 DLREIVTFPLFSDLVQCGFP 86.45
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 34 46 13 VEQRIDLNQLLIQ 88.45
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 49 67 19 SATYFVKASGDSMIDGGIS 88.21
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 69 80 12 GDLLIVDSAITA 94.48
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 83 96 14 GDIVIAAVDGEFTV 88.63
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 104 123 20 TVQLIPMNSAYSPITISSED 84.98
DP00626P0AG11"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" Escherichia coli (strain K12) 1 139 128 134 7 FGVVIHV 85.43
DP00628P15309"Prostatic acid phosphatase (PAP) (EC 3.1.3.2) (5-nucleotidase) (5-NT) (EC 3.1.3.5) (Acid phosphatase 3) (Ecto-5-nucleotidase) (Protein tyrosine phosphatase ACP3) (EC 3.1.3.48) (Thiamine monophosphatase) (TMPase) Cleaved into: PAPf39" Homo sapiens (Human) 248 286 262 271 10 VLVNEILNHM 82.27
DP00629Q07097Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Sendai virus (strain Fushimi) (SeV) 401 524 413 422 10 GGGAIEVALD 80.4
DP00629Q07097Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Sendai virus (strain Fushimi) (SeV) 402 524 413 422 10 GGGAIEVALD 80.4
DP00630O76070Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR) Homo sapiens (Human) 1 127 6 12 7 KGFSIAK 87.29
DP00630O76070Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR) Homo sapiens (Human) 1 127 69 93 25 AVVSSVNTVATKTVEEAENIAVTSG 85.35
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 284 90 97 8 TLFQFESH 85.54
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 284 177 190 14 KVITFELAKNWNNN 84.62
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 284 204 212 9 EEDIIINPV 95.13
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 284 225 231 7 VTQEIRN 80.6
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 284 245 254 10 EDVITYVNKK 91.54
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 31 190 90 97 8 TLFQFESH 85.54
DP00631P38634Protein SIC1 (CDK inhibitor p40) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 31 190 177 185 9 KVITFELAK 85.73
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 14 23 10 AQQGYSAYTA 91.81
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 32 45 14 TTQAYGQQSYGTYG 88.51
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 48 71 24 TDVSYTQAQTTATYGQTAYATSYG 89.67
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 82 88 7 APQAYSQ 87.29
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 94 119 26 GTGAYDTTTATVTTTQASYAAQSAYG 88.83
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 166 174 9 GQSNYSYPQ 97.99
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 204 215 12 DQSSYSQQNTYG 89.88
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 222 233 12 QQSSYGQQSSYG 87.29
DP00632Q01844RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) Homo sapiens (Human) 1 264 243 249 7 QTGSYSQ 80.27
DP00633Q09472Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) Homo sapiens (Human) 401 566 425 431 7 NQQPILT 82.61
DP00633Q09472Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) Homo sapiens (Human) 401 566 455 480 26 TVSQIDPSSIERAYAALGLPYQVNQM 83.26
DP00633Q09472Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) Homo sapiens (Human) 401 566 533 541 9 LHSAINSQN 90.97
DP00636P17120Kinesin-like protein bimC Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) 1 71 44 50 7 KTAAISR 86.29
DP00640Q89933Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) 400 525 415 429 15 AQVSFLHGDQSENEL 97.32
DP00640Q89933Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) 400 525 514 520 7 TPIVYND 82.94
DP00640Q89933Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) 401 525 415 429 15 AQVSFLHGDQSENEL 97.32
DP00640Q89933Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) 401 525 514 520 7 TPIVYND 82.94
DP00640Q89933Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) 401 486 415 429 15 AQVSFLHGDQSENEL 97.32
DP00641P51671Eotaxin (C-C motif chemokine 11) (Eosinophil chemotactic protein) (Small-inducible cytokine A11) Homo sapiens (Human) 1 31 5 19 15 AALLWLLLIAAAFSP 91.97
DP00644P22362C-C motif chemokine 1 (Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309) Homo sapiens (Human) 1 23 1 16 16 MQIITTALVCLLLAGM 82.21
DP00645Q91ZE9Bcl-2-modifying factor Mus musculus (Mouse) 1 185 31 41 11 SADLFAQSQLD 84.62
DP00645Q91ZE9Bcl-2-modifying factor Mus musculus (Mouse) 1 185 46 52 7 RLQLFPL 87.29
DP00645Q91ZE9Bcl-2-modifying factor Mus musculus (Mouse) 1 185 92 104 13 PQRLFYGNAGYRL 85.52
DP00645Q91ZE9Bcl-2-modifying factor Mus musculus (Mouse) 1 185 137 148 12 KLQCIADQFHRL 86.96
DP00645Q91ZE9Bcl-2-modifying factor Mus musculus (Mouse) 1 185 159 176 18 RAWWQVFLFLQNLALNRQ 86.85
DP00646Q01231Gap junction alpha-5 protein (Connexin-40) (Cx40) Mus musculus (Mouse) 251 355 275 287 13 SGEKFFSDFSNNM 80.89
DP00646Q01231Gap junction alpha-5 protein (Connexin-40) (Cx40) Mus musculus (Mouse) 251 355 309 319 11 GEGFIHMHYSQ 81.27
DP00654Q9ZPI5Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 (AtMPF2) Includes: Enoyl-CoA hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase (EC 4.2.1.17) (EC 5.1.2.3) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) Arabidopsis thaliana (Mouse-ear cress) 576 596 583 590 8 KGFYLYDD 96.78
DP00655P59113Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1) Mus musculus (Mouse) 141 250 160 171 12 VIEDILNLESSS 80.27
DP00655P59113Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1) Mus musculus (Mouse) 141 250 179 195 17 SPGLYSKTMTPTYDPIN 80.27
DP00655P59113Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1) Mus musculus (Mouse) 141 250 202 208 7 TMTWFGD 85.95
DP00656P07674Transcriptional repressor protein KorB Escherichia coli 252 294 259 266 8 TVDAFNGQ 84.62
DP00657P31168Dehydrin COR47 (Cold-induced COR47 protein) Arabidopsis thaliana (Mouse-ear cress) 1 265 1 7 7 MAEEYKN 84.95
DP00657P31168Dehydrin COR47 (Cold-induced COR47 protein) Arabidopsis thaliana (Mouse-ear cress) 1 265 33 40 8 GLFDFLGK 86.96
DP00657P31168Dehydrin COR47 (Cold-induced COR47 protein) Arabidopsis thaliana (Mouse-ear cress) 1 265 76 91 16 KENKITLLEELQEKTE 82.94
DP00659P16458Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit) Sterkiella nova (Ciliate) (Oxytricha nova) 233 385 336 345 10 QFVKYLDWHE 97.99
DP00661Q9CX60Protein LBH (Limb bud and heart-expressed protein) Mus musculus (Mouse) 1 105 1 15 15 MSVYFPIHCSDYLRS 90.64
DP00661Q9CX60Protein LBH (Limb bud and heart-expressed protein) Mus musculus (Mouse) 1 105 40 46 7 LSYQIFP 90.3
DP00662Q8LBP4Inner membrane protein ALBINO3; chloroplastic Arabidopsis thaliana (Mouse-ear cress) 339 462 341 353 13 NNVLSTAQQVYLR 85.75
DP00662Q8LBP4Inner membrane protein ALBINO3; chloroplastic Arabidopsis thaliana (Mouse-ear cress) 339 462 365 372 8 NASKIISA 85.54
DP00663P81558Myelin basic protein (MBP) Sus scrofa (Pig) 1 171 10 20 11 HGSKYLASAST 83.61
DP00663P81558Myelin basic protein (MBP) Sus scrofa (Pig) 1 171 85 94 10 PVVHFFKNIV 88.09
DP00663P81558Myelin basic protein (MBP) Sus scrofa (Pig) 1 171 150 158 9 TLSKIFKLG 90.97
DP00664Q0141718 kDa seed maturation protein Glycine max (Soybean) (Glycine hispida) 1 173 14 22 9 TATNIGASA 85.95
DP00664Q0141718 kDa seed maturation protein Glycine max (Soybean) (Glycine hispida) 1 173 98 109 12 GTATYSTTGEYG 88.29
DP00666P32004Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171) Homo sapiens (Human) 1144 1257 1169 1177 9 KDETFGEYR 85.73
DP00666P32004Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171) Homo sapiens (Human) 1144 1257 1215 1231 17 VDVQFNEDGSFIGQYSG 85.26
DP00667P42763Dehydrin ERD14 Arabidopsis thaliana (Mouse-ear cress) 1 185 1 7 7 MAEEIKN 81.27
DP00667P42763Dehydrin ERD14 Arabidopsis thaliana (Mouse-ear cress) 1 185 29 36 8 GLFDFLGK 86.96
DP00667P42763Dehydrin ERD14 Arabidopsis thaliana (Mouse-ear cress) 1 185 48 60 13 IASEFEQKVHISE 86.13
DP00669P81019Seminal plasma protein BSP-30 kDa (BSP-30K) Bos taurus (Bovine) 26 96 56 66 11 YTTTFLPRTIY 80.27
DP00672Q92886Neurogenin-1 (NGN-1) (Class A basic helix-loop-helix protein 6) (bHLHa6) (Neurogenic basic-helix-loop-helix protein) (Neurogenic differentiation factor 3) (NeuroD3) Homo sapiens (Human) 90 150 134 145 12 LRFAYNYIWALA 92.73
DP00673P06935Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) West Nile virus (WNV) 2 105 47 60 14 VLALLAFFRFTAIA 87.74
DP00674Q69422Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Hepatitis GB virus B (GBV-B) (GB virus B) 2 155 22 31 10 TQASYPVSIK 80.94
DP00674Q69422Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Hepatitis GB virus B (GBV-B) (GB virus B) 2 155 51 59 9 RNYKIAGIH 80.27
DP00674Q69422Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Hepatitis GB virus B (GBV-B) (GB virus B) 2 155 61 71 11 GLQTLAQAALP 81.27
DP00674Q69422Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Hepatitis GB virus B (GBV-B) (GB virus B) 2 155 86 104 19 NLGILLDYPLGWIGDVTTH 83.12
DP00674Q69422Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Hepatitis GB virus B (GBV-B) (GB virus B) 2 155 129 150 22 DGVNWATGWFGVHLFVVCLLSL 87.29
DP00675P19711Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) 169 270 208 220 13 PDATIVVEGVKYQ 83.9
DP00675P19711Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) 169 270 233 239 7 QDGLYHN 86.96
DP00675P19711Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) 169 270 253 265 13 ALLAWAIIAIVLF 94.52
DP00675P19711Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) 170 260 208 220 13 PDATIVVEGVKYQ 83.9
DP00675P19711Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) 170 260 233 239 7 QDGLYHN 86.96
DP00677P1281016.9 kDa class I heat shock protein 1 (HSP 16.9) (Heat shock protein 16.9A) (Heat shock protein 17) (Low molecular weight heat shock protein) Triticum aestivum (Wheat) 1 42 13 19 7 FADLWAD 80.27
DP00677P1281016.9 kDa class I heat shock protein 1 (HSP 16.9) (Heat shock protein 16.9A) (Heat shock protein 17) (Low molecular weight heat shock protein) Triticum aestivum (Wheat) 1 42 23 32 10 TFRSIVPAIS 86.29
DP00678P11171Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1) Homo sapiens (Human) 800 864 819 829 11 RIVITGDADID 86.62
DP00678P11171Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1) Homo sapiens (Human) 800 864 834 841 8 LVQAIKEA 88.63
DP00683Q99801Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) Homo sapiens (Human) 1 184 27 37 11 TSFLIQDILRD 87.08
DP00683Q99801Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) Homo sapiens (Human) 1 184 73 79 7 NDQLSTG 81.27
DP00683Q99801Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) Homo sapiens (Human) 1 184 98 110 13 HLGSYLLDSENTS 86.62
DP00683Q99801Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) Homo sapiens (Human) 1 184 130 151 22 AFSHTQVIELERKFSHQKYLSA 86.29
DP00683Q99801Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) Homo sapiens (Human) 1 184 166 176 11 TQVKIWFQNRR 85.95
DP00689P30185Dehydrin Rab18 Arabidopsis thaliana (Mouse-ear cress) 1 186 20 29 10 IQQQYDEYGN 87.29
DP00693P45561Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP) Sus scrofa (Pig) 2 173 2 16 15 GTWILFACLLGAAFS 87.65
DP00693P45561Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP) Sus scrofa (Pig) 2 173 25 47 23 HPGYINFSYEVLTPLKWYQNMIR 83.83
DP00693P45561Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP) Sus scrofa (Pig) 2 173 63 69 7 HHQIIPV 87.29
DP00694Q8N488RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) Homo sapiens (Human) 1 228 28 44 17 SVCTFRNSAEAFKCSIC 80.86
DP00694Q8N488RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) Homo sapiens (Human) 1 228 124 135 12 EANSIQSANATT 80.94
DP00694Q8N488RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) Homo sapiens (Human) 1 228 156 176 21 AQQLAVTVGNVTVIITDFKEK 81.59
DP00694Q8N488RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) Homo sapiens (Human) 145 179 156 174 19 AQQLAVTVGNVTVIITDFK 81.66
DP00697Q9IK92Nucleoprotein (Protein N) (Nucleocapsid protein) Nipah virus 400 532 418 424 7 GGVLIGG 96.32
DP00697Q9IK92Nucleoprotein (Protein N) (Nucleocapsid protein) Nipah virus 400 532 473 481 9 TNSLLNLRS 80.27
DP00698O89339Nucleoprotein (Protein N) (Nucleocapsid protein) Hendra virus (isolate Horse/Autralia/Hendra/1994) 400 532 473 481 9 TNSLLNLRS 80.27
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 9 39 31 DGLNIIDFIQKNQKEIQKTYGRSSIQQPSIK 84.6
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 112 118 7 TDVVYHD 89.97
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 125 131 7 GYGFTSS 80.27
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 155 169 15 KMLSYAPEIAVSKED 86.62
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 189 200 12 TAVPFTLRNLSD 80.27
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 208 220 13 IAEHYYGLGVKEQ 90.66
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 234 241 8 SIKLYTSD 87.96
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 245 255 11 ADQLEFEDEFA 87.23
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 258 267 10 SSEVIVGISP 86.29
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 328 334 7 LAEEFEC 86.62
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 348 355 8 ENSLINCQ 91.97
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 406 364 373 10 YHWSIERSIS 87.29
DP00699Q9IK91Phosphoprotein (Protein P) Nipah virus 1 100 9 39 31 DGLNIIDFIQKNQKEIQKTYGRSSIQQPSIK 84.6
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 10 34 25 GLDIIDFIQKNQKEIQKTYGRSSIQ 83.93
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 84 101 18 SDGTIGQRVSNTRAWAED 81.61
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 112 118 7 TDVVYHD 89.97
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 171 184 14 EIDLIGLEDKFASA 80.94
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 207 215 9 VIPEYYYGS 86.36
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 228 241 14 GNVNLDSIKIYTSD 86.26
DP00700O55778Phosphoprotein (Protein P) Hendra virus (isolate Horse/Autralia/Hendra/1994) 1 404 246 265 20 NQLEYEDEFAKSSSEVVIDT 92.49
DP00702P46937Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog) Homo sapiens (Human) 50 171 65 73 9 LEALFNAVM 86.29
DP00705P2294312 kDa heat shock protein (Glucose and lipid-regulated protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 109 29 35 7 GKEYITD 87.29
DP00705P2294312 kDa heat shock protein (Glucose and lipid-regulated protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 109 91 98 8 DAVEYVSG 96.32
DP00706Q15517Corneodesmosin (S protein) Homo sapiens (Human) 60 171 64 70 7 GFSSYSG 92.64
DP00706Q15517Corneodesmosin (S protein) Homo sapiens (Human) 60 171 113 119 7 SQVSYSS 82.47
DP00706Q15517Corneodesmosin (S protein) Homo sapiens (Human) 60 171 159 166 8 SSFQFSSS 80.6
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 161 243 191 203 13 LEQLLALYVAEIR 85.18
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 161 243 218 228 11 PDSAYLQEARL 84.62
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 347 420 372 380 9 LDEVISKYA 91.19
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 495 740 499 506 8 SLQISNEK 86.96
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 495 740 563 573 11 VSQLFELEIEA 85.31
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 495 740 598 605 8 TTVLENGA 85.95
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 495 740 644 652 9 LGNSYVERQ 86.96
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 495 740 692 701 10 GLVTSSLCIP 85.62
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 566 739 566 573 8 LFELEIEA 86.16
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 566 739 598 605 8 TTVLENGA 85.95
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 566 739 644 652 9 LGNSYVERQ 86.96
DP00707Q9UER7Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) Homo sapiens (Human) 566 739 692 701 10 GLVTSSLCIP 85.62
DP00708O35613Death domain-associated protein 6 (Daxx) Mus musculus (Mouse) 566 739 605 613 9 AAVVTSTSV 85.28
DP00708O35613Death domain-associated protein 6 (Daxx) Mus musculus (Mouse) 566 739 644 650 7 LGNSYIK 87.29
DP00708O35613Death domain-associated protein 6 (Daxx) Mus musculus (Mouse) 566 739 715 726 12 RQCIYKTSVATQ 91.97
DP00709Q9Y3M2Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1) Homo sapiens (Human) 1 63 3 9 7 FFGNTFS 86.34
DP00709Q9Y3M2Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1) Homo sapiens (Human) 1 63 18 25 8 SASLSNLH 80.6
DP00709Q9Y3M2Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1) Homo sapiens (Human) 1 63 36 42 7 LGLEYGS 85.62
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 9 111 21 31 11 LSANISQEMTM 87.96
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 9 111 41 52 12 TNFGISSVDLSV 82.41
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 9 111 69 75 7 DFSSIST 87.29
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 9 111 91 106 16 ADYKYDLKLQEYQSAI 91.66
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 112 174 119 125 7 KTQLYNK 96.99
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 112 174 133 139 7 SLMAIEC 82.94
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 112 174 147 153 7 SGFHYGV 87.29
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 238 278 243 255 13 AKHLYDSYIKSFP 88.6
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 238 278 260 267 8 KARAILTG 81.27
DP00718P37231Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) Homo sapiens (Human) 453 477 456 468 13 SSQLFAKLLQKMT 90.64
DP00719Q13569G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) Homo sapiens (Human) 1 50 5 29 25 NAGSYSLQQAQAFYTFPFQQLMAEA 86.93
DP00719Q13569G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) Homo sapiens (Human) 51 111 94 103 10 KQEKITDTFK 87.29
DP00719Q13569G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) Homo sapiens (Human) 340 410 360 367 8 SNGLIESV 82.94
DP00719Q13569G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) Homo sapiens (Human) 340 410 371 379 9 GESAFSGIP 90.64
DP00719Q13569G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) Homo sapiens (Human) 340 410 381 399 19 GQWMTQSFTDQIPSFSNHC 81.2
DP00720Q05344FACT complex subunit Ssrp1 (Chorion-factor 5) (Facilitates chromatin transcription complex subunit Ssrp1) (Recombination signal sequence recognition protein) (Single-strand recognition protein) (dSSRP1) Drosophila melanogaster (Fruit fly) 437 518 490 501 12 VAEEYDSNVESD 88.63
DP00720Q05344FACT complex subunit Ssrp1 (Chorion-factor 5) (Facilitates chromatin transcription complex subunit Ssrp1) (Recombination signal sequence recognition protein) (Single-strand recognition protein) (dSSRP1) Drosophila melanogaster (Fruit fly) 625 723 659 665 7 SKEYISD 85.28
DP00721Q8IRG6FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16) Drosophila melanogaster (Fruit fly) 889 1044 904 916 13 QSLNWQKIMKTIT 86.06
DP00724Q9LQT8DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2) Arabidopsis thaliana (Mouse-ear cress) 11 113 27 38 12 MDELLAVLGYKV 80.6
DP00724Q9LQT8DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2) Arabidopsis thaliana (Mouse-ear cress) 11 113 50 58 9 LEQLEVMMS 80.6
DP00724Q9LQT8DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2) Arabidopsis thaliana (Mouse-ear cress) 11 113 71 89 19 ETVHYNPAELYTWLDSMLT 87.54
DP00724Q9LQT8DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2) Arabidopsis thaliana (Mouse-ear cress) 11 113 96 108 13 SNAEYDLKAIPGD 81.3
DP00725P41851Type II secretion system protein M (T2SS protein M) (Cholera toxin secretion protein EpsM) (General secretion pathway protein M) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) 44 85 59 75 17 QLLSWVSENANDIVTLR 82.81
DP00728P00760Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2 Bos taurus (Bovine) 4 47 4 16 13 FIFLALLGAAVAF 86.62
DP00728P00760Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2 Bos taurus (Bovine) 4 47 33 42 10 NTVPYQVSLN 84.41
DP00728P00760Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2 Bos taurus (Bovine) 68 89 74 84 11 GEDNINVVEGN 88.42
DP00742Q99LM3Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM) Mus musculus (Mouse) 1 341 69 75 7 GEASILD 85.95
DP00742Q99LM3Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM) Mus musculus (Mouse) 1 341 172 180 9 VTVNEAETE 81.27
DP00748P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 238 293 239 252 14 YARVIQKRVPNAYD 80.41
DP00748P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 238 293 255 278 24 ALALEVGELVKVTKINVSGQWEGE 81.58
DP00749Q9TY14Apical membrane antigen 1 (Fragment) Plasmodium vivax 413 445 420 434 15 NQVVIKEEFRNYYEN 90.86
DP00752E6PBU940S ribosomal protein rpS31e Tetrahymena thermophila 1 71 10 32 23 GETKIYTLEQGTSVLDLKSQISQ 80.27
DP00752E6PBU940S ribosomal protein rpS31e Tetrahymena thermophila 1 71 34 40 7 MGFEIDM 88.29
DP00752E6PBU940S ribosomal protein rpS31e Tetrahymena thermophila 1 71 45 52 8 NNGFIAPN 88.29
DP00752E6PBU940S ribosomal protein rpS31e Tetrahymena thermophila 1 71 58 66 9 DDVTYYLSL 85.99
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 1 81 12 24 13 EQQEYKEAFQLFD 92.38
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 1 81 68 76 9 DQETFLTIM 91.49
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 82 150 91 97 7 KAFEIFD 97.75
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 82 150 100 108 9 KNGYISASE 87.29
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 82 150 110 116 7 KHVLTTL 80.27
DP00753C4M0U8Calmodulin; putative Entamoeba histolytica 82 150 135 145 11 EEGLINVDDFV 90.24
DP00756Q04884Opacity protein opA60 (Fragment) Neisseria gonorrhoeae 18 52 39 47 9 TVSDYFRNI 83.98
DP00756Q04884Opacity protein opA60 (Fragment) Neisseria gonorrhoeae 75 114 78 92 15 NNNKYSVNIENVRIR 82.99
DP00756Q04884Opacity protein opA60 (Fragment) Neisseria gonorrhoeae 145 188 167 175 9 GAVTTYNTD 91.45
DP00759P80220TSC22 domain family protein 3 (DSIP-immunoreactive peptide) (DIP protein) (Delta sleep-inducing peptide immunoreactor) (Glucocorticoid-induced leucine zipper protein) Sus scrofa (Pig) 48 77 48 57 10 QLEKFQSRLS 86.62
DP00765O00585C-C motif chemokine 21 (6Ckine) (Beta-chemokine exodus-2) (Secondary lymphoid-tissue chemokine) (SLC) (Small-inducible cytokine A21) Homo sapiens (Human) 71 111 83 91 9 VQQLMQHLD 80.27
DP00768Q28181Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) Bos taurus (Bovine) 117 166 121 131 11 PSQNIAAGLES 80.94
DP00768Q28181Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) Bos taurus (Bovine) 117 166 137 143 7 GAQILGQ 82.61
DP00768Q28181Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) Bos taurus (Bovine) 272 590 288 296 9 DVQTISILP 85.25
DP00768Q28181Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) Bos taurus (Bovine) 272 590 466 475 10 HSVLLDSYLV 84.28
DP00768Q28181Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) Bos taurus (Bovine) 272 590 505 513 9 GAQALSEES 80.56
DP00771P20435DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 71 4 30 27 YEEAFNDGNENFEDFDVEHFSDEETYE 87.32
DP00771P20435DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 71 44 52 9 NGKTIVTGG 80.27
DP00774P40719Sensor protein QseC (EC 2.7.13.3) Escherichia coli (strain K12) 35 158 40 52 13 VDELFDTQLMLFA 92.33
DP00774P40719Sensor protein QseC (EC 2.7.13.3) Escherichia coli (strain K12) 35 158 59 66 8 DLNEINAA 91.97
DP00774P40719Sensor protein QseC (EC 2.7.13.3) Escherichia coli (strain K12) 35 158 84 94 11 DALTFAIFTHD 96.02
DP00774P40719Sensor protein QseC (EC 2.7.13.3) Escherichia coli (strain K12) 35 158 146 152 7 GQEWEYR 90.16
DP00774P40719Sensor protein QseC (EC 2.7.13.3) Escherichia coli (strain K12) 386 417 396 404 9 ALARIGERF 80.27
DP00775P15311Ezrin (Cytovillin) (Villin-2) (p81) Homo sapiens (Human) 130 150 130 141 12 VQAKFGDYNKEV 81.86
DP00775P15311Ezrin (Cytovillin) (Villin-2) (p81) Homo sapiens (Human) 298 515 372 378 7 ALQLEEE 80.6
DP00775P15311Ezrin (Cytovillin) (Villin-2) (p81) Homo sapiens (Human) 298 515 420 434 15 ELAEYTAKIALLEEA 85.15
DP00775P15311Ezrin (Cytovillin) (Villin-2) (p81) Homo sapiens (Human) 506 586 529 540 12 RQLLTLSSELSQ 80.94
DP00778P46670Tubulin-specific chaperone C (Chromosome instability protein 2) (Tubulin-folding cofactor C) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 220 245 225 240 16 RDHLIIQDFSNPFQSE 82.07
DP00783P10279Major prion protein (PrP) (Major scrapie-associated fibril protein 1) (CD antigen CD230) Bos taurus (Bovine) 23 121 32 42 11 GGWNTGGSRYP 80.94
DP00787B2LME8Alginase Pseudoalteromonas sp. SM0524 32 155 42 61 20 GFSNWNETDPAAISSDAYSG 96.99
DP00787B2LME8Alginase Pseudoalteromonas sp. SM0524 32 155 83 95 13 NTEYTLSAYVLGK 91.38
DP00787B2LME8Alginase Pseudoalteromonas sp. SM0524 32 155 103 119 17 LNGLFKNQTFNVSSWTK 87.21
DP00787B2LME8Alginase Pseudoalteromonas sp. SM0524 32 155 131 150 20 SLQVFAKHYNNTSDVRFDNF 86.45
DP00790P08245Uncharacterized protein YciH Escherichia coli (strain K12) 1 31 7 14 8 RLVYSTET 85.28
DP00791P9WHJ5RNA polymerase-binding protein RbpA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 26 12 19 8 GAVSYETD 82.15
DP00791P9WHJ5RNA polymerase-binding protein RbpA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 25 12 19 8 GAVSYETD 82.15
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 135 143 9 EAQVFMPIS 81.12
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 175 188 14 LTFTTATFAATKFG 85.67
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 218 231 14 KQKAISSSMHSLYG 85.62
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 271 278 8 AKEFIFPN 91.51
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 117 345 303 340 38 YSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQ 87.86
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 345 175 188 14 LTFTTATFAATKFG 85.67
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 345 218 231 14 KQKAISSSMHSLYG 85.62
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 345 271 278 8 AKEFIFPN 91.51
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 345 303 340 38 YSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQ 87.86
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 285 175 188 14 LTFTTATFAATKFG 85.67
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 285 218 231 14 KQKAISSSMHSLYG 85.62
DP00794P50616Protein Tob1 (Transducer of erbB-2 1) Homo sapiens (Human) 147 285 271 278 8 AKEFIFPN 91.51
DP00796P15382Potassium voltage-gated channel subfamily E member 1 (Delayed rectifier potassium channel subunit IsK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel) Homo sapiens (Human) 107 129 111 117 7 NHLAIEQ 87.29
DP00797O15273Telethonin (Titin cap protein) Homo sapiens (Human) 91 167 113 123 11 LQELLALETAL 86.96
DP00797O15273Telethonin (Titin cap protein) Homo sapiens (Human) 91 167 132 138 7 EVAEITK 82.94
DP00798O14214tRNA (guanine(9)-N1)-methyltransferase (EC 2.1.1.221) (tRNA methyltransferase 10) (tRNA(m1G9)-methyltransferase) (tRNA(m1G9)MTase) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 83 42 48 7 RQQEWDA 80.6
DP00798O14214tRNA (guanine(9)-N1)-methyltransferase (EC 2.1.1.221) (tRNA methyltransferase 10) (tRNA(m1G9)-methyltransferase) (tRNA(m1G9)MTase) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 271 304 279 288 10 SDESFDVSED 80.27
DP00806A1B8N7ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) Paracoccus denitrificans (strain Pd 1222) 116 188 118 128 11 ADVVSAQALTD 85.04
DP00806A1B8N7ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) Paracoccus denitrificans (strain Pd 1222) 116 188 153 174 22 DESLIGGMIVKLGSQMIDSSIR 84.46
DP00808P24937Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 51 2 10 9 EDINFASLA 91.97
DP00808P24937Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 51 18 46 29 FMGNWQDIGTSNMSGGAFSWGSLWSGIKN 82.45
DP00808P24937Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 158 250 225 237 13 ASGNWQSTLNSIV 86.29
DP00809P80870General stress protein 13 (GSP13) Bacillus subtilis (strain 168) 81 130 106 112 7 QGFNTLK 82.61
DP00809P80870General stress protein 13 (GSP13) Bacillus subtilis (strain 168) 81 130 115 123 9 LEEWIEMSN 86.03
DP00814P01252Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1 Bos taurus (Bovine) 1 110 8 14 7 TSSEITT 80.94
DP00815Q9DCL8Protein phosphatase inhibitor 2 (IPP-2) Mus musculus (Mouse) 1 206 49 58 10 DEMNILATYH 85.55
DP00815Q9DCL8Protein phosphatase inhibitor 2 (IPP-2) Mus musculus (Mouse) 1 206 145 164 20 RKLHYNEGLNIKLARQLISK 84.6
DP00816P41236Protein phosphatase inhibitor 2 (IPP-2) Homo sapiens (Human) 9 164 48 57 10 DEMNILATYH 85.55
DP00816P41236Protein phosphatase inhibitor 2 (IPP-2) Homo sapiens (Human) 9 164 144 159 16 RKLHYNEGLNIKLARQ 82.84
DP00823N1NXA6SAGA-associated factor 11 "Saccharomyces cerevisiae (strain CEN.PK113-7D) (Bakers yeast)" 64 99 67 73 7 SSQYIHC 84.28
DP00824Q9NJS1Salivary anti-thrombin peptide anophelin Anopheles albimanus (New world malaria mosquito) 23 83 55 71 17 DYAAIEASLSETFNTAA 81.64
DP00824Q9NJS1Salivary anti-thrombin peptide anophelin Anopheles albimanus (New world malaria mosquito) 54 83 55 71 17 DYAAIEASLSETFNTAA 81.64
DP00824Q9NJS1Salivary anti-thrombin peptide anophelin Anopheles albimanus (New world malaria mosquito) 56 83 56 71 16 YAAIEASLSETFNTAA 81.29
DP00827O31467Sec-independent protein translocase protein TatAd Bacillus subtilis (strain 168) 49 70 57 63 7 SAELTAV 80.27
DP00833P22995Antitoxin ParD Escherichia coli 38 83 42 58 17 ADQAWQELKTMLGNRIN 85.46
DP00833P22995Antitoxin ParD Escherichia coli 38 83 69 78 10 SVGEILDEEL 84.28
DP00833P22995Antitoxin ParD Escherichia coli 50 83 69 78 10 SVGEILDEEL 84.28
DP00833P22995Antitoxin ParD Escherichia coli 58 83 69 78 10 SVGEILDEEL 84.28
DP00835Q03337Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 54 20 26 7 DGYEYTV 87.2
DP00835Q03337Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 54 29 49 21 KQAITSEASTTYIPSRIYSES 81.05
DP00835Q03337Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 104 164 115 126 12 RASAFLSQNESS 85.34
DP00836P01139Beta-nerve growth factor (Beta-NGF) Mus musculus (Mouse) 19 128 66 72 7 QTRNITV 80.94
DP00836P01139Beta-nerve growth factor (Beta-NGF) Mus musculus (Mouse) 19 128 85 92 8 PRVLFSTQ 80.35
DP00839Q16186Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog) Homo sapiens (Human) 132 252 156 173 18 LQSLLGNMSHSQLMQLIG 84.62
DP00839Q16186Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog) Homo sapiens (Human) 253 285 266 275 10 DLQSILATMN 82.68
DP00840P46065Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A) Bos taurus (Bovine) 74 108 91 100 10 KLRWYFKLYD 91.14
DP00842P12506Protein Tat (Transactivating regulatory protein) Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) (HIV-1) 1 86 34 48 15 CQVCFITKGLGISYG 82.68
DP00847P20220Protein F-112 Sulfolobus spindle-shape virus 1 (SSV1) 74 112 85 94 10 TQDNIAKIFD 86.96
DP00848Q49ZM2Putative secretory antigen Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) 1 49 14 22 9 IGAAIVGLD 87.29
DP00848Q49ZM2Putative secretory antigen Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) 1 49 37 44 8 NQSTTQST 80.27
DP00849Q9Q8E9M156R Myxoma virus (strain Lausanne) (MYXV) 1 32 19 27 9 KVNTYRTSA 85.95
DP00850P36932Integrase (EC 2.7.7.-) (EC 3.1.-.-) Escherichia phage P2 (Bacteriophage P2) 46 161 64 71 8 LTQIWWDL 86.41
DP00850P36932Integrase (EC 2.7.7.-) (EC 3.1.-.-) Escherichia phage P2 (Bacteriophage P2) 46 161 82 94 13 NLGKIEIFTKITN 85.46
DP00850P36932Integrase (EC 2.7.7.-) (EC 3.1.-.-) Escherichia phage P2 (Bacteriophage P2) 46 161 97 113 17 CAFQITKSLISQYCATR 86.58
DP00850P36932Integrase (EC 2.7.7.-) (EC 3.1.-.-) Escherichia phage P2 (Bacteriophage P2) 46 161 134 146 13 FTALIEAELFFGE 88.37
DP00851Q9KX51PmoC Methylosinus trichosporium 177 256 179 195 17 FSLAFLIVAIGPFMIIP 87.35
DP00851Q9KX51PmoC Methylosinus trichosporium 177 256 198 241 44 GLNEWGHTFWFMEELFVAPLHWGFVFFGWMALGVFGVVLQILMG 87.31
DP00853P00127Cytochrome b-c1 complex subunit 6; mitochondrial (Complex III subunit 6) (Complex III subunit VI) (Cytochrome c1 non-heme 17 kDa protein) (Mitochondrial hinge protein) (Ubiquinol-cytochrome c oxidoreductase subunit 6) (Ubiquinol-cytochrome c reductase 17 kDa protein) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 72 6 18 13 LVGEYWEQLKITV 84.72
DP00863Q9X0Q3Transcriptional regulator; crp family Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) 130 201 134 140 7 KLMNFLV 81.41
DP00866O54465Hypothetical mobile element-associated protein (Pathogenicity island protein) Staphylococcus aureus 42 72 60 67 8 TLQNLAKQ 85.12
DP00869F2Z293Chlorophyll a-b binding protein; chloroplastic Spinacia oleracea (Spinach) 1 87 44 51 8 EYLQYDYD 81.44
DP00869F2Z293Chlorophyll a-b binding protein; chloroplastic Spinacia oleracea (Spinach) 1 87 53 68 16 LDQNLAKNLAGDIIGT 83.61
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 363 565 379 392 14 VARLFSLFGCQEED 94.39
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 363 565 402 422 21 LALALAHAGELEALQALMELG 82.99
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 363 565 514 520 7 GLQAWGQ 87.29
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 364 565 379 392 14 VARLFSLFGCQEED 94.39
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 364 565 402 422 21 LALALAHAGELEALQALMELG 82.99
DP00870H0W0T5Asparaginase (EC 3.5.1.1) Cavia porcellus (Guinea pig) 364 565 514 520 7 GLQAWGQ 87.29
DP00871A4ZNR2Nuclear export protein (NEP) (Non-structural protein 2) (NS2) Influenza A virus (A/lvPR8/34(H1N1)) 1 121 5 16 12 TVSSFQDILLRM 81.94
DP00871A4ZNR2Nuclear export protein (NEP) (Non-structural protein 2) (NS2) Influenza A virus (A/lvPR8/34(H1N1)) 1 121 33 42 10 TQFESLKLYR 81.34
DP00871A4ZNR2Nuclear export protein (NEP) (Non-structural protein 2) (NS2) Influenza A virus (A/lvPR8/34(H1N1)) 1 121 69 83 15 LGQKFEEIRWLIEEV 87.85
DP00871A4ZNR2Nuclear export protein (NEP) (Non-structural protein 2) (NS2) Influenza A virus (A/lvPR8/34(H1N1)) 1 121 90 116 27 TENSFEQITFMQALHLLLEVEQEIRTF 85.52
DP00872P80428Actin-related protein 4 (Actin-like protein ARP4) (Actin-like protein 4) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 199 226 203 211 9 IIPLFAIKQ 85.69
DP00873Q9H981Actin-related protein 8 (hArp8) (INO80 complex subunit N) Homo sapiens (Human) 401 507 420 429 10 HDEHYLLATQ 84.15
DP00874Q12406Actin-related protein 7 (Actin-like protein ARP7) (Chromatin structure-remodeling complex protein ARP7) (SWI/SNF complex component ARP7) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 353 379 359 367 9 GTSHINTNV 89.97
DP00875P69723Virion infectivity factor (Vif) (SOR protein) Cleaved into: p17; p7 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 141 192 143 156 14 GSLQYLALAALITP 82.27
DP00876P14340Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5) Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2) 1 100 49 60 12 ALVAFLRFLTIP 88.66
DP00878G8HXD9NepR Sphingomonas sp. Fr1 28 56 32 44 13 LRSAYQKTIEEQV 82.94
DP00884P50106DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 101 137 110 116 7 IQVSTTE 80.27
DP00884P50106DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 102 137 110 116 7 IQVSTTE 80.27
DP00889P9WF19Putative antitoxin VapB5 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 45 24 30 7 EDVTITV 93.65
DP00892O31818UPF0291 protein YnzC Bacillus subtilis (strain 168) 41 77 50 56 7 KSVKIID 85.14
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 1 10 10 MLDFFTIFSK 91.54
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 12 23 12 GLVLWCFQGVSD 91.36
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 29 40 12 VNALIRSVLLQE 85.28
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 43 57 15 GNNSFTHEALTLKYK 80.6
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 60 84 25 NQFELVFVVGFQKILTLTYVDKLID 89.95
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 100 121 22 QQSALSLLNGTFDFQNDFLRLL 81.79
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 214 220 7 REEFIQK 87.29
DP00893P08240Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) Homo sapiens (Human) 1 331 303 309 7 AAQNSTK 82.94
DP00895P03421Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain A2) 1 102 20 29 10 FLESIKGKFT 80.27
DP00895P03421Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain A2) 1 102 37 50 14 KDSIISVNSIDIEV 87.36
DP00895P03421Phosphoprotein (Protein P) Human respiratory syncytial virus A (strain A2) 1 102 58 64 7 SNSTIIN 87.67
DP00896P10121Signal recognition particle receptor FtsY (SRP receptor) Escherichia coli (strain K12) 1 187 8 15 8 GFFSWLGF 87.88
DP00896P10121Signal recognition particle receptor FtsY (SRP receptor) Escherichia coli (strain K12) 1 187 63 81 19 EAETFAADVVEVTEQVAES 83.47
DP00896P10121Signal recognition particle receptor FtsY (SRP receptor) Escherichia coli (strain K12) 1 187 133 145 13 ETVEIVEAAEEEA 91.97
DP00898P13338RNA polymerase-associated protein Gp33 Enterobacteria phage T4 (Bacteriophage T4) 1 31 2 10 9 TQFSLNDIR 86.62
DP00902O32728RNA polymerase sigma factor Geobacillus stearothermophilus (Bacillus stearothermophilus) 1 101 32 38 7 RDEIIEK 89.97
DP00902O32728RNA polymerase sigma factor Geobacillus stearothermophilus (Bacillus stearothermophilus) 1 101 41 52 12 RLVWSVVQRFLN 85.67
DP00902O32728RNA polymerase sigma factor Geobacillus stearothermophilus (Bacillus stearothermophilus) 1 101 57 96 40 ADDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQ 88.48
DP00902O32728RNA polymerase sigma factor Geobacillus stearothermophilus (Bacillus stearothermophilus) 159 250 185 193 9 EASWFDKIA 85.95
DP00902O32728RNA polymerase sigma factor Geobacillus stearothermophilus (Bacillus stearothermophilus) 159 250 204 215 12 RERLIVYLRYYR 86.85
DP00904Q58876Uncharacterized protein MJ1481 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 104 213 109 122 14 EGALYIVSNKKLFK 97.52
DP00904Q58876Uncharacterized protein MJ1481 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 104 213 169 187 19 VERFIEKYKPEKIFVVVED 85.99
DP00904Q58876Uncharacterized protein MJ1481 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) 104 213 189 208 20 KDELLYLRAKNLYNAEKLDA 92.49
DP00910P41567Eukaryotic translation initiation factor 1 (eIF1) (A121) (Protein translation factor SUI1 homolog) (Sui1iso1) Homo sapiens (Human) 1 28 3 11 9 AIQNLHSFD 80.27
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 44 69 26 NLVPFMNFARITSATGATCEGVIKYM 87.2
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 131 151 21 SLTTYAGYKALMQIQSWLEIR 85.7
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 155 184 30 EPVAIVGYPGSICLALSRLLLAHGFSLHLL 86.69
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 219 234 16 RCKLFAAATSAGGVID 80.27
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 241 250 10 GSIFIDVALP 81.17
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 262 268 7 DDILIID 95.7
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 285 307 23 LNVTIKQQLNGCMAETIVLALEN 86.16
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 322 330 9 KVLEIGEIA 86.96
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 332 348 17 RHGFFAYPLASYGERID 95.32
DP00913A0A0J9X1Q5Aminotransferase PigE (EC 2.6.1.-) Serratia sp. (strain FS14) 1 371 360 366 7 HHDIYAG 84.62
DP00915Q5JH72PCNA-inhibitor (Thermococcales inhibitor of PCNA) (TIP) Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) 1 27 5 11 7 LDEFIGD 91.97
DP00918A0MHA3Patellamide protein uncultured Prochloron sp. 36 64 44 53 10 TACITFCAYD 93.68
DP00922P67966Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1) Gallus gallus (Chicken) 67 115 88 94 7 LGIKYEE 80.94
DP00926Q9BQB4Sclerostin Homo sapiens (Human) 25 79 25 38 14 GWQAFKNDATEIIP 85.05
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 1 72 16 36 21 LLKAYDVNISGLVSTTMQNEA 86.32
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 1 72 55 67 13 VARFIEMNGSFAD 80.73
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 32 72 55 67 13 VARFIEMNGSFAD 80.73
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 37 72 55 67 13 VARFIEMNGSFAD 80.73
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 41 72 55 67 13 VARFIEMNGSFAD 80.73
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 46 72 55 67 13 VARFIEMNGSFAD 80.73
DP00928P62552Antitoxin CcdA (LynA) (Protein H) (Protein LetA) Escherichia coli (strain K12) 46 71 55 66 12 VARFIEMNGSFA 80.77
DP00929P04608Protein Tat (Transactivating regulatory protein) Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 1 86 34 48 15 CQVCFITKALGISYG 82.81
DP00934P61925cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform) Homo sapiens (Human) 1 76 2 15 14 TDVETTYADFIASG 82.75
DP00937Q12972Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1) Homo sapiens (Human) 144 225 163 172 10 LDNLTEFNTA 85.82
DP00937Q12972Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1) Homo sapiens (Human) 144 225 178 190 13 STLTIEEGNLDIQ 85.95
DP00937Q12972Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1) Homo sapiens (Human) 144 225 199 211 13 SRVTFSEDDEIIN 91.1
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 332 13 21 9 TDFLEEWKA 81.94
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 332 51 63 13 LAQTTAAGTSELN 80.27
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 332 156 171 16 GVVNIPAAECLDEYED 96.32
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 332 186 197 12 TQQNTIQNEAAS 85.7
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 332 226 233 8 EEEILNRY 80.27
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 332 250 259 10 APANFASSST 81.54
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 290 13 21 9 TDFLEEWKA 81.94
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 290 51 63 13 LAQTTAAGTSELN 80.27
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 290 156 171 16 GVVNIPAAECLDEYED 96.32
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 290 186 197 12 TQQNTIQNEAAS 85.7
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 290 226 233 8 EEEILNRY 80.27
DP00940Q62627PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Rattus norvegicus (Rat) 1 290 250 259 10 APANFASSST 81.54
DP00943O35274Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130) Rattus norvegicus (Rat) 1 154 19 29 11 HRSAYEAGIQA 80.27
DP00943O35274Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130) Rattus norvegicus (Rat) 417 494 455 468 14 PIQVFSTYSNEDYD 94.05
DP00943O35274Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130) Rattus norvegicus (Rat) 417 494 479 487 9 ASAEYELEK 82.94
DP00944P1273650S ribosomal protein L32e (Hl5) Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) 1 94 10 19 10 AEEEYTELTD 90.64
DP00947O10609Protein E7 Human papillomavirus 45 1 41 7 16 10 TLQEIVLHLE 94.31
DP00947O10609Protein E7 Human papillomavirus 45 1 41 25 36 12 DLLCYEQLSESE 80.3
DP00947O10609Protein E7 Human papillomavirus 45 72 106 72 81 10 RIELTVESSA 80.94
DP00947O10609Protein E7 Human papillomavirus 45 72 106 87 98 12 LQQLFLSTLSFV 86.06
DP00948P59595Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) Severe acute respiratory syndrome coronavirus (SARS-CoV) 182 247 219 226 8 ALALLLLD 86.62
DP00948P59595Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) Severe acute respiratory syndrome coronavirus (SARS-CoV) 343 402 348 364 17 KDNVILLNKHIDAYKTF 83.69
DP00948P59595Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) Severe acute respiratory syndrome coronavirus (SARS-CoV) 366 422 407 413 7 QLQNSMS 84.62
DP00949Q9HAU5Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) Homo sapiens (Human) 430 486 463 481 19 DARNFYENLIDLKAFVPAI 84.53
DP00949Q9HAU5Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) Homo sapiens (Human) 1167 1207 1181 1187 7 QQFKILN 82.61
DP00949Q9HAU5Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) Homo sapiens (Human) 1167 1207 1195 1202 8 AANHWNQQ 88.29
DP00951P17677Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46) Homo sapiens (Human) 1 238 34 47 14 AATKIQASFRGHIT 80.34
DP00951P17677Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46) Homo sapiens (Human) 1 238 205 211 7 AEENIEA 91.97
DP00953Q9H832Ubiquitin-conjugating enzyme E2 Z (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme Z) (Uba6-specific E2 conjugating enzyme 1) (Use1) (Ubiquitin carrier protein Z) (Ubiquitin-protein ligase Z) Homo sapiens (Human) 1 99 76 84 9 GAALLSHWD 80.82
DP00955P06836Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43) Bos taurus (Bovine) 1 242 34 47 14 AATKIQASFRGHIT 80.34
DP00957C0J347SBDS-like protein Trypanosoma cruzi 264 464 331 341 11 QTVTTAELSST 80.27
DP00957C0J347SBDS-like protein Trypanosoma cruzi 264 464 438 445 8 RNEYWNDA 85.28
DP00958P46984EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 123 61 87 27 GSQLTYLGQLRTQLTGLQDDINEFLTG 92.53
DP00958P46984EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 123 105 115 11 IQEEINQLLDG 93.98
DP00958P46984EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 65 113 80 87 8 DINEFLTG 87.04
DP00959O15169Axin-1 (Axis inhibition protein 1) (hAxin) Homo sapiens (Human) 295 500 301 313 13 VNPYYVNAGYALA 85.28
DP00961P52630Signal transducer and activator of transcription 2 (p113) Homo sapiens (Human) 817 838 824 833 10 AGQNTVDEVY 87.29
DP00968Q60795Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2) Mus musculus (Mouse) 1 98 20 26 7 IDILWRQ 82.27
DP00968Q60795Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2) Mus musculus (Mouse) 1 98 66 87 22 QEKAFFAQFQLDEETGEFLPIQ 82.72
DP00970P0ABD8Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) Escherichia coli (strain K12) 1 77 19 25 7 SELEISE 87.29
DP00970P0ABD8Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) Escherichia coli (strain K12) 1 77 44 50 7 MQQAYAA 97.66
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 10 16 7 RSSWYWG 87.58
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 22 29 8 EAVALLQG 80.89
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 32 39 8 HGVFLVRD 85.28
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 46 54 9 DYVLSVSEN 87.96
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 56 64 9 RVSHYIINS 86.47
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 99 117 19 ALLEFYKIHYLDTTTLIEP 82.77
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 124 146 23 GSGVILRQEEAEYVRALFDFNGN 85.62
DP00973P46108Adapter molecule crk (Proto-oncogene c-Crk) (p38) Homo sapiens (Human) 1 204 166 173 8 EEQWWNAE 85.54
DP00976P04578Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 127 196 155 165 11 KNCSFNISTSI 83.06
DP00976P04578Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 127 196 169 185 17 VQKEYAFFYKLDIIPID 87.9
DP00976P04578Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) 297 331 316 324 9 AFVTIGKIG 87.85
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 34 41 8 WVTVYYGV 96.53
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 48 71 24 TTTLFCASDAKAYDTEVHNVWATH 80.94
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 88 112 25 VTENFNMWKNNMVEQMHEDIISLWD 91.57
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 124 131 8 LCVTLNCT 86.96
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 153 163 11 KNCSFNITTSI 85.68
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 167 199 33 VQKEYALFYNLDVVPIDNASYRLISCNTSVITQ 86.77
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 217 230 14 AGFAILKCNDKKFN 81.58
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 253 260 8 TQLLLNGS 89.97
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 262 293 32 AEEEIVIRSENFTNNAKTIIVQLNESVVINCT 86.06
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 308 320 13 GRALYTTGEIIGD 87.11
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 330 344 15 KTQWENTLEQIAIKL 84.26
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 351 359 9 NKTIIFNPS 92.98
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 374 391 18 GGEFFYCNSTQLFTWNDT 90.32
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 397 403 7 TGRNITL 80.27
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 407 417 11 IKQIINMWQEV 83.46
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 432 441 10 CSSNITGLLL 80.27
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 33 498 467 479 13 RSELYKYKVVKIE 85.16
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 127 193 153 163 11 KNCSFNITTSI 85.68
DP00978P35961Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) 127 193 167 188 22 VQKEYALFYNLDVVPIDNASYR 87.75
DP00980P36595DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (DNA-directed RNA polymerases I; II; and III 15 kDa polypeptide) (RPC16) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 59 45 54 10 TTVITEDVAS 83.95
DP00984P12357Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) Spinacia oleracea (Spinach) 70 164 74 99 26 SLVISLSTGLSLFLGRFVFFNFQREN 93.31
DP00984P12357Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) Spinacia oleracea (Spinach) 70 164 133 159 27 VGFNIVDVLAWGSIGHIVAYYILATAS 89.06
DP00984P12357Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) Spinacia oleracea (Spinach) 73 167 74 99 26 SLVISLSTGLSLFLGRFVFFNFQREN 93.31
DP00984P12357Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) Spinacia oleracea (Spinach) 73 167 133 162 30 VGFNIVDVLAWGSIGHIVAYYILATASNGY 88.68
DP00985Q87WW0Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) (SAT) Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) 217 305 219 236 18 NGTLIMIDDERILEHLTD 86.99
DP00985Q87WW0Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) (SAT) Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) 217 305 268 279 12 LTDIIQEMLLTR 82.61
DP00986Q8QWD4VP4 (Fragment) Human enterovirus D68 (EV68) (EV-68) 2 29 14 24 11 ENANIATNGSH 84.16
DP00990P12355Photosystem I reaction center subunit III; chloroplastic (Light-harvesting complex I 17 kDa protein) (PSI-F) Spinacia oleracea (Spinach) 1 77 1 11 11 MSFTIPTNLYK 86.29
DP00990P12355Photosystem I reaction center subunit III; chloroplastic (Light-harvesting complex I 17 kDa protein) (PSI-F) Spinacia oleracea (Spinach) 1 77 56 70 15 AALALSSVLLSSWSV 80.56
DP00992P27356Methane monooxygenase regulatory protein B Methylosinus trichosporium 1 35 4 14 11 AHNAYNAGIMQ 94.31
DP00992P27356Methane monooxygenase regulatory protein B Methylosinus trichosporium 1 35 21 30 10 ADEFFAEENQ 96.32
DP00993Q9I332Translocation protein in type III secretion Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) 1 253 25 35 11 RAQQIAFEQAL 89.91
DP00993Q9I332Translocation protein in type III secretion Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) 20 40 25 35 11 RAQQIAFEQAL 89.91
DP00994P39015Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 142 168 146 163 18 TAQLSLQDYLNQQANNQF 80.82
DP00994P39015Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 177 273 205 223 19 EYLEFDATFVESNTRKNFG 88.17
DP00994P39015Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 177 273 248 258 11 TANATNSANTV 80.6
DP00994P39015Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 273 205 223 19 EYLEFDATFVESNTRKNFG 88.17
DP00994P39015Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 273 248 258 11 TANATNSANTV 80.6
DP00997P0A4T9HTH-type transcriptional activator TipA Streptomyces lividans 111 159 119 127 9 KFEVFGDFD 87.29
DP00998Q05127Polymerase cofactor VP35 (Ebola VP35) (eVP35) Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) 20 48 25 35 11 LSGWISEQLMT 90.97
DP00999P03315Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Semliki forest virus (SFV) 119 260 198 210 13 GAVQYSGGRFTIP 83.02
DP00999P03315Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Semliki forest virus (SFV) 119 260 229 237 9 RVVAIVLGG 96.32
DP00999P03315Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) Semliki forest virus (SFV) 119 260 247 255 9 SVVTWNKDM 91.97
DP01009P97303Transcription regulator protein BACH2 (BTB and CNC homolog 2) Mus musculus (Mouse) 331 520 340 354 15 LRSLFGITKGVESTG 83.34
DP01009P97303Transcription regulator protein BACH2 (BTB and CNC homolog 2) Mus musculus (Mouse) 331 520 428 436 9 RSVIFSASA 84.17
DP01009P97303Transcription regulator protein BACH2 (BTB and CNC homolog 2) Mus musculus (Mouse) 331 520 475 483 9 SSQAYSHSG 87.29
DP01011P68390Ovomucoid Meleagris gallopavo (Wild turkey) 1 65 41 55 15 LLCAYNIEYGTNISK 86.53
DP01014O9474226S proteasome complex subunit SEM1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 89 55 65 11 TQTNIWEENWD 86.23
DP01015Q83AR4Elongation factor P (EF-P) Coxiella burnetii (strain RSA 493 / Nine Mile phase I) 132 188 166 176 11 LFLNEGEIIKV 80.97
DP01025P02619Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2) Esox lucius (Northern pike) 1 107 25 32 8 HKEFFAKV 82.94
DP01025P02619Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2) Esox lucius (Northern pike) 1 107 43 51 9 KKAFYVIDQ 94.17
DP01025P02619Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2) Esox lucius (Northern pike) 1 107 53 71 19 KSGFIEEDELKLFLQNFSP 86.69
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2131 2145 15 AVAHILGIRDVASIN 89.23
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2214 2228 15 QQATLNLSTLLVNPE 80.33
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2285 2295 11 SLASYYIECIR 92.58
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2306 2319 14 AGYSYGACVAFEMC 91.3
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2332 2351 20 NHSLFLFDGSHTFVLAYTQS 88.46
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2366 2379 14 AKAMYFFVQQFTDM 88.87
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2401 2407 7 TVDLITQ 85.43
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2415 2449 35 HALSFAARSFYQKLRAAENYWPQATYHGNVTLLRA 85.69
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2461 2467 7 ADYNLSQ 86.29
DP01026A5YV763-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) Sus scrofa (Pig) 2112 2512 2490 2501 12 GLESILSIIHSC 88.46
DP01028Q59471Diol dehydrase beta subunit (EC 4.2.1.28) Klebsiella oxytoca 1 45 8 18 11 LRQIIEDVLSE 83.46
DP01031Q99IB8Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 2a (isolate JFH-1) (HCV) 2224 2317 2231 2238 8 VDANLLME 80.27
DP01032Q06556Fibronectin binding protein Streptococcus dysgalactiae 810 969 822 830 9 QSEEITITE 85.47
DP01032Q06556Fibronectin binding protein Streptococcus dysgalactiae 810 969 855 863 9 SQEDIVLGG 80.27
DP01032Q06556Fibronectin binding protein Streptococcus dysgalactiae 810 969 865 873 9 GQVIDFTED 83.61
DP01032Q06556Fibronectin binding protein Streptococcus dysgalactiae 810 969 895 901 7 EDEVIIG 94.46
DP01032Q06556Fibronectin binding protein Streptococcus dysgalactiae 810 969 903 912 10 QGQVIDFTED 83.75
DP01032Q06556Fibronectin binding protein Streptococcus dysgalactiae 810 969 926 932 7 GTVLEED 80.27
DP01032Q06556Fibronectin binding protein Streptococcus dysgalactiae 810 969 938 944 7 EDEVIIG 94.46
DP01032Q06556Fibronectin binding protein Streptococcus dysgalactiae 810 969 946 955 10 QGQVIDFTED 83.75
DP01034P73124Ssl1911 protein Synechocystis sp. (strain PCC 6803 / Kazusa) 1 65 14 20 7 HHQFIKN 84.09
DP01034P73124Ssl1911 protein Synechocystis sp. (strain PCC 6803 / Kazusa) 1 65 29 35 7 AAAEIGV 87.29
DP01034P73124Ssl1911 protein Synechocystis sp. (strain PCC 6803 / Kazusa) 1 65 39 45 7 KDFWTTV 89.2
DP01035Q39805Dehydrin-like protein Glycine max (Soybean) (Glycine hispida) 1 226 35 43 9 ASVTYVATR 97.32
DP01035Q39805Dehydrin-like protein Glycine max (Soybean) (Glycine hispida) 1 226 126 140 15 QHGNIGGPYYGTNTA 82.27
DP01038Q9FUM5BN28a Brassica napus (Rape) 1 65 42 48 7 AGQKITE 86.96
DP01038Q9FUM5BN28a Brassica napus (Rape) 1 65 52 60 9 GAVNLVKEK 91.97
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 356 362 7 AGFEIDN 91.97
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 366 375 10 TIEEFFGSAY 84.41
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 395 402 8 FINMYGFD 87.29
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 404 413 10 TEYSFIQFVD 87.86
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 417 429 13 GAQIEENVYADIR 85.13
DP01039Q85258Polyprotein (Fragment) Potato virus Y 336 523 458 464 7 TIHAYFR 82.51
DP01040Q9FUW7Omega gliadin storage protein Triticum aestivum (Wheat) 1 280 2 17 16 KTFLIFVLLAMAMKIA 89.21
DP01040Q9FUW7Omega gliadin storage protein Triticum aestivum (Wheat) 1 280 33 45 13 PQQSFSYQQQPFP 86.39
DP01043Q80FJ1Membrane fusion protein p14 Reptilian orthoreovirus 2 31 4 12 9 GPSNFVNHA 86.96
DP01044Q47785Bacteriocin immunity protein (EntI protein) (Immunity protein for enterocin A) (Orf2 protein) (Probable immunity protein) Enterococcus faecium (Streptococcus faecium) 82 103 89 95 7 INGLYRA 80.6
DP01045Q7DB66Lipoprotein Escherichia coli O157:H7 60 85 66 76 11 FVRAITILNNN 85.53
DP01047O50835Fibronectin-binding protein BBK32 Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) 56 205 87 103 17 NKSNFLQKNVILEEESL 82.88
DP01047O50835Fibronectin-binding protein BBK32 Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) 56 205 166 196 31 SLQGIAGSNSISYTDEIEEEDYDQYYLDEYD 81.95
DP01049Q6QCC2Factor H-binding protein (Lipoprotein) (Lipoprotein GNA1870) Neisseria meningitidis 101 137 104 132 29 DGQLITLESGEFQVYKQSHSALTAFQTEQ 86.55
DP01050P0A6X3RNA-binding protein Hfq (HF-1) (Host factor-I protein) (HF-I) Escherichia coli (strain K12) 75 102 88 94 7 SAQNTSA 81.41
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 9 19 11 NQQNYQQYSQN 90.45
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 31 39 9 GYQAYNAQA 98.33
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 42 65 24 AGGYYQNYQGYSGYQQGGYQQYNP 88.18
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 69 76 8 YQQQYNPQ 92.64
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 78 85 8 GYQQYNPQ 91.97
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 88 95 8 YQQQFNPQ 91.64
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 100 118 19 NYKNFNYNNNLQGYQAGFQ 84.26
DP01051Q7LKB1ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) "Saccharomyces cerevisiae (Bakers yeast)" 1 253 216 246 31 EDLKISESTHNTNNANVTSADALIKEQEEEV 87.57
DP01054Q76LA1CSTB protein (Cystatin B) (Cystatin B (Stefin B)) (Cystatin B (Stefin B); isoform CRA_a) (Epididymis secretory sperm binding protein) (cDNA; FLJ92415; Homo sapiens cystatin B (stefin B) (CSTB); mRNA) Homo sapiens (Human) 1 67 39 57 19 KAVSFKSQVVAGTNYFIKV 85.44
DP01055Q8GT36Thylakoid soluble phosphoprotein Spinacia oleracea (Spinach) 1 103 4 20 17 LPFVFGAAASSRVVTAA 80.27
DP01055Q8GT36Thylakoid soluble phosphoprotein Spinacia oleracea (Spinach) 1 103 33 43 11 SFVDWLLGKIT 85.01
DP01055Q8GT36Thylakoid soluble phosphoprotein Spinacia oleracea (Spinach) 1 103 45 52 8 EDQFYETD 87.58
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 11 17 7 RVEVILD 86.96
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 51 59 9 PSFAISSEG 81.12
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 105 113 9 SIALLLTAA 86.58
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 135 141 7 TLVSYGT 91.97
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 161 197 37 KENTFEVSLLATSESEIDEDFFSDIDNDKKIVTFDWD 86.18
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 234 244 11 MDQITAEQEEM 86.96
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 295 306 12 NDGKIVQQNGFG 87.29
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 387 394 8 APILWSHT 80.6
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 475 481 7 EACNFMQ 91.97
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 600 606 7 GAQLFAR 97.66
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 649 657 9 PPVAYNPIH 81.94
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 701 708 8 DASLFTFQ 93.02
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 746 766 21 ASSVYSVPAYSSQPSFQSNAS 82.51
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 769 775 7 VNESYTP 81.61
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 788 794 7 TSSLFTA 87.96
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 803 813 11 KAGVIAQERSS 85.62
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 882 894 13 MQESIAANVVSAA 89.3
DP01056A7UMX5Synaptopodin 2 variant Meleagris gallopavo (Wild turkey) 1 996 950 958 9 SQQQYAYCS 94.46
DP01057Q42512Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) Arabidopsis thaliana (Mouse-ear cress) 41 139 44 51 8 KKSLIYAA 92.18
DP01057Q42512Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) Arabidopsis thaliana (Mouse-ear cress) 41 139 53 64 12 GDGNILDDLNEA 92.31
DP01057Q42512Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) Arabidopsis thaliana (Mouse-ear cress) 41 139 107 115 9 KAAAYVEEK 91.97
DP01057Q42512Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) Arabidopsis thaliana (Mouse-ear cress) 41 139 122 129 8 KAAEFAEG 86.96
DP01058Q9SIN5Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B) Arabidopsis thaliana (Mouse-ear cress) 41 139 45 65 21 KKSLIYAVKSDGNILDDLNEA 91.34
DP01058Q9SIN5Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B) Arabidopsis thaliana (Mouse-ear cress) 41 139 108 116 9 KALDYVTEK 80.27
DP01058Q9SIN5Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B) Arabidopsis thaliana (Mouse-ear cress) 41 139 123 130 8 KAAEFVEG 87.29
DP01060A8CDV5Latent membrane protein 2A (Fragment) Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) 1 118 81 88 8 DQSLYLGL 96.99
DP01060A8CDV5Latent membrane protein 2A (Fragment) Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) 1 118 107 113 7 SSQHIYE 90.16
DP01065Q9NQI0Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) Homo sapiens (Human) 1 236 13 22 10 HMSSYVPIFE 83.01
DP01065Q9NQI0Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) Homo sapiens (Human) 1 236 215 221 7 NEEVITG 81.56
DP01066Q9NQI0Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) Homo sapiens (Human) 1 204 13 22 10 HMSSYVPIFE 83.01
DP01066Q9NQI0Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) Homo sapiens (Human) 1 204 181 187 7 NEEVITG 81.56
DP01067P19599Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) Plasmodium falciparum (isolate FC27 / Papua New Guinea) 21 238 22 40 19 NESKYSNTFINNAYNMSIR 88.29
DP01067P19599Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) Plasmodium falciparum (isolate FC27 / Papua New Guinea) 21 238 129 135 7 ATESISP 85.62
DP01068Q9UBB5Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) Homo sapiens (Human) 238 356 247 253 7 QTASIFK 89.78
DP01068Q9UBB5Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) Homo sapiens (Human) 238 356 279 285 7 RQLFWEK 85.48
DP01068Q9UBB5Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) Homo sapiens (Human) 238 356 287 303 17 LQGLSASDVTEQIIKTM 85.78
DP01068Q9UBB5Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) Homo sapiens (Human) 238 356 323 333 11 SAVASALHTSS 80.6
DP01069Q6MRH6Hit locus orf4 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) 1 101 4 19 16 LLVLSILLTLGFSFAG 87.29
DP01070P42568Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3) Homo sapiens (Human) 490 568 522 546 25 ILQQIVNLIEETGHFHITNTTFDFD 86.93
DP01070P42568Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3) Homo sapiens (Human) 490 568 557 563 7 KLQSYLE 86
DP01071O23764CDet11-24 protein Craterostigma plantagineum (Blue gem) (Torenia plantagineum) 1 422 56 63 8 NDEEINTS 92.31
DP01071O23764CDet11-24 protein Craterostigma plantagineum (Blue gem) (Torenia plantagineum) 1 422 160 166 7 KGVNYGG 92.98
DP01071O23764CDet11-24 protein Craterostigma plantagineum (Blue gem) (Torenia plantagineum) 1 422 176 182 7 EHQTISD 85.28
DP01071O23764CDet11-24 protein Craterostigma plantagineum (Blue gem) (Torenia plantagineum) 1 422 274 292 19 TAAEYKNLVAEKLTPVYEK 83.95
DP01071O23764CDet11-24 protein Craterostigma plantagineum (Blue gem) (Torenia plantagineum) 1 422 353 359 7 LSQAIME 90.97
DP01073Q61548Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) (Phosphoprotein F1-20) Mus musculus (Mouse) 623 680 636 645 10 VIDLFGDAFG 86.62
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 335 341 7 GFDFIKD 85.95
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 382 388 7 LSFNFSQ 82.47
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 402 410 9 STTLFNFGG 94.95
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 444 451 8 TAPIFSFG 80.94
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 531 538 8 ADVTSNID 90.72
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 540 546 7 SAQFTFG 95.8
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 569 583 15 PTFTFGQSTSENKIS 81.74
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 655 665 11 PSFTFASSKTS 80.94
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 687 693 7 TSFSFTK 86.62
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 751 761 11 NGFSFTKFNHN 84.55
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 798 808 11 SAFSFGTANTN 83.46
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 817 823 7 TSFSFNA 89.63
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 837 848 12 SGTNIAGTFNVG 86.18
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 862 891 30 AGSAFGFSSSGTAATGAASNQSSFNFGNNG 84.95
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 908 915 8 NAGLFNKP 95.65
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 925 937 13 VPSAFNFTGNNST 87.03
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 940 959 20 GGSVFNMNGNTNANTVFAGS 83.08
DP01075P20676Nucleoporin NUP1 (Nuclear pore protein NUP1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 300 1076 981 1003 23 TVPNINFSGLNGGITNTATNALR 80.79
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 34 47 14 LFGNSNNNNNSTSN 84.62
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 60 83 24 AGSNSNSLFGNNNTQNNGAFGQSM 83.18
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 118 130 13 TNNAFNNNSNSTN 82.43
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 141 178 38 GGTLFGSQNNNSAGTSSLFGGQSTSTTGTFGNTGSSFG 84.49
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 184 190 7 NGSNIFG 88.92
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 195 216 22 SQSNTTGSLFGNQQSSAFGTNN 82.96
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 218 245 28 QGSLFGQQSQNTNNAFGNQNQLGGSSFG 83.97
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 251 295 45 SGSLFGQSNNTLGNTTNNRNGLFGQMNSSNQGSSNSGLFGQNSMN 85.22
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 298 341 44 TQGVFGQNNNQMQINGNNNNSLFGKANTFSNSASGGLFGQNNQQ 84.69
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 343 355 13 GSGLFGQNSQTSG 82.94
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 372 396 25 TQSNTGIGLFGQNNNQQQQSTGLFG 86.98
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 403 412 10 TGSLFGGNSS 87.29
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 434 445 12 GNSLFGATKLTN 88.29
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 472 485 14 TGSLFGNNTASTTV 87.29
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 488 509 22 TNGLFGNNANNSTSTTNTGLFG 83.16
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 521 536 16 GGGLFGNSNSNSSTIG 84.3
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 548 556 9 NTGLFGATG 86.96
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 590 599 10 TQNALLGTTA 80.6
DP01076Q02629Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 640 610 625 16 NEQLFSKISIPNSITN 92.79
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 18 37 20 ANNNSNTTNQNSSTGAGAFG 82.17
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 39 78 40 GQSTFGFNNSAPNNTNNANSSITPAFGSNNTGNTAFGNSN 85.74
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 90 108 19 TTNTFGSNSAGTSLFGSSS 86.99
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 119 138 20 GGNTFGSSSLFNNSTNSNTT 85.27
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 160 175 16 NANTSNNLFGATANAN 81.52
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 196 204 9 PAFSFNSSV 86.96
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 215 221 7 TGFSFGS 84.62
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 548 554 7 SAFSFGS 87.29
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 565 573 9 AKAAISFGA 85.69
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 603 586 592 7 PAFTFGA 85.28
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 498 607 548 554 7 SAFSFGS 87.29
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 498 607 565 573 9 AKAAISFGA 85.69
DP01077P14907Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 498 607 586 592 7 PAFTFGA 85.28
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 441 449 9 SGFTFLKTQ 90.97
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 451 477 27 AAANSLQSQSSSTFGAPSFGSSAFKID 82.72
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 518 525 8 STSEYAFG 86.71
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 608 637 30 GTSAFGTASSNETNSGSIFGKAAFGSSSFA 85.53
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 640 652 13 NNELFGSNFTISK 90.02
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 700 716 17 KTNAFDFGSSSFGSGFS 81.15
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 824 836 13 LTETIKKSANIDM 83.46
DP01078P40477Nucleoporin NUP159 (Nuclear pore protein NUP159) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 441 881 855 865 11 PFSAFATNITK 87.17
DP01079P40517Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 203 138 156 19 KPFAFGSGLSFGSGFNILK 82.22
DP01080Q9C1S9Exoglucanase-6A (EC 3.2.1.91) (1;4-beta-cellobiohydrolase 6A) (Avicelase 2) (Beta-glucancellobiohydrolase 6A) (Exocellobiohydrolase 6A) Humicola insolens (Soft-rot fungus) 44 96 53 59 7 QNDWYSQ 90.11
DP01080Q9C1S9Exoglucanase-6A (EC 3.2.1.91) (1;4-beta-cellobiohydrolase 6A) (Avicelase 2) (Beta-glucancellobiohydrolase 6A) (Exocellobiohydrolase 6A) Humicola insolens (Soft-rot fungus) 44 96 64 76 13 SQVTTTSTTSTSS 85.28
DP01082Q7X2A1Immunoglobulin-like B protein Leptospira interrogans serovar Pomona 1119 1165 1139 1149 11 IQVVYSESINN 86.47
DP01082Q7X2A1Immunoglobulin-like B protein Leptospira interrogans serovar Pomona 1119 1165 1154 1160 7 DLSNYKI 86.67
DP01083Q7TP21Replication protein A subunit Rattus norvegicus (Rat) 91 167 142 150 9 VAKAYGASK 80.6
DP01084Q1K7R9Replication protein A subunit Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) 111 173 138 147 10 STGFYGVKSE 84.62
DP01085Q9SKI4Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A) Arabidopsis thaliana (Mouse-ear cress) 106 193 121 130 10 AQKTFSGTGN 84.41
DP01085Q9SKI4Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A) Arabidopsis thaliana (Mouse-ear cress) 106 193 135 142 8 NRVVFNEP 89.63
DP01085Q9SKI4Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A) Arabidopsis thaliana (Mouse-ear cress) 106 193 154 166 13 RGVNIQNQANNTP 91.97
DP01086Q10Q08Replication protein A 70 kDa DNA-binding subunit B (OsRPA70b) (Replication factor A protein 1B) (Replication protein A 1B) Oryza sativa subsp. japonica (Rice) 105 180 105 117 13 LEVVFKALDSEIK 86.54
DP01086Q10Q08Replication protein A 70 kDa DNA-binding subunit B (OsRPA70b) (Replication factor A protein 1B) (Replication protein A 1B) Oryza sativa subsp. japonica (Rice) 105 180 162 170 9 SASQIVNEQ 85.51
DP01087Q1PAB4Protein Tat (Transactivating regulatory protein) Human immunodeficiency virus 1 1 101 34 48 15 CQVCFIRKALGISYG 84.06
DP01088Q9XES8Seed maturation protein PM28 Glycine max (Soybean) (Glycine hispida) 1 89 6 14 9 EDITYATSQ 91.97
DP01088Q9XES8Seed maturation protein PM28 Glycine max (Soybean) (Glycine hispida) 1 89 44 50 7 VDLFSSA 80.27
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 3546 3795 3698 3716 19 AASEIAHLAIDEAVLETSN 86.18
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 3546 3795 3758 3766 9 VIVAEVGYD 87.07
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 3546 3795 3769 3790 22 ECSTIADTITSLSSSPLYTAPV 87.29
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4716 4748 33 VEVELFFSQAEVFSGLELDLLMECSEYVTTSIQ 83.68
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4815 4822 8 QQAEIVEQ 92.31
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4877 4909 33 VEVELFFSQAEVFSGLELDLLMECSEYVTTSIQ 83.68
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4937 4944 8 QQAEIIEQ 82.98
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 4976 4983 8 QQVEIIEQ 93.48
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5015 5022 8 QQAEIIEQ 82.98
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5054 5061 8 QQVEIIEQ 93.48
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5093 5100 8 QQAEIIEQ 82.98
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5132 5139 8 QQVEIIEQ 93.48
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5233 5265 33 VEVELFFSKAEVFSGLELDLLMECSEYVTTSIQ 85.54
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5332 5339 8 QQAEIIEQ 82.98
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5394 5426 33 VEVELLFSQAEVFSGLELDLLMECSEYVTTSIQ 85.39
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 5493 5500 8 QQAEIIEQ 82.98
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6179 6211 33 VEVELFFSQAEVFSGLELDLLMECSEYVTTSIQ 83.68
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6707 6714 8 QTAEIVEQ 86.96
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6746 6754 9 QQAAIVEQK 95.65
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6780 6792 13 ETSEIQTAEIVEQ 84.38
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6824 6832 9 QQAAIVEQK 95.65
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6858 6871 14 ETSEIQQAAVVEQK 80.27
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6902 6910 9 QQAAIVEQK 95.65
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 4627 7026 6941 6949 9 QQAAIVEQK 95.65
DP01090G4SLH0Titin homolog (EC 2.7.11.1) Caenorhabditis elegans 7013 8512 8492 8507 16 NQSRIFEETSIEVTSL 84.66
DP01092O66683Anti sigma factor FlgM Aquifex aeolicus (strain VF5) 5 88 10 18 9 LIGLLLETE 80.6
DP01092O66683Anti sigma factor FlgM Aquifex aeolicus (strain VF5) 5 88 38 48 11 TLSKIAQELSK 89.3
DP01094Q9BP37Aragonite protein AP7 Haliotis rufescens (California red abalone) 23 52 24 32 9 DNGNYGNGM 80.94
DP01094Q9BP37Aragonite protein AP7 Haliotis rufescens (California red abalone) 23 52 37 47 11 TQGNTYDDLAS 86.71
DP01094Q9BP37Aragonite protein AP7 Haliotis rufescens (California red abalone) 56 88 65 72 8 ALCYSITD 86.71
DP01095Q9BP38Aragonite protein AP24 Haliotis rufescens (California red abalone) 25 54 35 46 12 LCNQYNQNVTTR 81.44
DP01097P61244Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) Homo sapiens (Human) 81 102 83 89 7 NALLEQQ 80.27
DP01097P61244Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) Homo sapiens (Human) 93 150 110 116 7 DNSLYTN 84.42
DP01097P61244Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) Homo sapiens (Human) 93 150 118 126 9 KGSTISAFD 89.74
DP01100P10636Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) Homo sapiens (Human) 1 441 274 280 7 KVQIINK 97.99
DP01100P10636Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) Homo sapiens (Human) 1 441 304 312 9 GSVQIVYKP 89.37
DP01100P10636Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) Homo sapiens (Human) 1 441 350 362 13 VQSKIGSLDNITH 85.28
DP01100P10636Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) Homo sapiens (Human) 1 441 388 396 9 HGAEIVYKS 86.99
DP01101P04370Myelin basic protein (MBP) (Myelin A1 protein) Mus musculus (Mouse) 1 169 12 20 9 KYLATASTM 80.27
DP01101P04370Myelin basic protein (MBP) (Myelin A1 protein) Mus musculus (Mouse) 1 169 83 92 10 PVVHFFKNIV 88.09
DP01101P04370Myelin basic protein (MBP) (Myelin A1 protein) Mus musculus (Mouse) 1 169 148 156 9 TLSKIFKLG 90.97
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 7 18 12 TQQATQSYGAYP 82.69
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 22 31 10 GQGYSQQSSQ 80.27
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 34 43 10 GQQSYSGYSQ 81.61
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 87 98 12 SQSSYGQQSSYP 85.45
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 283 291 9 DNNTIFVQG 87.55
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 294 314 21 ENVTIESVADYFKQIGIIKTN 83.87
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 321 327 7 MINLYTD 97.99
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 347 360 14 AKAAIDWFDGKEFS 89.46
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 364 371 8 IKVSFATR 80.94
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 526 434 442 9 ENMNFSWRN 83.61
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 7 18 12 TQQATQSYGAYP 82.69
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 22 31 10 GQGYSQQSSQ 80.27
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 34 43 10 GQQSYSGYSQ 81.61
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 87 98 12 SQSSYGQQSSYP 85.45
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 283 291 9 DNNTIFVQG 87.55
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 294 314 21 ENVTIESVADYFKQIGIIKTN 83.87
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 321 327 7 MINLYTD 97.99
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 347 360 14 AKAAIDWFDGKEFS 89.46
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 364 371 8 IKVSFATR 80.94
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 507 434 442 9 ENMNFSWRN 83.61
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 7 18 12 TQQATQSYGAYP 82.69
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 22 31 10 GQGYSQQSSQ 80.27
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 34 43 10 GQQSYSGYSQ 81.61
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 87 98 12 SQSSYGQQSSYP 85.45
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 283 291 9 DNNTIFVQG 87.55
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 294 314 21 ENVTIESVADYFKQIGIIKTN 83.87
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 321 327 7 MINLYTD 97.99
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 347 360 14 AKAAIDWFDGKEFS 89.46
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 422 364 371 8 IKVSFATR 80.94
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 7 18 12 TQQATQSYGAYP 82.69
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 22 31 10 GQGYSQQSSQ 80.27
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 34 43 10 GQQSYSGYSQ 81.61
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 87 98 12 SQSSYGQQSSYP 85.45
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 214 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 7 18 12 TQQATQSYGAYP 82.69
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 22 31 10 GQGYSQQSSQ 80.27
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 34 43 10 GQQSYSGYSQ 81.61
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 87 98 12 SQSSYGQQSSYP 85.45
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 1 163 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 2 36 7 18 12 TQQATQSYGAYP 82.69
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 2 36 22 31 10 GQGYSQQSSQ 80.27
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 39 95 51 59 9 GQSSYSSYG 87.96
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 98 214 139 150 12 QQQSYGQQQSYN 93.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 98 214 157 165 9 QQNQYNSSS 87.14
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 285 370 294 314 21 ENVTIESVADYFKQIGIIKTN 83.87
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 285 370 321 327 7 MINLYTD 97.99
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 285 370 347 360 14 AKAAIDWFDGKEFS 89.46
DP01102P35637RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) Homo sapiens (Human) 421 455 434 442 9 ENMNFSWRN 83.61
DP01103Q13698Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1) Homo sapiens (Human) 666 791 775 786 12 EASSFFIFSPTN 96.49
DP01104P46531Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD) Homo sapiens (Human) 1758 1888 1764 1771 8 HGQLWFPE 95.53
DP01105P20444Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13) Mus musculus (Mouse) 606 672 622 633 12 GAENFDKFFTRG 85.34
DP01105P20444Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13) Mus musculus (Mouse) 606 672 641 667 27 DQLVIANIDQSDFEGFSYVNPQFVHPI 87.19
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 598 236 268 33 TVWISVAVLSAVICLIIVWAVALKGYSMVTCIF 88.18
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 598 310 317 8 LLVEYLEV 82.48
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 598 370 381 12 NPSTFYDPEVIE 80.6
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 598 429 441 13 SYHNITDVCELAV 87.29
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 598 553 559 7 MDNNILV 88.01
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 396 236 268 33 TVWISVAVLSAVICLIIVWAVALKGYSMVTCIF 88.18
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 396 310 317 8 LLVEYLEV 82.48
DP01106P16471Prolactin receptor (PRL-R) Homo sapiens (Human) 236 396 370 381 12 NPSTFYDPEVIE 80.6
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 1 7 7 MSEYIRV 84.28
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 24 36 13 GTVLLSTVTAQFP 80.78
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 69 76 8 GNLVYVVN 91.72
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 103 116 14 TSDLIVLGLPWKTT 80.41
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 119 142 24 DLKEYFSTFGEVLMVQVKKDLKTG 86.68
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 148 162 15 GFVRFTEYETQVKVM 82.61
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 207 215 9 LREFFSQYG 85.73
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 227 261 35 RAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAE 93.28
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 309 320 12 GGMNFGAFSINP 92.06
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 326 335 10 AQAALQSSWG 80.27
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 370 376 7 GNNSYSG 85.95
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 1 414 379 390 12 SGAAIGWGSASN 80.27
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 263 414 309 320 12 GGMNFGAFSINP 92.06
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 263 414 326 335 10 AQAALQSSWG 80.27
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 263 414 370 376 7 GNNSYSG 85.95
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 263 414 379 390 12 SGAAIGWGSASN 80.27
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 266 414 309 320 12 GGMNFGAFSINP 92.06
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 266 414 326 335 10 AQAALQSSWG 80.27
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 266 414 370 376 7 GNNSYSG 85.95
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 266 414 379 390 12 SGAAIGWGSASN 80.27
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 267 414 309 320 12 GGMNFGAFSINP 92.06
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 267 414 326 335 10 AQAALQSSWG 80.27
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 267 414 370 376 7 GNNSYSG 85.95
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 267 414 379 390 12 SGAAIGWGSASN 80.27
DP01108Q13148TAR DNA-binding protein 43 (TDP-43) Homo sapiens (Human) 321 343 326 335 10 AQAALQSSWG 80.27
DP01109P22626Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1) Homo sapiens (Human) 190 341 286 314 29 GYDNYGGGNYGSGNYNDFGNYNQQPSNYG 89.23
DP01110Q9UHD9Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) Homo sapiens (Human) 450 624 451 477 27 AMQALMQIQQGLQTLATEAPGLIPSFT 80.9
DP01110Q9UHD9Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) Homo sapiens (Human) 450 624 556 569 14 NQQFIQQMVQALAG 82.11
DP01110Q9UHD9Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) Homo sapiens (Human) 450 624 583 619 37 QQQLEQLNAMGFLNREANLQALIATGGDINAAIERLL 85.94
DP01113D0PV95ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1) Caenorhabditis elegans 1 168 91 101 11 RDRNYEDRGYN 80.6
DP01118Q12834Cell division cycle protein 20 homolog (p55CDC) Homo sapiens (Human) 81 164 88 99 12 MEVASFLLSKEN 85.17
DP01118Q12834Cell division cycle protein 20 homolog (p55CDC) Homo sapiens (Human) 81 164 114 134 21 KAWALNLNGFDVEEAKILRLS 84.12
DP01118Q12834Cell division cycle protein 20 homolog (p55CDC) Homo sapiens (Human) 81 164 148 154 7 LKVLYSQ 82.27
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 1 137 21 36 16 AVSHWQQQSYLDSGIH 85.51
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 1 137 60 76 17 SQVLYEWEQGFSQSFTQ 83.38
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 1 137 82 89 8 IDGQYAMT 80.27
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 19 44 21 36 16 AVSHWQQQSYLDSGIH 85.51
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 683 781 688 694 7 MAWNETA 85.62
DP01119P35222Catenin beta-1 (Beta-catenin) Homo sapiens (Human) 687 781 688 694 7 MAWNETA 85.62
DP01126O43561Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) Homo sapiens (Human) 28 233 106 119 14 SVASYENEGASGIR 84.33
DP01126O43561Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) Homo sapiens (Human) 28 233 188 201 14 RDSAFSMESIDDYV 86.96
DP01126O43561Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) Homo sapiens (Human) 28 233 216 225 10 GSREYVNVSQ 80.27
DP01127Q8VHK2Caskin-1 (CASK-interacting protein 1) Rattus norvegicus (Rat) 603 1430 726 733 8 RSQEYLLD 84.2
DP01127Q8VHK2Caskin-1 (CASK-interacting protein 1) Rattus norvegicus (Rat) 603 1430 831 839 9 RGFAYVLPQ 92.31
DP01127Q8VHK2Caskin-1 (CASK-interacting protein 1) Rattus norvegicus (Rat) 603 1430 883 891 9 SLNRYAASD 82.94
DP01127Q8VHK2Caskin-1 (CASK-interacting protein 1) Rattus norvegicus (Rat) 603 1430 1137 1146 10 ENVKFILTES 83.65
DP01127Q8VHK2Caskin-1 (CASK-interacting protein 1) Rattus norvegicus (Rat) 603 1430 1167 1178 12 PLSVYQNGTATI 80.27
DP01128O43806Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) (Fragment) Homo sapiens (Human) 25 93 58 68 11 RKWNFDFQNHK 86.96
DP01128O43806Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) (Fragment) Homo sapiens (Human) 25 93 70 79 10 LEGKYEWQEV 80.27
DP01133Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 216 302 248 260 13 SDQFSVEFEVESL 85.41
DP01133Q00987E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) Homo sapiens (Human) 216 302 278 289 12 DDEVYQVTVYQA 82.16
DP01134P10071Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83) Homo sapiens (Human) 106 236 196 206 11 YINPYMDYIRS 84.95
DP01134P10071Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83) Homo sapiens (Human) 106 236 212 220 9 SLSMISATR 85.95
DP01135P40019Histone H2A.Z-specific chaperone CHZ1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 153 91 104 14 DLAEIDTSNIITSG 89.06
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 38 53 16 QTRNITVSIQYSYFTP 90.36
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 58 73 16 HLSNISNNDNNENNSA 87.86
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 75 83 9 SGSTIANGT 86.62
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 99 106 8 ALVLSFRD 81.77
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 115 122 8 RLNSFISV 86.75
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 164 127 136 10 AMERFNRLLN 80.6
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 303 316 14 NEAAFERIRRVLYD 85.14
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 318 329 12 TAVNSTNENSSA 86.62
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 354 361 8 RTGFFLVP 85.33
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 414 421 8 TLFQFHSP 80.6
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 460 468 9 VLDHIFNVA 83.05
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 501 518 18 QGSSFLENISRLTGHFTN 92.23
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 544 557 14 RNNLFSSGVASYRN 83.61
DP01136P22470Protein SAN1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 281 610 560 576 17 GDVTTVELRNNNSAAFP 87.63
DP01137Q6FI81Anamorsin (Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog) Homo sapiens (Human) 173 266 194 201 8 AAKLWTLS 84.62
DP01140P38293Proteasome maturation factor UMP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 148 72 80 9 YRQIFGIAE 88
DP01140P38293Proteasome maturation factor UMP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 148 86 99 14 MEMEIVNRTDFNPL 84.95
DP01140P38293Proteasome maturation factor UMP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 148 107 124 18 RDILLNKECSIDWEDVYP 80.38
DP01140P38293Proteasome maturation factor UMP1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 84 72 79 8 YRQIFGIA 87.96
DP01141P70604Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2) Rattus norvegicus (Rat) 396 424 406 412 7 HVHNFMM 87.96
DP01141P70604Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2) Rattus norvegicus (Rat) 436 487 452 466 15 HQRKFLQAIHQLRSV 85.42
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 196 205 10 NVSGIYHVTN 80.57
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 208 222 15 SNSSIVYEAADVIMH 84.28
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 267 277 11 GTAAFCSAMYV 86.62
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 280 292 13 LCGSIFLVSQLFT 89.17
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 331 341 11 ALVVSQLLRIP 82.27
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 357 381 25 AGLAYYSMVGNWAKVLIVALLFAGV 91.84
DP01142O92972Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) Hepatitis C virus genotype 1b (strain HC-J4) (HCV) 191 447 399 442 44 FTSLFSSGASQKIQLVNTNGSWHINRTALNCNDSLQTGFFAALF 92.73
DP01144P08008Outer membrane virulence protein YopE Yersinia pseudotuberculosis serotype I (strain IP32953) 1 100 2 11 10 KISSFISTSL 87.83
DP01144P08008Outer membrane virulence protein YopE Yersinia pseudotuberculosis serotype I (strain IP32953) 1 100 55 61 7 LASRIIE 82.56
DP01144P08008Outer membrane virulence protein YopE Yersinia pseudotuberculosis serotype I (strain IP32953) 1 100 67 79 13 AHSVIGFIQRMFS 90.92
DP01146O34800Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) Bacillus subtilis (strain 168) 1 56 27 33 7 SVASYQV 83.28
DP01146O34800Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) Bacillus subtilis (strain 168) 1 56 37 51 15 TARIFKENERLIDEY 84.15
DP01146O34800Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) Bacillus subtilis (strain 168) 9 52 27 33 7 SVASYQV 83.28
DP01146O34800Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) Bacillus subtilis (strain 168) 9 52 37 47 11 TARIFKENERL 83.13
DP01146O34800Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) Bacillus subtilis (strain 168) 13 53 27 33 7 SVASYQV 83.28
DP01146O34800Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) Bacillus subtilis (strain 168) 13 53 37 48 12 TARIFKENERLI 83.44
DP01147Q9I322Type III secretion regulatory protein ExsE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) 1 81 2 8 7 KIESISP 87.29
DP01148A0A068MVV3Glutamine synthetase inactivating factor IF7 Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714)) 1 65 14 20 7 HHQFIKN 84.09
DP01148A0A068MVV3Glutamine synthetase inactivating factor IF7 Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714)) 1 65 29 45 17 AAAEIGVQAEKDFWTTV 88.08
DP01149Q14457Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa Homo sapiens (Human) 1 150 29 50 22 TSFKILDRVTIQELTAPLLTTA 86.2
DP01149Q14457Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa Homo sapiens (Human) 1 150 93 101 9 SANSFTLIG 86.18
DP01149Q14457Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa Homo sapiens (Human) 1 150 121 127 7 DLFDIMS 85.28
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 139 8 30 23 GGVITEEMAASLLDQLIEEVLAD 89.4
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 139 43 49 7 LHELYDL 90.97
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 139 61 67 7 AVSQIFP 87
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 91 8 30 23 GGVITEEMAASLLDQLIEEVLAD 89.4
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 91 43 49 7 LHELYDL 90.97
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 91 61 67 7 AVSQIFP 87
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 1 36 8 30 23 GGVITEEMAASLLDQLIEEVLAD 89.4
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 27 91 43 49 7 LHELYDL 90.97
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 27 91 61 67 7 AVSQIFP 87
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 36 91 43 49 7 LHELYDL 90.97
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 36 91 61 67 7 AVSQIFP 87
DP01150P03255Early E1A protein (Early E1A 32 kDa protein) Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) 53 91 61 67 7 AVSQIFP 87
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 8 14 7 LVLSYQE 88.29
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 22 30 9 LVDNFFNEV 92.64
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 33 52 20 DDDLYVPSLYELYDLDVESA 87.94
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 59 79 21 QAVNEFFPESLILAASEGLFL 85.6
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 106 112 7 DLLCYEM 82.61
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 180 191 12 YLRAYNMFIYSP 95.07
DP01151P03259Early E1A protein (Early E1A 29.5 kDa protein) Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 1 266 237 249 13 AVESILDLIQEEE 85.28
DP01152Q9JK11Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) Rattus norvegicus (Rat) 544 725 546 554 9 TKIAYETKV 80.27
DP01152Q9JK11Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) Rattus norvegicus (Rat) 544 725 559 569 11 TSEAIQESLYP 85.92
DP01152Q9JK11Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) Rattus norvegicus (Rat) 544 725 668 680 13 EAPYISIACDLIK 80.42
DP01152Q9JK11Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) Rattus norvegicus (Rat) 544 725 691 705 15 DFSNYSEIAKFEKSV 86.29
DP01153P9WI73Serine/threonine-protein kinase PknG (EC 2.7.11.1) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 75 32 38 7 TQAVFRP 81.61
DP01154P195942S albumin (GM2S-1) (Napin-type 2S albumin 3) Cleaved into: 2S albumin small chain (Aspartic acid-rich peptide) (Lunasin); 2S albumin large chain (8 kDa methionine-rich protein) (8 kDa MRP) Glycine max (Soybean) (Glycine hispida) 22 64 36 42 7 QGVNLTP 80.6
DP01155O66858RNA polymerase sigma factor RpoN Aquifex aeolicus (strain VF5) 1 60 22 47 26 LELLTYQTQELEKLIHEEVLVNPLIK 91.66
DP01157P04908Histone H2A type 1-B/E (Histone H2A.2) (Histone H2A/a) (Histone H2A/m) Homo sapiens (Human) 98 130 108 118 11 VLPNIQAVLLP 81.06
DP01159A6NF83Nuclear protein 2 (Nuclear transcriptional regulator 1-like protein) (Nuclear transcriptional regulator protein 2) Homo sapiens (Human) 1 97 25 39 15 EEELYDCLDYYYLRD 94.36
DP01160P9WPI9Tyrosine-protein kinase PtkA (EC 2.7.10.-) (Protein tyrosine kinase A) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 81 46 54 9 NDNGIVTDT 80.94
DP01161Q9UMS4Pre-mRNA-processing factor 19 (EC 2.3.2.27) (Nuclear matrix protein 200) (PRP19/PSO4 homolog) (hPso4) (RING-type E3 ubiquitin transferase PRP19) (Senescence evasion factor) Homo sapiens (Human) 169 194 169 186 18 TPEIIQKLQDKATVLTTE 86.06
DP01162Q96SD1Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein) Homo sapiens (Human) 480 575 488 508 21 QWEVFFKRNDEITDESLENFP 86.67
DP01162Q96SD1Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein) Homo sapiens (Human) 480 575 556 563 8 DTVLLSSQ 80.31
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 331 692 374 382 9 GSLVIQASE 80.9
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 331 692 510 518 9 NLPYFGQTN 80.94
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 331 692 530 536 7 SQQLSTV 80.94
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 331 692 605 615 11 AASSIYSMYTQ 89.94
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 331 692 659 668 10 HPENIYSNSQ 87.09
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 693 918 750 767 18 QKLLYQRTTIAAMETISV 88.59
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 693 918 783 792 10 SPVEIQNPYL 80.4
DP01164Q13625Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) Homo sapiens (Human) 693 918 858 866 9 VLDVYLEEY 86.29
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 2 34 33 QIQSFYHSASLKTQEAFKSLQKTLYNGMQILSG 86.6
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 46 54 9 RPEIIVLRE 82.94
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 58 64 7 TWGNYLQ 87.63
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 73 93 21 LHNLYNLQRDLLTVAATVLGK 83.25
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 1 148 128 137 10 KKNLIELIAA 92.78
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 29 168 46 54 9 RPEIIVLRE 82.94
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 29 168 58 64 7 TWGNYLQ 87.63
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 29 168 73 93 21 LHNLYNLQRDLLTVAATVLGK 83.25
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 29 168 128 137 10 KKNLIELIAA 92.78
DP01166O30916Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) 29 168 154 160 7 AAVAFRD 92.98
DP01167P02730Band 3 anion transport protein (Anion exchange protein 1) (AE 1) (Anion exchanger 1) (Solute carrier family 4 member 1) (CD antigen CD233) Homo sapiens (Human) 1 54 17 23 7 EQEEYED 87.29
DP01169P24255RNA polymerase sigma-54 factor Escherichia coli (strain K12) 1 105 19 44 26 LQQAIRLLQLSTLELQQELQQALESN 84.2
DP01169P24255RNA polymerase sigma-54 factor Escherichia coli (strain K12) 1 105 46 57 12 LLEQIDTHEEID 80.6
DP01169P24255RNA polymerase sigma-54 factor Escherichia coli (strain K12) 1 105 88 94 7 WDTIYTA 91.97
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 445 451 7 NIQNFQL 97.66
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 462 476 15 NGQLLMIPQQALAQM 80.29
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 595 607 13 KCKNFLSTLIKLA 80.6
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 623 648 26 LVQNLLDGKIEAEDFTSRLYRELNSS 81.48
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 671 679 9 SAAFIQQSQ 82.68
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 694 702 9 TAVVLSSSV 88.93
DP01170O00268Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) Homo sapiens (Human) 408 838 711 718 8 ATVTSALQ 80.94
DP01172O43516WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein) Homo sapiens (Human) 407 503 451 460 10 ESRFYFHPIS 83.28
DP01173Q15726Metastasis-suppressor KiSS-1 (Kisspeptin-1) Cleaved into: Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10 Homo sapiens (Human) 20 138 35 45 11 GQQLESLGLLA 85.62
DP01173Q15726Metastasis-suppressor KiSS-1 (Kisspeptin-1) Cleaved into: Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10 Homo sapiens (Human) 20 138 108 122 15 DLPNYNWNSFGLRFG 86.69
DP01174O43474Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) Homo sapiens (Human) 1 130 19 26 8 SFSTFASG 92.98
DP01174O43474Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) Homo sapiens (Human) 1 130 68 77 10 ATVATDLESG 80.94
DP01174O43474Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) Homo sapiens (Human) 1 130 95 113 19 ETEEFNDLLDLDFILSNSL 82.91
DP01175P28235Gap junction alpha-4 protein (Connexin-37) (Cx37) Mus musculus (Mouse) 233 333 260 269 10 PEQVFFYLPM 89.26
DP01175P28235Gap junction alpha-4 protein (Connexin-37) (Cx37) Mus musculus (Mouse) 233 333 287 297 11 TEQNWANLTTE 84.22
DP01176P08033Gap junction beta-1 protein (Connexin-32) (Cx32) (GAP junction 28 kDa liver protein) Rattus norvegicus (Rat) 217 283 244 254 11 KQNEINKLLSE 94.31
DP01177P0AE98Curli production assembly/transport component CsgF Escherichia coli (strain K12) 19 49 20 28 9 GTMTFQFRN 80.38
DP01177P0AE98Curli production assembly/transport component CsgF Escherichia coli (strain K12) 19 49 36 44 9 NNGAFLLNS 83.98
DP01178Q14978Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) Homo sapiens (Human) 1 699 50 60 11 LLDIYSFWLKS 83.19
DP01178Q14978Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) Homo sapiens (Human) 1 699 659 665 7 NQVLKFT 86.19
DP01181P56621Nickel and cobalt resistance protein CnrY Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) 2 38 4 10 7 VEEWLTH 81.61
DP01181P56621Nickel and cobalt resistance protein CnrY Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) 2 38 22 33 12 VDVTSIQECISA 83.92
DP01181P56621Nickel and cobalt resistance protein CnrY Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) 2 30 4 10 7 VEEWLTH 81.61
DP01183Q9R224Protein BEX1 (Brain-expressed X-linked protein 1 homolog) (Reduced expression protein 3) (REX-3) Mus musculus (Mouse) 1 55 36 42 7 AVALTSE 82.94
DP01184O96013Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) Homo sapiens (Human) 9 68 13 21 9 APSNFEHRV 82.61
DP01184O96013Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) Homo sapiens (Human) 9 68 39 46 8 WQSLIEES 96.66
DP01186P03086Agnoprotein (Agno) JC polyomavirus (JCPyV) (JCV) 41 71 58 66 9 TEQTYSALP 92.31
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 19 30 12 LQFNAAMISNKS 81.1
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 41 49 9 NSSYIVIGK 89
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 56 66 11 NSTAIAATAES 81.97
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 91 100 10 AEALLLYTSK 87.02
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 141 153 13 EEGEIFHEARDYV 80.94
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 267 286 20 KKSLYQDLMENSTVEVNRYE 85.62
DP01189P53874Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 359 323 339 17 TISNLSNFYQFNENIND 91.01
DP01191O1414026S proteasome complex subunit rpn15 (mRNA export factor dss1) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 1 54 41 49 9 WENNWDDED 86.96
DP01192P5503626S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) Homo sapiens (Human) 305 377 336 343 8 QSVLENLP 80.94
DP01192P5503626S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) Homo sapiens (Human) 305 377 348 356 9 NNEAIRNAM 80.27
DP01192P5503626S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) Homo sapiens (Human) 328 361 336 343 8 QSVLENLP 80.94
DP01192P5503626S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) Homo sapiens (Human) 328 361 348 356 9 NNEAIRNAM 80.27
DP01195P39007Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 (Oligosaccharyl transferase subunit STT3) (EC 2.4.99.18) (Staurosporine and temperature sensitivity protein 3) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 299 351 299 346 48 MVSLFLILVLGVVGLSALTYMGLIAPWTGRFYSLWDTNYAKIHIPIIA 89.76
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 43 52 10 KDSSFENILA 82.54
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 55 92 38 HENAYIVALFTATAPEIGCSLCLELESEYDTIVASWFD 87.56
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 103 115 13 DTSIFFTKVNLED 83.69
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 122 141 20 KAFQFFQLNNVPRLFIFKPN 87.17
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 147 155 9 DHSVISIST 84.06
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 162 182 21 MKQIIQAIKQFSQVNDFSLHL 91.02
DP01196P48439Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 23 215 190 204 15 ITSTIITFITVLLFK 88.74
DP01199B9KDD4Undecaprenyl-diphosphooligosaccharide--protein glycotransferase (EC 2.4.99.19) (Protein glycosylation B) Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) 281 327 284 322 39 DPVLYQLKFYVFKASDVQNLKDAAFMYFNVNETIMEVNT 88.11
DP01200O29867Dolichyl-phosphooligosaccharide-protein glycotransferase 3 (EC 2.4.99.21) (Archaeal glycosylation protein B) (AglB-L) (AglB-Long) (Oligosaccharyl transferase) (OST) (OTase) Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) 336 373 354 368 15 GALTIAEVYPFFFTH 86.91
DP01201Q47184EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) Escherichia coli 1 30 7 23 17 ASVASANASTSTSMAYD 80.27
DP01201Q47184EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) Escherichia coli 60 147 60 70 11 SIAKFADMNEA 87.29
DP01201Q47184EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) Escherichia coli 60 147 84 96 13 VDAKIADVQSSSD 87.29
DP01201Q47184EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) Escherichia coli 60 147 105 112 8 DEVISYIN 95.19
DP01201Q47184EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) Escherichia coli 60 147 116 132 17 NDITISGIDNINAQLGA 92.21
DP01202O55000Serine/threonine-protein phosphatase 1 regulatory subunit 10 (MHC class I region proline-rich protein CAT53) (Phosphatase 1 nuclear targeting subunit) (Protein PNUTS) Rattus norvegicus (Rat) 309 433 406 417 12 KLREYFYFELDE 84.59
DP01203O75807Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog) Homo sapiens (Human) 513 631 562 573 12 VTVHFLAVWAGP 85.73
DP01228Q9UMZ1Prothymosin a14 Homo sapiens (Human) 1 101 8 15 8 TSSEITTE 80.94
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 195 208 14 EENTFEIALARLIP 86.72
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 213 220 8 SHAAYTYN 94.44
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 258 267 10 ATLHINITTA 88.13
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 295 303 9 KQSTIGKTA 89.97
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 332 342 11 AQETSYQNNRT 80.6
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 356 365 10 TLNDYYAALA 82.31
DP01237P36100Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 195 482 445 452 8 AVNATATA 80.6
DP01239P20591Interferon-induced GTP-binding protein Mx1 (Interferon-induced protein p78) (IFI-78K) (Interferon-regulated resistance GTP-binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) Cleaved into: Interferon-induced GTP-binding protein Mx1; N-terminally processed Homo sapiens (Human) 532 572 534 540 7 QDQVYRG 86.62
DP01239P20591Interferon-induced GTP-binding protein Mx1 (Interferon-induced protein p78) (IFI-78K) (Interferon-regulated resistance GTP-binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) Cleaved into: Interferon-induced GTP-binding protein Mx1; N-terminally processed Homo sapiens (Human) 532 572 560 567 8 DFGAFQSS 87.29
DP01246O13916Anaphase-promoting complex subunit hcn1 (20S cyclosome/APC complex protein hcn1) (Chaperone-like protein hcn1) (High copy suppressor of cut9 protein 1) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 25 80 61 69 9 GITQIFDSS 90.67
DP01248O95292Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) Homo sapiens (Human) 1 125 5 12 8 EQVLSLEP 87.29
DP01248O95292Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) Homo sapiens (Human) 1 125 23 29 7 TDVVTTN 84.57
DP01248O95292Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) Homo sapiens (Human) 1 125 57 79 23 NSGIIDAGASINVSVMLQPFDYD 87.04
DP01249P61073C-X-C chemokine receptor type 4 (CXC-R4) (CXCR-4) (FB22) (Fusin) (HM89) (LCR1) (Leukocyte-derived seven transmembrane domain receptor) (LESTR) (Lipopolysaccharide-associated protein 3) (LAP-3) (LPS-associated protein 3) (NPYRL) (Stromal cell-derived factor 1 receptor) (SDF-1 receptor) (CD antigen CD184) Homo sapiens (Human) 1 26 3 14 12 GISIYTSDNYTE 98.33
DP01254P12956"X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5-deoxyribose-5-phosphate lyase Ku70) (5-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6)" Homo sapiens (Human) 533 609 584 592 9 ACRAYGLKS 82.94
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 8 16 9 KLSNTVLPS 82.61
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 27 51 25 GIAQIQEETCQLLTDEVSYRIKEIA 82.9
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 87 99 13 HAQEFIPFRFASG 92
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 101 112 12 GRELYFYEEKEV 88.43
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 114 120 7 LSDIINT 86.29
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 1 216 133 140 8 AHWLSIEG 85.28
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 437 677 444 455 12 NQDAYRAEFGSL 80.27
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 437 677 468 486 19 AQAALQAQQVNRTTLTITQ 83.1
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 437 677 551 560 10 QQVLSLSTSA 82.41
DP01262P49848Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) Homo sapiens (Human) 437 677 602 611 10 SVQKYIVVSL 87.79
DP01268Q9H816"5 exonuclease Apollo (EC 3.1.-.-) (DNA cross-link repair 1B protein) (SNM1 homolog B) (SNMIB) (hSNM1B)" Homo sapiens (Human) 314 335 322 329 8 SVQQYMSS 82.86
DP01269Q8NG31Kinetochore scaffold 1 (ALL1-fused gene from chromosome 15q14 protein) (AF15q14) (Bub-linking kinetochore protein) (Blinkin) (Cancer susceptibility candidate gene 5 protein) (Cancer/testis antigen 29) (CT29) (Kinetochore-null protein 1) (Protein CASC5) (Protein D40/AF15q14) Homo sapiens (Human) 150 175 150 159 10 KEFSIIEHTR 94.92
DP01280P05067Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31 Homo sapiens (Human) 672 711 686 694 9 QKLVFFAED 88
DP01280P05067Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31 Homo sapiens (Human) 672 711 699 706 8 KGAIIGLM 86.96
DP01281Q9JM54Phorbol-12-myristate-13-acetate-induced protein 1 (Protein Noxa) Mus musculus (Mouse) 16 42 31 37 7 GDKVYCT 84.28
DP01284P24928DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit) (RNA-directed RNA polymerase II subunit RPB1) (EC 2.7.7.48) Homo sapiens (Human) 1773 1970 1953 1962 10 TYSLTSPAIS 84.62
DP01285Q97W59Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) 18 139 32 52 21 NMIILNIGNTTIIRNFAEYCD 88.52
DP01285Q97W59Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) 18 139 60 69 10 ICMKYLLKEL 80.27
DP01285Q97W59Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) 18 139 79 107 29 GELVIQGKFSSQVINTLMERFLKAYVECS 85.54
DP01285Q97W59Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) 18 139 111 117 7 SLDTILK 80.27
DP01285Q97W59Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) 18 139 120 129 10 KKSWYIVCLA 86.32
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 241 251 11 MDVSYALEMSS 95.32
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 264 275 12 DLNEIRNEVLAP 80.27
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 310 318 9 HFHAYSETE 90.97
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 342 363 22 GLSHIQTQTHWPDGLYNTQHTQ 88.17
DP01287Q9VZU1ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) Drosophila melanogaster (Fruit fly) 241 388 369 383 15 MDELFPDNFQSTCTQ 87.29
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 367 381 15 PLFKIANPIAGEPIS 86.96
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 415 433 19 TDLSYASQNFIPSAQWATA 90.97
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 458 465 8 HTQTFLPS 88.29
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 468 485 18 VTSSIAAQTDAFMDTCFQ 85.28
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 516 542 27 DIFESVHSSYNVATGNIISNSLVAETV 83.17
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 562 575 14 SAPIINFSAQNSML 82.08
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 584 601 18 QTQTIDLLSDLENILSSN 84.89
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 634 651 18 IDFDIEEFFSASNIQTQT 87.63
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 674 680 7 TDFLLAD 90.3
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 682 688 7 SAQSYGC 85.95
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 690 701 12 GNSNFLGLEMFD 88.63
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 706 714 9 TDLNFFLDS 83.72
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 758 764 7 VQLNSTE 83.95
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 775 785 11 LGSLFFTSNET 91.12
DP01288O43313ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) Homo sapiens (Human) 362 823 790 815 26 DDFLLADLAWNTMESQFSSVETQTSA 85.67
DP01292P49768Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) Homo sapiens (Human) 1 77 6 26 21 APLSYFQNAQMSEDNHLSNTV 86.49
DP01292P49768Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) Homo sapiens (Human) 262 378 270 299 30 MLVETAQERNETLFPALIYSSTMVWLVNMA 85.45
DP01292P49768Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) Homo sapiens (Human) 262 378 311 321 11 KNSKYNAESTE 86.96
DP01292P49768Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) Homo sapiens (Human) 262 378 361 370 10 VQELSSSILA 81.2
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 1 120 20 26 7 RTVAISD 91.3
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 1 120 39 47 9 GGTLFSTTP 83.61
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 1 120 49 61 13 GTRIIYDRKFLLD 87.63
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 1 120 94 105 12 EVNNLNNLNNHD 85.54
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 18 62 20 26 7 RTVAISD 91.3
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 18 62 39 47 9 GGTLFSTTP 83.61
DP01293Q13542Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) Homo sapiens (Human) 18 62 49 57 9 GTRIIYDRK 87.63
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 37 49 13 NQTKIAYEQRLLN 81.25
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 58 86 29 LDLFLDYMIWISTSYIEVDSESGQEVLRS 88.21
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 89 102 14 ERCLIYIQDMETYR 91.45
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 106 137 32 RFLKIWIWYINLFLSNNFHESENTFKYMFNKG 89.69
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 141 178 38 KLSLFYEEFSKLLENAQFFLEAKVLLELGAENNCRPYN 90.15
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 183 189 7 SLSNYED 92.64
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 192 203 12 REMNIVENQNSV 86.96
DP01294P41695Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 29 230 211 225 15 KGRLIYRTAPFFIRK 84.39
DP01295Q98XH7Protein Tat (Fragment) Human immunodeficiency virus 1 1 72 34 49 16 CQVCFMTKGLGIYYGR 89.97
DP01296Q6BBK3CP12 Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2) 1 52 14 22 9 EAHAISEEK 80.27
DP01296Q6BBK3CP12 Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2) 1 52 29 43 15 AAAAWDAVEELQAEA 85.95
DP01300Q9SLJ2Dehydrin HIRD11 (Histidine-rich dehydrin of 11 kDa) (AtHIRD11) (Protein SRC1 homolog) Arabidopsis thaliana (Mouse-ear cress) 1 98 1 15 15 MAGLINKIGDALHIG 88.36
DP01306Q03518Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) Homo sapiens (Human) 61 172 78 111 34 ASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTA 86.57
DP01306Q03518Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) Homo sapiens (Human) 61 172 125 132 8 WAVLWLGA 83.15
DP01306Q03518Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) Homo sapiens (Human) 61 172 149 157 9 AQGWLAALK 87.96
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 1 265 25 34 10 EEEIIAEDYD 91.97
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 1 265 61 69 9 GLPYYWNAD 86.55
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 1 265 71 77 7 DLVSWLS 86.81
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 1 265 249 260 12 GAVLRANAEASR 80.27
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 82 265 249 260 12 GAVLRANAEASR 80.27
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 95 265 249 260 12 GAVLRANAEASR 80.27
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 220 265 249 260 12 GAVLRANAEASR 80.27
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 223 265 249 260 12 GAVLRANAEASR 80.27
DP01308O60828Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) Homo sapiens (Human) 238 260 249 255 7 GAVLRAN 80.27
DP01310Q8WUP2Filamin-binding LIM protein 1 (FBLP-1) (Migfilin) (Mitogen-inducible 2-interacting protein) (MIG2-interacting protein) Homo sapiens (Human) 1 85 10 18 9 ASSVFITLA 85.88
DP01311Q6NUK1Calcium-binding mitochondrial carrier protein SCaMC-1 (Mitochondrial ATP-Mg/Pi carrier protein 1) (Mitochondrial Ca(2+)-dependent solute carrier protein 1) (Small calcium-binding mitochondrial carrier protein 1) (Solute carrier family 25 member 24) Homo sapiens (Human) 50 78 59 72 14 AEEKIFTTGDVNKD 81.44
DP01312Q9UMX1Suppressor of fused homolog (SUFUH) Homo sapiens (Human) 279 360 314 321 8 RGLEINSK 85.28
DP01315Q9QWH1Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36) Mus musculus (Mouse) 1 79 14 21 8 ASVTTNTS 85.28
DP01315Q9QWH1Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36) Mus musculus (Mouse) 1 79 47 55 9 QISVYSGIP 92.31
DP01315Q9QWH1Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36) Mus musculus (Mouse) 1 79 59 68 10 TVQVIQQALH 84.31
DP01316P25916Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) Mus musculus (Mouse) 106 240 127 140 14 DDEIISLSIEFFDQ 89.23
DP01316P25916Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) Mus musculus (Mouse) 106 240 185 194 10 NTFQIDVMYE 89.63
DP01316P25916Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) Mus musculus (Mouse) 106 240 199 214 16 KDYYTLMDIAYIYTWR 85.91
DP01319Q15796Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) Homo sapiens (Human) 1 262 61 78 18 LEKAITTQNCNTKCVTIP 82.72
DP01319Q15796Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) Homo sapiens (Human) 1 262 80 88 9 TCSEIWGLS 85.28
DP01319Q15796Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) Homo sapiens (Human) 1 262 98 107 10 TTGLYSFSEQ 88.76
DP01319Q15796Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) Homo sapiens (Human) 1 262 124 135 12 PHVIYCRLWRWP 88.29
DP01319Q15796Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) Homo sapiens (Human) 1 262 147 157 11 ENCEYAFNLKK 83.79
DP01320P36152Fe-S cluster assembly protein DRE2 (Anamorsin homolog) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 234 348 246 252 7 MITMITC 80.27
DP01320P36152Fe-S cluster assembly protein DRE2 (Anamorsin homolog) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 234 348 274 282 9 EENEINDIR 87.29
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 439 445 7 ESVEFTK 85.62
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 476 482 7 ESVEFTK 85.62
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 494 500 7 SQVETED 80.27
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 513 519 7 ESVEFTK 85.62
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 550 556 7 ESVEFTK 85.62
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 564 575 12 GFSETVTIVEDT 90.38
DP01322Q01924Fibronectin-binding protein Streptococcus pyogenes 396 591 578 586 9 KLVFHFDNN 91.56
DP01323Q8R316HMG box-containing protein 1 (HMG box transcription factor 1) (High mobility group box transcription factor 1) Mus musculus (Mouse) 358 380 364 373 10 SSAVYVLSSM 87.96
DP01329P28324ETS domain-containing protein Elk-4 (Serum response factor accessory protein 1) (SAP-1) (SRF accessory protein 1) Homo sapiens (Human) 94 136 106 116 11 ESLNFSEVSSS 86.96
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 112 12 38 27 KIREIYRYDEMSNKVLKVDKRFMNTSQ 80.7
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 112 42 48 7 RDAEISQ 82.94
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 112 94 103 10 QHNTILNSSS 84.48
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 193 257 205 213 9 QAVAILADD 87.81
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 193 257 231 238 8 LGGEINDN 85.28
DP01330P32639Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 193 257 241 252 12 DDEEYDYNDVEV 86.62
DP01332P17931Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen) Homo sapiens (Human) 1 115 1 13 13 MADNFSLHDALSG 81.12
DP01332P17931Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen) Homo sapiens (Human) 1 112 1 13 13 MADNFSLHDALSG 81.12
DP01332P17931Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen) Homo sapiens (Human) 1 40 1 13 13 MADNFSLHDALSG 81.12
DP01339P0A903Outer membrane protein assembly factor BamC Escherichia coli (strain K12) 26 98 37 45 9 GDEAYLEAA 93.98
DP01339P0A903Outer membrane protein assembly factor BamC Escherichia coli (strain K12) 26 98 63 71 9 GDYAIPVTN 87.63
DP01344Q13469Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1) Homo sapiens (Human) 131 294 175 187 13 SASFISDTFSPYT 82.56
DP01344Q13469Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1) Homo sapiens (Human) 131 294 204 213 10 QFQNIPAHYS 94.31
DP01356Q49492"Mycinamicin III 3-O-methyltransferase (EC 2.1.1.237) (Mycinamicin biosynthesis protein F)" Micromonospora griseorubida 116 144 133 139 7 NLHQYNE 82.27
DP01361P15927Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) Homo sapiens (Human) 1 42 5 15 11 GFESYGSSSYG 89.97
DP01361P15927Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) Homo sapiens (Human) 175 270 190 200 11 EAGNFGGNSFM 83.55
DP01361P15927Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) Homo sapiens (Human) 175 270 210 217 8 NQVLNLIK 89.38
DP01361P15927Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) Homo sapiens (Human) 175 270 223 229 7 EGLNFQD 86.96
DP01361P15927Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) Homo sapiens (Human) 175 270 244 259 16 QAVDFLSNEGHIYSTV 85.85
DP01378P0CU43Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 6 14 9 QESSYQYSD 82.61
DP01378P0CU43Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 44 56 13 MPNLIAPFISSSA 82.33
DP01378P0CU43Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 66 75 10 GFQASVSRIT 86.96
DP01378P0CU43Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 103 109 7 EQELLSR 80.27
DP01378P0CU43Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 152 158 7 MEQTIEN 88.29
DP01379P0CU44Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 6 14 9 QESSYQYSD 82.61
DP01379P0CU44Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 44 56 13 MPNLIAPFISSSA 82.33
DP01379P0CU44Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 66 75 10 GFQASVSRIT 86.96
DP01379P0CU44Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 103 109 7 EQELLSR 80.27
DP01379P0CU44Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 224 152 158 7 MEQTIEN 88.29
DP01380P0CU45Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 227 62 80 19 LAEEIVGQGFTASAARISG 84.42
DP01380P0CU45Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 227 122 138 17 KTEAYRKTAEAEAEKIR 80.27
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 12 18 7 TEVVYGG 91.97
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 32 42 11 KTTNYTHTEIR 82.94
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 60 77 18 LAQEIVGEGFTASATRIS 94.31
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 83 89 7 TQVLESQ 87.96
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 92 103 12 REQAFKDQEKYS 83.95
DP01381P0CU46Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 237 105 112 8 EQAAIARA 91.97
DP01382P0CU47Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 414 113 127 15 KNGEFVASSNRQNSS 82.94
DP01382P0CU47Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 414 159 165 7 TTVITES 83.95
DP01382P0CU47Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 414 268 275 8 SEAQINDM 80.27
DP01382P0CU47Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 414 301 318 18 KAAAYRNAVEADAELIRQ 84.99
DP01382P0CU47Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 414 342 354 13 QQQEIRLEAEYAM 88.01
DP01382P0CU47Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 414 373 389 17 ASTNIDVNIDSAIGTTH 89.06
DP01383P0CU51Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 229 33 43 11 IQQTSYLQSQV 83.92
DP01383P0CU51Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 229 54 89 36 FFSTSFSAQEILGEGFQASISRISAVSEELSSIEIP 82.5
DP01383P0CU51Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 229 109 117 9 LSANYQKEV 88.29
DP01383P0CU51Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 229 154 162 9 VEMAIENQK 82.61
DP01383P0CU51Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 229 211 222 12 GQVVSESQKFTE 80.6
DP01384P0CU50Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 227 62 80 19 LAEEIVGQGFTASAARISG 84.42
DP01384P0CU50Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 227 122 138 17 KTEAYRKTAEAEAEKIR 80.27
DP01385P0CU48Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 227 62 80 19 LAEEIVGQGFTASAARISG 84.42
DP01385P0CU48Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 227 122 138 17 KTEAYRKTAEAEAEKIR 80.27
DP01386P0CU49Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 238 30 41 12 VAAVYAVRFASS 87.99
DP01386P0CU49Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 238 143 158 16 AENAWEKTKDVAENLK 83.44
DP01386P0CU49Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 238 171 178 8 AANAWETV 87.21
DP01386P0CU49Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) Hypsibius dujardini (Water bear) (Macrobiotus dujardini) 1 238 200 210 11 AQQVIHDATTQ 81.61
DP01388P0CU52Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 227 31 38 8 VQQTSYMQ 85.66
DP01388P0CU52Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 227 59 80 22 AQELLGEGFQASISRISAVTED 82.75
DP01388P0CU52Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 227 108 115 8 GQQYEKEL 80.27
DP01388P0CU52Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) 1 227 152 160 9 AELAIENQK 91.97
DP01391P03520Phosphoprotein (P protein) (Protein M1) Vesicular stomatitis Indiana virus (strain San Juan) (VSIV) 1 60 6 15 10 KVREYLKSYS 80.27
DP01391P03520Phosphoprotein (P protein) (Protein M1) Vesicular stomatitis Indiana virus (strain San Juan) (VSIV) 1 60 20 29 10 AVGEIDEIEA 87.29
DP01391P03520Phosphoprotein (P protein) (Protein M1) Vesicular stomatitis Indiana virus (strain San Juan) (VSIV) 1 60 33 42 10 EKSNYELFQE 91.51
DP01393P04880Phosphoprotein (Protein P) (Protein M1) Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV) 1 60 6 15 10 KVREYLKSYS 80.27
DP01393P04880Phosphoprotein (Protein P) (Protein M1) Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV) 1 60 20 29 10 AVGEIDEIEA 87.29
DP01393P04880Phosphoprotein (Protein P) (Protein M1) Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV) 1 60 33 42 10 EKSNYELFQE 91.51
DP01394P04879Phosphoprotein (Protein P) (Protein M1) Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV) 1 60 6 15 10 KVREYLKSYS 80.27
DP01394P04879Phosphoprotein (Protein P) (Protein M1) Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV) 1 60 20 29 10 AVGEIDEIEA 87.29
DP01394P04879Phosphoprotein (Protein P) (Protein M1) Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV) 1 60 33 42 10 EKSNYELFQE 91.51
DP01395Q8B0H3Phosphoprotein (Protein P) (NS) (Protein M1) Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV) 1 60 20 29 10 AVGEIDEIEA 87.29
DP01395Q8B0H3Phosphoprotein (Protein P) (NS) (Protein M1) Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV) 1 60 33 42 10 EKSNYELFQE 91.51
DP01397Q9Z0P7Suppressor of fused homolog Mus musculus (Mouse) 279 359 314 321 8 RGLEINSK 85.28
DP01400P45985Dual specificity mitogen-activated protein kinase kinase 4 (MAP kinase kinase 4) (MAPKK 4) (EC 2.7.12.2) (JNK-activating kinase 1) (MAPK/ERK kinase 4) (MEK 4) (SAPK/ERK kinase 1) (SEK1) (Stress-activated protein kinase kinase 1) (SAPK kinase 1) (SAPKK-1) (SAPKK1) (c-Jun N-terminal kinase kinase 1) (JNKK) Homo sapiens (Human) 1 86 44 50 7 LKLNFAN 87.29
DP01401P47093U6 snRNA-associated Sm-like protein LSm8 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 68 109 96 104 9 EHVIWEKVY 86.96
DP01424Q2KIG3Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI) Bos taurus (Bovine) 1 117 8 33 26 VLVATVLFCGEHAFAFQRGQVLSALP 93.49
DP01424Q2KIG3Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI) Bos taurus (Bovine) 1 117 37 76 40 RQVQILQNVTTTYKIVLWQPVAAEYIVKGYEVHFFVNASD 88.63
DP01425Q15004PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor) Homo sapiens (Human) 1 111 64 72 9 GIGEFFRLS 81.46
DP01425Q15004PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor) Homo sapiens (Human) 50 77 64 72 9 GIGEFFRLS 81.46
DP01426P06400Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) Homo sapiens (Human) 786 928 801 808 8 GGNIYISP 94.52
DP01426P06400Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) Homo sapiens (Human) 786 928 831 849 19 ILVSIGESFGTSEKFQKIN 92.69
DP01426P06400Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) Homo sapiens (Human) 786 928 893 907 15 GESKFQQKLAEMTST 85.28
DP01426P06400Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) Homo sapiens (Human) 829 873 831 849 19 ILVSIGESFGTSEKFQKIN 92.69
DP01427Q01094Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) Homo sapiens (Human) 200 301 222 236 15 HLMNICTTQLRLLSE 82.01
DP01427Q01094Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) Homo sapiens (Human) 200 301 241 249 9 QRLAYVTCQ 87.29
DP01427Q01094Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) Homo sapiens (Human) 200 301 278 288 11 SSENFQISLKS 87.75
DP01428P03120Regulatory protein E2 Human papillomavirus type 16 286 365 308 323 16 HCTLYTAVSSTWHWTG 86.12
DP01428P03120Regulatory protein E2 Human papillomavirus type 16 286 365 328 342 15 HKSAIVTLTYDSEWQ 85.11
DP01428P03120Regulatory protein E2 Human papillomavirus type 16 286 365 344 353 10 DQFLSQVKIP 87.56
DP01429Q09427ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) Cricetus cricetus (Black-bellied hamster) 1319 1343 1322 1336 15 EAESYEGLLAPSLIP 80.27
DP01430Q03071Elongin-C "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 77 99 87 94 8 SLELLLAA 82.32
DP01431C6ZFX3Intrinsically disordered protein 1 Lotus japonicus (Lotus corniculatus var. japonicus) 1 94 4 23 20 SFTNIKAISALVAEEFSNSL 83.63
DP01431C6ZFX3Intrinsically disordered protein 1 Lotus japonicus (Lotus corniculatus var. japonicus) 1 94 69 88 20 VTGYYKPENIKEIDVAELRS 83.21
DP01432E1UJ20Parvalbumin beta-1 Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) 2 109 21 41 21 AADTFNFKTFFHTIGFASKSA 87.24
DP01432E1UJ20Parvalbumin beta-1 Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) 2 109 55 72 18 ASGFIEVEELKLFLQNFC 86.29
DP01433P04052DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) Drosophila melanogaster (Fruit fly) 1657 1739 1660 1666 7 SGSNIYS 93.41
DP01435O60829P antigen family member 4 (PAGE-4) (G antigen family C member 1) (PAGE-1) Homo sapiens (Human) 1 102 20 28 9 DVVAFVAPG 96.32
DP01436P54936Protein lin-2 (Abnormal cell lineage protein 2) Caenorhabditis elegans 423 487 435 444 10 TLNQIDGLLG 81.27
DP01436P54936Protein lin-2 (Abnormal cell lineage protein 2) Caenorhabditis elegans 423 487 471 477 7 VVCEIRD 82.61
DP01437P90976LIN-7 (Fragment) Caenorhabditis elegans 115 180 120 129 10 DVQRILELME 80.27
DP01437P90976LIN-7 (Fragment) Caenorhabditis elegans 115 180 146 170 25 QQVLQSEFFGAVREVYETVYESIDA 84.9
DP01438O14936Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) Homo sapiens (Human) 335 401 368 377 10 LDFLHSVFQD 80.74
DP01438O14936Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) Homo sapiens (Human) 335 401 383 391 9 LLDLYDKIN 84.28
DP01438O14936Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) Homo sapiens (Human) 394 460 412 420 9 VLEEISCYP 90.97
DP01438O14936Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) Homo sapiens (Human) 394 460 448 454 7 AHEVYSD 86.14
DP01442Q2Q4X9Seed maturation protein Medicago truncatula (Barrel medic) (Medicago tribuloides) 1 260 130 145 16 SALTIGEALEATAHTV 83.67
DP01442Q2Q4X9Seed maturation protein Medicago truncatula (Barrel medic) (Medicago tribuloides) 1 260 154 163 10 DASAIQAAEV 87.63
DP01442Q2Q4X9Seed maturation protein Medicago truncatula (Barrel medic) (Medicago tribuloides) 1 260 167 173 7 GSNVITP 84.62
DP01442Q2Q4X9Seed maturation protein Medicago truncatula (Barrel medic) (Medicago tribuloides) 1 260 182 190 9 SAAAFNAEC 84.06
DP01442Q2Q4X9Seed maturation protein Medicago truncatula (Barrel medic) (Medicago tribuloides) 1 260 200 208 9 GNVLTGATA 81.27
DP01442Q2Q4X9Seed maturation protein Medicago truncatula (Barrel medic) (Medicago tribuloides) 1 260 222 229 8 AGVASAEM 80.6
DP01443Q9UJX4Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) Homo sapiens (Human) 1 26 5 13 9 HESLYFNPM 92.53
DP01443Q9UJX4Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) Homo sapiens (Human) 1 24 5 13 9 HESLYFNPM 92.53
DP01443Q9UJX4Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) Homo sapiens (Human) 353 413 357 365 9 SYVLLEHSV 86.96
DP01443Q9UJX4Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) Homo sapiens (Human) 353 413 367 399 33 KAVHFGLPYLASLGIQSLVQQRAFAGKTANKLM 87.06
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 171 450 172 180 9 SLQNFSNCL 87.85
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 171 450 220 242 23 SNSKYSLNTDSSVSYIDSAVISP 87.81
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 171 450 293 305 13 GDGSYLQNYTNTP 90.89
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 171 450 419 445 27 TQPNINDSLEITKLDSSIISEGKISTI 86.57
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 180 447 220 242 23 SNSKYSLNTDSSVSYIDSAVISP 87.81
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 180 447 293 305 13 GDGSYLQNYTNTP 90.89
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 180 447 419 442 24 TQPNINDSLEITKLDSSIISEGKI 85.9
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 767 824 793 799 7 QEEQIMG 80.6
DP01445P30260Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) Homo sapiens (Human) 769 824 793 799 7 QEEQIMG 80.6
DP01448P10923Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) Mus musculus (Mouse) 17 294 146 154 9 DSLAYGLRS 82.27
DP01448P10923Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) Mus musculus (Mouse) 17 294 192 198 7 VAQLLSM 88.2
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 70 79 10 RLVSYTPAYL 91.64
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 123 154 32 VQQTLNSTNEIEALETSRLYEDSGYSSFSLQS 83.78
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 165 182 18 LEENFGDSLQSCLLQIQS 88.29
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 220 236 17 LKEIIARGNFRLQNIIG 91.3
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 258 285 28 VLATILAQLSDMDLINVSKVSTTWKKIL 83.86
DP01450Q9UKT4F-box only protein 5 (Early mitotic inhibitor 1) Homo sapiens (Human) 1 318 291 310 20 AFQLYSKAIQRVTENNNKFS 81.91
DP01452Q13042Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) Homo sapiens (Human) 528 620 529 536 8 DSEAYIGA 88.25
DP01452Q13042Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) Homo sapiens (Human) 528 620 554 560 7 TLKNIIS 87.48
DP01452Q13042Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) Homo sapiens (Human) 528 620 596 607 12 LEETFEIEMNES 86.2
DP01452Q13042Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) Homo sapiens (Human) 534 620 554 560 7 TLKNIIS 87.48
DP01452Q13042Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) Homo sapiens (Human) 534 620 596 607 12 LEETFEIEMNES 86.2
DP01453Q8NHZ8Anaphase-promoting complex subunit CDC26 (Anaphase-promoting complex subunit 12) (APC12) (Cell division cycle protein 26 homolog) Homo sapiens (Human) 26 85 44 52 9 GEGAIGLSS 82.16
DP01455Q96DE5Anaphase-promoting complex subunit 16 (APC16) (Cyclosome subunit 16) Homo sapiens (Human) 1 51 33 39 7 KALFTYP 94.08
DP01456Q01081Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) Homo sapiens (Human) 38 152 42 59 18 FSQTIALLNIYRNPQNSS 92.75
DP01456Q01081Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) Homo sapiens (Human) 38 152 74 99 26 MQEHYDEFFEEVFTEMEEKYGEVEEM 84.26
DP01456Q01081Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) Homo sapiens (Human) 38 152 110 118 9 VGNVYVKFR 88.29
DP01457Q92973Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP) Homo sapiens (Human) 319 371 320 337 18 DIDIILLKGDVEEDETIP 82.29
DP01461Q13188Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C) Homo sapiens (Human) 314 427 363 371 9 GTMVINSED 85.62
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 1 300 17 23 7 RNQEIQQ 80.27
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 1 300 91 98 8 NPNFFEQR 80.6
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 1 300 271 277 7 SSEHYSS 80.6
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 2 33 17 23 7 RNQEIQQ 80.27
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 300 600 511 517 7 TGNSYTD 80.94
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 300 600 580 586 7 GGLKIES 80.94
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 600 900 640 647 8 SREIIETD 80.6
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 600 900 684 694 11 EDSFFRQRMFS 83.61
DP01463Q9UHB7AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) Homo sapiens (Human) 600 900 711 724 14 RYPLIVKIDLNLLT 85.4
DP01464P28229Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein) Mus musculus (Mouse) 265 332 273 283 11 GAYNYPFTWNT 88.14
DP01464P28229Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein) Mus musculus (Mouse) 265 332 288 294 7 PGYNIAV 82.27
DP01464P28229Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein) Mus musculus (Mouse) 265 332 297 326 30 DQIQYTELSNAKIAYKQNKANIAQEQQYGS 83.31
DP01465Q8IW19Aprataxin and PNK-like factor (EC 3.1.-.-) (Apurinic-apyrimidinic endonuclease APLF) (PNK and APTX-like FHA domain-containing protein) (XRCC1-interacting protein 1) Homo sapiens (Human) 399 420 405 411 7 GGVQIVG 87.63
DP01466A4L7I2Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1707 1730 24 GAVHTLPTIIGNLAAVSDWVMSTV 81.05
DP01466A4L7I2Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1758 1767 10 ASVRFFRAEL 86.96
DP01466A4L7I2Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1825 1836 12 SELLTFGDFLPG 86.43
DP01467Q9SP32Endoribonuclease Dicer homolog 1 (EC 3.1.26.-) (Dicer-like protein 1) (AtDCL1) (Protein ABNORMAL SUSPENSOR 1) (Protein CARPEL FACTORY) (Protein SHORT INTEGUMENTS 1) (Protein SUSPENSOR 1) Arabidopsis thaliana (Mouse-ear cress) 1732 1811 1761 1768 8 TVEVFIDG 96.32
DP01468A3RMR8Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1707 1730 24 GAVHTLPTIIGNLAAVSDWVMSTV 81.05
DP01468A3RMR8Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1758 1767 10 ASVRFFRAEL 86.96
DP01468A3RMR8Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1825 1836 12 SELLTFGDFLPG 86.43
DP01469A4L7I4Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1707 1730 24 GAVHTLPTIIGNLAAVSDWVMSTV 81.05
DP01469A4L7I4Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1758 1767 10 ASVRFFRAEL 86.96
DP01469A4L7I4Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) Chikungunya virus (CHIKV) 1658 1856 1825 1836 12 SELLTFGDFLPG 86.43
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 61 72 12 RDITFDGEQAIK 86.79
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 74 84 11 DNSHYEDLYHS 80.27
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 96 104 9 DDLLILNME 87.81
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 192 198 7 EITNFSD 86.96
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 212 220 9 TDNQIAIQK 93.72
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 227 237 11 IEKAINEVPYR 82.94
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 248 261 14 SKGNINKSNEKIIT 83.52
DP01471P36118Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 322 276 288 13 SIERINEMVSKIC 86.11
DP01473Q96GU1P antigen family member 5 (PAGE-5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate-associated gene 5 protein) Homo sapiens (Human) 20 130 86 101 16 DVEAFQQELALLKIED 86.48
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 1 130 13 21 9 RPQNYLFGC 87.18
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 1 130 55 69 15 DELHIVEAEAMNYEG 87.16
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 1 130 90 96 7 GGFEITP 81.94
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 1 130 107 122 16 GPVHISGQHLVAVEED 86.62
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 159 294 251 257 7 MQASIEK 86.29
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 159 294 264 275 12 VEAKFINYVKNC 94.93
DP01474P06748Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) Homo sapiens (Human) 159 294 280 289 10 DQEAIQDLWQ 84.41
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 824 876 838 853 16 NSELYQSVKNSVNKTL 91.97
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 824 876 860 871 12 GIEATALAKNFS 83.61
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 880 889 10 KFKNFNNNNN 83.48
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 925 938 14 VNAKIDRLNQIASG 80.27
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1004 1031 28 LAQKIDNLNQAVSEAKAGFFGNLEQTID 88.41
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1041 1049 9 VMNLYVESA 88.52
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1059 1084 26 KLDNYAINSHTRINSNIQNGAINEKA 88.38
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1112 1120 9 SLSEYDKIG 87.96
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1131 1137 7 DSFKFST 83.95
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 877 1186 1149 1166 18 GFTHFLANAFSTGYYCLA 88.65
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 893 1001 925 938 14 VNAKIDRLNQIASG 80.27
DP01475P55980Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) 998 1038 1004 1031 28 LAQKIDNLNQAVSEAKAGFFGNLEQTID 88.41
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 806 815 10 TTVISESTYP 80.8
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 837 843 7 VTESYTT 80.65
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 861 867 7 NVVVTER 80.27
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 889 900 12 GSNVIVTERVIA 87.29
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 919 928 10 NVVVTERVIQ 80.27
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 946 954 9 AHNVIVTER 88.63
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 1000 1007 8 GIGLSSLG 80.27
DP01476Q02413Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) Homo sapiens (Human) 774 1049 1019 1028 10 SDHHFNQTIG 84.41
DP01478Q9UJX5Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4) Homo sapiens (Human) 480 521 494 505 12 GNQWYDFLQNSS 84.39
DP01479Q9UJX3Anaphase-promoting complex subunit 7 (APC7) (Cyclosome subunit 7) Homo sapiens (Human) 1 35 4 23 20 GDAAILESSLRILYRLFESV 84.36
DP01481Q5UPT2Probable uracil-DNA glycosylase (UDG) (EC 3.2.2.-) Acanthamoeba polyphaga mimivirus (APMV) 1 94 33 40 8 DNSVIIND 96.07
DP01482O13828mRNA decapping complex subunit 2 (EC 3.-.-.-) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 553 741 556 565 10 SAQLLQALLH 80.5
DP01482O13828mRNA decapping complex subunit 2 (EC 3.-.-.-) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 553 741 582 592 11 SLSLLTLLKSG 80.27
DP01482O13828mRNA decapping complex subunit 2 (EC 3.-.-.-) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 553 741 619 627 9 EVKNYSKST 83.28
DP01482O13828mRNA decapping complex subunit 2 (EC 3.-.-.-) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 553 741 645 654 10 AANQFDLLKV 82.61
DP01482O13828mRNA decapping complex subunit 2 (EC 3.-.-.-) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) 553 741 724 736 13 HFLSYLQSVVSSN 84.05
DP01484P04626Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) Homo sapiens (Human) 988 1255 1000 1010 11 LDSTFYRSLLE 91.97
DP01484P04626Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) Homo sapiens (Human) 988 1255 1019 1025 7 DAEEYLV 87
DP01484P04626Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) Homo sapiens (Human) 988 1255 1217 1225 9 FDNLYYWDQ 93.01
DP01486P11912B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a) Homo sapiens (Human) 166 226 184 203 20 DENLYEGLNLDDCSMYEDIS 90.97
DP01486P11912B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a) Homo sapiens (Human) 166 226 214 221 8 GSLNIGDV 88.29
DP01487P40259B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b) Homo sapiens (Human) 181 229 203 214 12 QTATYEDIVTLR 81.77
DP01487P40259B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b) Homo sapiens (Human) 181 229 216 222 7 GEVKWSV 87.29
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 83 2 8 7 RTISYSE 80.55
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 83 10 17 8 RQNLSATM 80.52
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 83 25 31 7 APILITR 87.63
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 83 36 57 22 ACVLMSLEEYNSLEETAYLLRS 85.28
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 55 2 8 7 RTISYSE 80.55
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 55 10 17 8 RQNLSATM 80.52
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 55 25 31 7 APILITR 87.63
DP01488P69346Antitoxin YefM Escherichia coli (strain K12) 1 55 36 50 15 ACVLMSLEEYNSLEE 87.63
DP01489Q9UBK2Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) Homo sapiens (Human) 2 220 60 101 42 DQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPV 85.5
DP01489Q9UBK2Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) Homo sapiens (Human) 2 220 153 161 9 NTQLSYNEC 93.94
DP01489Q9UBK2Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) Homo sapiens (Human) 2 220 181 191 11 AIVKTENSWSN 82.61
DP01489Q9UBK2Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) Homo sapiens (Human) 2 220 209 215 7 ELLKYLT 83.95
DP01490Q9NR61Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4) Homo sapiens (Human) 553 685 567 581 15 AMNNLSDFQKDNLIP 83.21
DP01490Q9NR61Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4) Homo sapiens (Human) 553 685 662 674 13 RDSMYQSVCLISE 87.45
DP01491P22059Oxysterol-binding protein 1 Homo sapiens (Human) 346 379 355 368 14 DENEFFDAPEIITM 85.38
DP01492Q01097Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) Mus musculus (Mouse) 1259 1482 1270 1280 11 VAVSSNASTTK 80.27
DP01492Q01097Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) Mus musculus (Mouse) 1259 1482 1303 1311 9 SYDTFVDLQ 80.94
DP01492Q01097Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) Mus musculus (Mouse) 1259 1482 1345 1358 14 GESSFANKSSVTTA 86.62
DP01492Q01097Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) Mus musculus (Mouse) 1259 1482 1399 1406 8 SKSYFFRQ 81.1
DP01495P08510Potassium voltage-gated channel protein Shaker (Protein minisleep) Drosophila melanogaster (Fruit fly) 513 655 581 592 12 LQQLTQTQLYQQ 91.39
DP01495P08510Potassium voltage-gated channel protein Shaker (Protein minisleep) Drosophila melanogaster (Fruit fly) 513 655 619 633 15 QSHTINASAAAATSG 80.33
DP01496P0AFG0Transcription termination/antitermination protein NusG Escherichia coli (strain K12) 45 65 48 54 7 EVVEIRG 86.96
DP01497Q9NK80Gliotactin Drosophila melanogaster (Fruit fly) 750 956 756 769 14 SDRFYDEDVFINGE 93.02
DP01497Q9NK80Gliotactin Drosophila melanogaster (Fruit fly) 750 956 795 803 9 RDNIYEYRD 90.41
DP01498O70480Vesicle-associated membrane protein 4 (VAMP-4) Mus musculus (Mouse) 47 117 60 76 17 VDEVIDVMQENITKVIE 92.6
DP01498O70480Vesicle-associated membrane protein 4 (VAMP-4) Mus musculus (Mouse) 47 117 94 102 9 NATAFSNRS 85.62
DP01499Q9JI51Vesicle transport through interaction with t-SNAREs homolog 1A (Vesicle transport v-SNARE protein Vti1-like 2) (Vti1-rp2) Rattus norvegicus (Rat) 115 192 141 162 22 AGYQIAVETEQIGQEMLENLSH 81.18
DP01501G3V7P1Syntaxin-12 (Syntaxin-13) Rattus norvegicus (Rat) 182 250 188 210 23 IQQLEADILDVNQIFKDLAMMIH 86.52
DP01501G3V7P1Syntaxin-12 (Syntaxin-13) Rattus norvegicus (Rat) 182 250 238 245 8 QRAAYYQK 90.84
DP01502P33328Synaptobrevin homolog 2 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 1 91 64 74 11 DNLAISAQGFK 83.31
DP01503P32867Protein SSO1 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 192 265 210 233 24 LTQLFNDMEELVIEQQENVDVIDK 87.35
DP01504P39926Protein SSO2 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 196 269 214 237 24 LTQLFNDMEELVIEQQENVDVIDK 87.35
DP01505P0AGB6ECF RNA polymerase sigma-E factor (RNA polymerase sigma-E factor) (Sigma-24) Escherichia coli (strain K12) 67 90 67 85 19 DSAFYTWLYRIAVNTAKNY 88.15
DP01508Q15418Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) Homo sapiens (Human) 683 735 698 708 11 MAATYSALNSS 85.16
DP01508Q15418Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) Homo sapiens (Human) 683 735 717 723 7 IESSILA 85.28
DP01508Q15418Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) Homo sapiens (Human) 696 735 698 708 11 MAATYSALNSS 85.16
DP01508Q15418Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) Homo sapiens (Human) 696 735 717 723 7 IESSILA 85.28
DP01509P9WIP5Protein MbtH Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 71 9 33 25 DNGAFFVLVNDEDQHSLWPVFADIP 87
DP01509P9WIP5Protein MbtH Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 1 71 47 58 12 ACLDYVEKNWTD 84.62
DP01511P32917Protein STE5 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 147 238 190 202 13 GEKIIELACGHLS 85.28
DP01511P32917Protein STE5 "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 147 238 204 215 12 QECLIISFGTTS 88.32
DP01512P03050Transcriptional repressor arc Salmonella phage P22 (Bacteriophage P22) 1 53 33 39 7 VNSEIYQ 91.3
DP01513P53378Tubulin gamma chain (Gamma-tubulin) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 439 473 442 463 22 QDSYLDDVLVDDENMVGELEED 80.6
DP01516Q06810Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 194 333 195 206 12 RASNILPIAYIP 83.97
DP01516Q06810Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 194 333 240 246 7 LGSSILD 80.94
DP01516Q06810Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 194 333 264 272 9 DDNLITAIR 84.39
DP01516Q06810Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 194 333 276 290 15 KLVQIAEEESDKEIQ 90.64
DP01516Q06810Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" 194 333 292 301 10 LDVIEEQTEA 85.62
DP01517Q06710Paired box protein Pax-8 Homo sapiens (Human) 1 27 16 22 7 LGGAFVN 85.95
DP01517Q06710Paired box protein Pax-8 Homo sapiens (Human) 62 86 62 69 8 LGRYYETG 84.62
DP01518P26367Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) Homo sapiens (Human) 1 130 11 19 9 LGGVFVNGR 80.6
DP01518P26367Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) Homo sapiens (Human) 1 130 25 33 9 TRQKIVELA 83.5
DP01518P26367Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) Homo sapiens (Human) 1 130 41 64 24 DISRILQVSNGCVSKILGRYYETG 81.72
DP01518P26367Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) Homo sapiens (Human) 1 130 83 91 9 VVSKIAQYK 88.29
DP01518P26367Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) Homo sapiens (Human) 1 130 96 103 8 SIFAWEIR 90.43
DP01518P26367Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) Homo sapiens (Human) 1 130 119 125 7 SVSSINR 87.63
DP01519A0A060ZAA1HTH_Tnp_Tc3_2 domain-containing protein Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) 50 106 83 96 14 TKVSISTVKRVLYR 84.28
DP01521Q5RJL0Ermin (Juxtanodin) (JN) Rattus norvegicus (Rat) 1 282 37 44 8 ETQTYYGV 91.56
DP01521Q5RJL0Ermin (Juxtanodin) (JN) Rattus norvegicus (Rat) 1 282 73 103 31 EDEKILNENTEENLFVVHQAIQDLSLQETSA 87.16
DP01521Q5RJL0Ermin (Juxtanodin) (JN) Rattus norvegicus (Rat) 1 282 151 169 19 TEIEWLGFQKSSQVDILHS 83.1
DP01521Q5RJL0Ermin (Juxtanodin) (JN) Rattus norvegicus (Rat) 1 282 178 186 9 WNEEINEED 87.63
DP01521Q5RJL0Ermin (Juxtanodin) (JN) Rattus norvegicus (Rat) 1 282 249 265 17 ARNSYSRYNTISYRKIR 87.29
DP01524Q9UM11Fizzy-related protein homolog (Fzr) (CDC20-like protein 1) (Cdh1/Hct1 homolog) (hCDH1) Homo sapiens (Human) 1 41 11 21 11 RQIVIQNENTM 87.29
DP01526Q9UJX6Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2) Homo sapiens (Human) 731 822 750 784 35 ELLLFWTYIQAML