CARs-DB

Waltz threshold =73.5

Waltz thresholds: 85 80

DisProt ID	UniProt Acc	Protein	Organism	Start (IDR)	End (IDR)	Start (CAR)	End (CAR)	CAR Length	Sequence	Waltz Score
DP00003	P03265	DNA-binding protein (DBP) (Early 2A protein) (Early E2A DNA-binding protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	294	334	294	304	11	EHVIEMDVTSE	79.93
DP00004	P49913	Cathelicidin antimicrobial peptide (18 kDa cationic antimicrobial protein) (CAP-18) (hCAP-18) Cleaved into: Antibacterial peptide FALL-39 (FALL-39 peptide antibiotic); Antibacterial peptide LL-37	Homo sapiens (Human)	134	170	134	141	8	LLGDFFRK	76.25
DP00004	P49913	Cathelicidin antimicrobial peptide (18 kDa cationic antimicrobial protein) (CAP-18) (hCAP-18) Cleaved into: Antibacterial peptide FALL-39 (FALL-39 peptide antibiotic); Antibacterial peptide LL-37	Homo sapiens (Human)	134	170	149	165	17	EFKRIVQRIKDFLRNLV	76.79
DP00005	P03045	Antitermination protein N (Regulatory protein N) (PN)	Escherichia phage lambda (Bacteriophage lambda)	1	107	15	30	16	QAQWKAANPLLVGVSA	77.17
DP00005	P03045	Antitermination protein N (Regulatory protein N) (PN)	Escherichia phage lambda (Bacteriophage lambda)	1	107	48	76	29	VESALNPIDLTVLAEYHKQIESNLQRIER	80.83
DP00005	P03045	Antitermination protein N (Regulatory protein N) (PN)	Escherichia phage lambda (Bacteriophage lambda)	1	36	15	30	16	QAQWKAANPLLVGVSA	77.17
DP00006	P00004	Cytochrome c	Equus caballus (Horse)	1	104	7	21	15	GKKIFVQKCAQCHTV	80.6
DP00006	P00004	Cytochrome c	Equus caballus (Horse)	1	104	45	76	32	PGFTYTDANKNKGITWKEETLMEYLENPKKYI	80.04
DP00006	P00004	Cytochrome c	Equus caballus (Horse)	1	104	78	87	10	GTKMIFAGIK	76.22
DP00006	P00004	Cytochrome c	Equus caballus (Horse)	1	104	92	99	8	REDLIAYL	81.52
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	48	54	7	TAVVLPH	75.25
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	56	63	8	PLATYSTV	76.05
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	84	90	7	CAGWLSQ	84.33
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	104	124	21	PYTEYVSHEAVSCPYSTDMYV	77.26
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	137	150	14	SSVLTYASPPLITN	91.81
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	189	195	7	SSLQYQP	76.25
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	206	213	8	VQLPISIP	80.6
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	226	251	26	AISSLTIDKLLLEEEESNTYELNHTL	78.69
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	65	48	54	7	TAVVLPH	75.25
DP00011	P0DMM9	Sulfotransferase 1A3 (ST1A3) (EC 2.8.2.1) (Aryl sulfotransferase 1A3/1A4) (Catecholamine-sulfating phenol sulfotransferase) (HAST3) (M-PST) (Monoamine-sulfating phenol sulfotransferase) (Placental estrogen sulfotransferase) (Sulfotransferase 1A3/1A4) (Sulfotransferase; monoamine-preferring) (Thermolabile phenol sulfotransferase) (TL-PST)	Homo sapiens (Human)	215	260	223	232	10	MVQHTSFKEM	74.75
DP00011	P0DMM9	Sulfotransferase 1A3 (ST1A3) (EC 2.8.2.1) (Aryl sulfotransferase 1A3/1A4) (Catecholamine-sulfating phenol sulfotransferase) (HAST3) (M-PST) (Monoamine-sulfating phenol sulfotransferase) (Placental estrogen sulfotransferase) (Sulfotransferase 1A3/1A4) (Sulfotransferase; monoamine-preferring) (Thermolabile phenol sulfotransferase) (TL-PST)	Homo sapiens (Human)	215	260	236	255	20	PMTNYTTVPQELMDHSISPF	78.04
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	659	673	15	NSILTETLHRFSLEG	75.18
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	675	682	8	APVSWTET	76.25
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	698	718	21	KNSILNPINSIRKFSIVQKTP	77.51
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	744	758	15	QGEAILPRISVISTG	78.64
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	766	774	9	RQSVLNLMT	77.52
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	779	785	7	QGQNIHR	84.62
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	799	810	12	QANLTELDIYSR	77.17
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	816	833	18	TGLEISEEINEEDLKECF	85.01
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	709	718	10	RKFSIVQKTP	74.55
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	744	758	15	QGEAILPRISVISTG	78.64
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	766	774	9	RQSVLNLMT	77.52
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	779	785	7	QGQNIHR	84.62
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	799	810	12	QANLTELDIYSR	77.17
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	816	826	11	TGLEISEEINE	84.68
DP00014	P05371	Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain	Rattus norvegicus (Rat)	66	97	68	76	9	SLLNSLEEA	80.27
DP00014	P05371	Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain	Rattus norvegicus (Rat)	386	447	403	409	7	VVVKLFD	84.71
DP00014	P05371	Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain	Rattus norvegicus (Rat)	386	447	436	442	7	ALQEYRR	90.64
DP00015	P61926	cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform)	Oryctolagus cuniculus (Rabbit)	1	76	2	15	14	TDVETTYADFIASG	79.34
DP00015	P61926	cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform)	Oryctolagus cuniculus (Rabbit)	1	76	22	51	30	AIHDILVSSASGNSNELALKLAGLDINKTE	77.65
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	38	44	7	MAGCIQE	79.93
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	47	57	11	ERWNFDFVTET	81.57
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	61	68	8	GDFAWERV	77.55
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	111	120	10	VDLSLSCTLV	74.88
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	147	159	13	MTDFYHSKRRLIF	80.86
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	94	38	44	7	MAGCIQE	79.93
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	94	47	57	11	ERWNFDFVTET	81.57
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	94	61	68	8	GDFAWERV	77.55
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	9	84	38	44	7	MAGCIQE	79.93
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	9	84	47	57	11	ERWNFDFVTET	81.57
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	9	84	61	68	8	GDFAWERV	77.55
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	23	35	13	VLVRTSACRSLFG	75.61
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	49	66	18	RLAELNAEDQNRWDYDFQ	75.4
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	76	82	7	RLQWTEV	86.62
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	86	95	10	SVPAFYRETV	78.09
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	109	117	9	VAVAVAVSP	74.73
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	173	181	9	VAVAVLAPA	77.03
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	239	248	10	ADQLHSGISG	74.98
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	254	278	25	TAAASANGAAIKKLSGPLISDFFAK	78.13
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	27	97	49	66	18	RLAELNAEDQNRWDYDFQ	75.4
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	27	97	76	82	7	RLQWTEV	86.62
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	27	97	86	92	7	SVPAFYR	78.02
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	1	198	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	1	198	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	1	198	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	1	50	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	105	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	105	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	105	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	97	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	97	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	97	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	25	93	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	25	93	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	25	93	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	55	95	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	55	95	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	66	88	70	81	12	LEGKYEWQEVEK	75.42
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	5	15	11	DDFETAPAEYV	81.57
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	40	60	21	AEVKANQNEENTGATAAETSE	75.94
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	78	88	11	VGVTTTTPSIA	79.93
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	92	106	15	ATANIASTSGASVTE	77.12
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	229	238	10	GVDNSNSNSD	74.98
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	246	264	19	KTEIISTNTNGATEDSTSE	76.98
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	279	296	18	QAQLLRQHVSSTASITSG	80.49
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	300	306	7	DLVQIEQ	81.08
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	313	320	8	NNNNSNVN	79.93
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	339	351	13	GNASFQAQRSMIS	75.3
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	594	674	598	604	7	RARNYSS	76.64
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	594	674	612	634	23	ANAASANAAAAAAAAASNSYAIP	77.74
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	594	674	642	669	28	DTMNFISSLKNDLSNISNSLPFEYPHEI	80.76
DP00021	P13551	Elongation factor G (EF-G)	Thermus thermophilus	40	67	43	57	15	GEVHEGAATMDFMEQ	74.31
DP00021	P13551	Elongation factor G (EF-G)	Thermus thermophilus	40	64	43	57	15	GEVHEGAATMDFMEQ	74.31
DP00024	P03129	Protein E7	Human papillomavirus type 16	1	40	7	14	8	TLHEYMLD	86.96
DP00024	P03129	Protein E7	Human papillomavirus type 16	1	40	19	35	17	TTDLYCYEQLNDSSEEE	80.17
DP00024	P03129	Protein E7	Human papillomavirus type 16	16	40	19	35	17	TTDLYCYEQLNDSSEEE	80.17
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	749	756	8	GNQSFEED	80.02
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	766	778	13	QGGNIVDIDFDSV	80.73
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	787	794	8	GNQSFEED	80.02
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	804	816	13	HGGNIIDIDFDSV	79.42
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	818	832	15	HIHGFNKHTEIIEED	76.77
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	846	853	8	NSVDFEED	76.92
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	749	756	8	GNQSFEED	80.02
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	766	778	13	QGGNIVDIDFDSV	80.73
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	787	794	8	GNQSFEED	80.02
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	804	816	13	HGGNIIDIDFDSV	79.42
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	818	832	15	HIHGFNKHTEIIEED	76.77
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	846	853	8	NSVDFEED	76.92
DP00026	P06179	Flagellin (Phase 1-I flagellin)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	65	1	41	41	MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSA	80.89
DP00026	P06179	Flagellin (Phase 1-I flagellin)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	65	46	60	15	AGQAIANRFTANIKG	83.21
DP00026	P06179	Flagellin (Phase 1-I flagellin)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	455	494	455	489	35	EDSDYATEVSNMSRAQILQQAGTSVLAQANQVPQN	76.88
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	97	36	51	16	ATSASVTLSDAQAKLM	79.35
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	97	54	61	8	GVSDINME	80.94
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	97	78	92	15	DTGKIADSLIREAQS	85.95
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	41	97	54	61	8	GVSDINME	80.94
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	41	97	78	92	15	DTGKIADSLIREAQS	85.95
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	1	118	32	47	16	GDYSTTPGGTLFSTTP	76.02
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	1	118	49	62	14	GTRIIYDRKFLMEC	82.68
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	1	55	32	47	16	GDYSTTPGGTLFSTTP	76.02
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	5	118	32	47	16	GDYSTTPGGTLFSTTP	76.02
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	5	118	49	62	14	GTRIIYDRKFLMEC	82.68
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	49	83	49	62	14	GTRIIYDRKFLMEC	82.68
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	50	84	50	62	13	TRIIYDRKFLMEC	82.3
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	80	91	12	KAVSLSMGLYMG	88.04
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	106	114	9	QQGQISLSS	81.05
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	117	135	19	TDLKLLEESIANLNRSTSV	82.47
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	179	202	24	GNVKLYTTDQSTFDILQDLEFSSG	78.34
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	215	227	13	SDLLIDENCLLSP	83.33
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	232	244	13	DDSFLLEGNSNED	77.98
DP00032	P56206	Glycine--tRNA ligase (EC 6.1.1.14) (Glycyl-tRNA synthetase) (GlyRS)	Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)	85	170	119	134	16	MEVEEENLHALVQAMM	75.08
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	271	299	29	IIFGIFGLTVMLFVFLFSKQQRIKMLILP	84.02
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	320	330	11	EEVNTILAIHD	87.35
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	341	351	11	SWVEFIELDID	78.9
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	362	369	8	TDRLLSSD	73.91
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	393	407	15	DILETDFNANDIHEG	78.93
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	421	428	8	ADLLCLDQ	77.26
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	445	453	9	QPSVIQAEK	75.25
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	469	494	26	QAAHIQLSNPSSLSNIDFYAQVSDIT	83.32
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	497	503	7	GSVVLSP	78.93
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	524	539	16	CQENFLMDNAYFCEAD	82.48
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	561	575	15	NQEDIYITTESLTTA	80.91
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	596	613	18	TSIHIVQSPQGLILNATA	83.02
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	5	22	18	DSVETMDEISNPNNILLP	82.72
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	30	41	12	ATGISGSQEPYG	74.58
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	58	69	12	DEPLIEDIVNPS	80.52
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	89	101	13	LQQPISLDHVITR	78.29
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	105	136	32	AGGVYSIGNSSTSSAAKLSDGDLTNATDPLLN	76.41
DP00037	Q9Y9L0	Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin)	Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)	197	250	207	216	10	CLDWWFCWDT	81.81
DP00037	Q9Y9L0	Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin)	Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)	197	250	221	230	10	DDVEEARRYL	76.25
DP00037	Q9Y9L0	Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin)	Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)	197	250	238	245	8	AKLLYEEA	77.97
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	11	22	12	KMSSYAYFVQTR	81.1
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	33	41	9	ASVNFSEFS	89.37
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	97	107	11	PSSAFFIFCAD	82.7
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	128	144	17	LGEKWNNLTAEDKVPYE	79.58
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	157	163	7	DITAYRN	79.93
DP00043	P02929	Protein TonB	Escherichia coli (strain K12)	103	151	138	146	9	ATAATSKPV	75.59
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	8	20	13	QRSKYLASASTMD	77.46
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	38	46	9	SLGRFFGSD	79.04
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	84	93	10	PVVHFFKNIV	86.76
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	107	117	11	GLSLSRFSWGA	76.28
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	145	156	12	AQGTLSKIFKLG	79.68
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	109	8	20	13	QRSKYLASASTMD	77.46
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	109	38	46	9	SLGRFFGSD	79.04
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	109	84	93	10	PVVHFFKNIV	86.76
DP00048	P03406	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) (HIV-1)	149	178	158	166	9	KGENTSLLH	75.7
DP00048	P03406	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) (HIV-1)	149	177	158	166	9	KGENTSLLH	75.7
DP00049	P70475	Myelin transcription factor 1-like protein	Rattus norvegicus	487	606	558	565	8	GHVNSNRN	86.62
DP00051	P07805	Ornithine decarboxylase (ODC) (EC 4.1.1.17)	Trypanosoma brucei brucei	1	35	9	21	13	LSCRFLEGFNTRD	78.72
DP00051	P07805	Ornithine decarboxylase (ODC) (EC 4.1.1.17)	Trypanosoma brucei brucei	1	35	23	30	8	LCKKISMN	76.25
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	22	39	18	TEVAEEIVEEETVVEETG	79.08
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	47	69	23	VQVEMGEFEDGAEETVEEVVADN	75.24
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	103	128	26	PIGEFEKVCSNDNKTFDSSCHFFATK	78.52
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	140	152	13	LHLDYIGPCKYIA	80.65
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	155	163	9	LDSELTEFP	74.21
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	167	180	14	RDWLKNVLVTLYER	83.09
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	183	190	8	GNNLLTEK	78.18
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	219	250	32	FEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTE	81.52
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	265	273	9	TTRFFETCD	79.52
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	276	297	22	NDKYIALEEWAGCFGIKEQDIN	81.73
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	101	2	20	19	LEEALAAIQNARDLEELKA	77.29
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	101	29	35	7	KGLLTQE	75.92
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	101	51	69	19	GQELNAIKAALEAALEARE	78.17
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	84	2	20	19	LEEALAAIQNARDLEELKA	77.29
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	84	29	35	7	KGLLTQE	75.92
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	84	51	69	19	GQELNAIKAALEAALEARE	78.17
DP00054	P78356	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta)	Homo sapiens (Human)	1	33	9	18	10	TAVAVAPLSA	74.58
DP00054	P78356	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta)	Homo sapiens (Human)	304	342	313	322	10	GGNLLCSYGT	83.95
DP00054	P78356	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta)	Homo sapiens (Human)	304	342	328	337	10	GNLLSFPRFF	80.87
DP00055	P10688	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1)	Rattus norvegicus (Rat)	130	202	140	147	8	KLQHWIHS	79.06
DP00055	P10688	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1)	Rattus norvegicus (Rat)	130	202	158	165	8	NKMNFKEL	74.25
DP00055	P10688	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1)	Rattus norvegicus (Rat)	130	202	170	188	19	KELNIQVDDGYARKIFREC	78.51
DP00055	P10688	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1)	Rattus norvegicus (Rat)	445	482	463	470	8	VEAAEMED	73.91
DP00061	P27694	Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) Cleaved into: Replication protein A 70 kDa DNA-binding subunit; N-terminally processed	Homo sapiens (Human)	105	180	108	119	12	VGVKIGNPVPYN	83.61
DP00061	P27694	Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) Cleaved into: Replication protein A 70 kDa DNA-binding subunit; N-terminally processed	Homo sapiens (Human)	105	180	155	166	12	VSKAYGASKTFG	75.14
DP00061	P27694	Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) Cleaved into: Replication protein A 70 kDa DNA-binding subunit; N-terminally processed	Homo sapiens (Human)	109	168	155	163	9	VSKAYGASK	75.33
DP00062	P19793	Retinoic acid receptor RXR-alpha (Nuclear receptor subfamily 2 group B member 1) (Retinoid X receptor alpha)	Homo sapiens (Human)	1	130	9	21	13	LDFSTQVNSSLTS	80.63
DP00062	P19793	Retinoic acid receptor RXR-alpha (Nuclear receptor subfamily 2 group B member 1) (Retinoid X receptor alpha)	Homo sapiens (Human)	1	130	84	96	13	TLGFSTGSPQLSS	75.59
DP00063	P49799	Regulator of G-protein signaling 4 (RGP4) (RGS4)	Rattus norvegicus (Rat)	1	50	22	31	10	RLGFLLQKSD	74.98
DP00064	P03607	Capsid protein (Coat protein)	Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea))	1	64	1	8	8	MSGLFHHR	77.26
DP00064	P03607	Capsid protein (Coat protein)	Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea))	1	64	13	25	13	EIRAFVMATRLTK	76.79
DP00064	P03607	Capsid protein (Coat protein)	Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea))	1	64	28	36	9	LAQAIQNTL	87.55
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	571	580	10	KIGNYVWEDT	90.77
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	584	590	7	GVQELGE	75.25
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	593	606	14	VGNVTVTVFDNNTN	79.77
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	616	624	9	EDGSYLIPN	84.76
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	630	638	9	YRVEFSNLP	77
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	659	666	8	LSSVITVN	84.95
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	668	692	25	KDNLSADLGIYKPKYNLGDYVWEDT	84.78
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	708	735	28	VTVTLKDENGNVLKTVTTDADGKYKFTD	77.26
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	737	752	16	DNGNYKVEFTTPEGYT	77.63
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	754	763	10	TTVTSGSDIE	75.59
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	767	803	37	NGLTTTGVINGADNMTLDSGFYKTPKYNLGNYVWEDT	82.3
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	819	835	17	VTVTLKNENGEVLQTTK	76.35
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	838	863	26	KDGKYQFTGLENGTYKVEFETPSGYT	75.89
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	871	888	18	TDEGIDSNGTSTTGVIKD	75.92
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	894	913	20	IDSGFYKPTYNLGDYVWEDT	80.55
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	939	973	35	KVLKTVTTDENGKYQFTDLNNGTYKVEFETPSGYT	76.29
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	988	1023	36	NGLTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYD	78.2
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	1040	1056	17	VKVTLLNEKGEVIGTTK	76.08
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	1059	1079	21	ENGKYCFDNLDSGKYKVIFEK	80.97
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	1102	1108	7	VDVTITD	97.32
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	1110	1118	9	DDFTLDNGY	78.93
DP00066	P27285	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus)	1	113	2	10	9	NRGFFNMLG	87.18
DP00066	P27285	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus)	1	113	38	57	20	LASQIQQLTTAVSALVIGQA	81.59
DP00067	Q57733	Small heat shock protein HSP16.5	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	1	32	7	27	21	FDSLFERMFKEFFATPMTGTT	83.9
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	18	28	11	ADQLADESLES	74.03
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	33	51	19	LQLVEESKDAGIRTLVMLD	78.31
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	56	70	15	QLERIEEGMDQINKD	76.72
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	80	89	10	DLGKFCGLCV	79.93
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	125	136	12	EQMAISGGFIRR	81.3
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	146	161	16	MDENLEQVSGIIGNLR	82.32
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	14	29	16	GVVAAAEKTKQGVAEA	76.42
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	35	41	7	EGVLYVG	97.32
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	50	66	17	HGVATVAEKTKEQVTNV	76.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	84	98	15	GAGSIAAATGFVKKD	79.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	109	116	8	QEGILEDM	74.92
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	121	127	7	DNEAYEM	80.12
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	129	135	7	SEEGYQD	78.02
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	14	29	16	GVVAAAEKTKQGVAEA	76.42
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	35	41	7	EGVLYVG	97.32
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	50	66	17	HGVATVAEKTKEQVTNV	76.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	84	98	15	GAGSIAAATGFVKKD	79.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	14	29	16	GVVAAAEKTKQGVAEA	76.42
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	35	41	7	EGVLYVG	97.32
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	50	66	17	HGVATVAEKTKEQVTNV	76.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	84	97	14	GAGSIAAATGFVKK	79.84
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	42	92	50	66	17	HGVATVAEKTKEQVTNV	76.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	42	92	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	61	95	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	61	95	84	90	7	GAGSIAA	84.42
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	101	140	109	116	8	QEGILEDM	74.92
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	101	140	121	127	7	DNEAYEM	80.12
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	101	140	129	135	7	SEEGYQD	78.02
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	103	140	109	116	8	QEGILEDM	74.92
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	103	140	121	127	7	DNEAYEM	80.12
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	103	140	129	135	7	SEEGYQD	78.02
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	104	140	109	116	8	QEGILEDM	74.92
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	104	140	121	127	7	DNEAYEM	80.12
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	104	140	129	135	7	SEEGYQD	78.02
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	12	25	14	SVSDILSPLEESYK	77.78
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	37	43	7	PLAAYRQ	76.92
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	62	72	11	GAVTAAYHMTA	75.83
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	77	95	19	QLSHSAVGGYCNGNLGNMS	75.04
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	121	129	9	RFPAISRFM	84.84
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	58	78	62	72	11	GAVTAAYHMTA	75.83
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	9951	9960	10	APEIIDVSSK	86.96
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	9962	9970	9	EEVKIMTIT	88.52
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	9979	9985	7	KEAVYEK	78.6
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	9993	10023	31	KRVFIESFEEPYDELEVEPYTEPFEQPYYEE	80.65
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10027	10033	7	DYEEIKV	80.6
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10039	10061	23	VHEEWEEDFEEGQEYYEREEGYD	87.97
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10063	10088	26	GEEEWEEAYQEREVIQVQKEVYEESH	80.98
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10112	10120	9	VIEKIEKTS	78.37
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10151	10159	9	QEEVIEVKV	83.02
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10166	10188	23	KMVISEEKMFFASHTEEEVSVTV	78.1
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10191	10208	18	VQKEIVTEEKIHVAISKR	78.3
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10305	10318	14	GVVTEEKITIVTQR	80.72
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10394	10405	12	RFVAEEKLSFAV	76.42
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10418	10438	21	AEEEWSYSEEEEGVSISVYRE	87.69
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10447	10474	28	AEVTEYEVMEEPEEYVVEEKLHIISKRV	81.63
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10479	10492	14	AEVTERQEKKIVLK	76.97
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10567	10582	16	HMQITQEEKVLVAVTK	78.07
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10617	10623	7	AKVTEFR	75.25
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10630	10636	7	EKVSIEA	79.55
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10653	10666	14	KERAYTLEEEAVSV	80.27
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10668	10715	48	REEEYEEYEEYDYKEFEEYEPTEEYDQYEEYEEREYERYEEHEEYITE	79.87
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10774	10784	11	FEEKIRISITK	76.65
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10833	10875	43	EEVAFEEEVVTHVEEYLVEEEEEYIHEEEEFITEEEVVPVIPV	81.43
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11032	11041	10	EEVLFEEEIV	86.92
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11124	11130	7	KKVVIPK	77.26
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11271	11283	13	RTVLEEKVSVAFR	80.65
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11291	11336	46	RLELEVVEAEVEEIPEEEEFHEVEEYFEEGEFHEVEEFIKLEQHRV	80.6
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11345	11360	16	VHRVIEVFEAEEVEVF	78.11
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11402	11408	7	KIVVEEK	77.26
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11597	11603	7	EEVALEE	76.25
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11606	11612	7	AEVVEEP	76.25
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11733	11744	12	EPEEIAPEEEIA	76.59
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11820	11830	11	VKEKIFQLKAI	77.77
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	12	25	14	MALLHQIQGNELEP	75.92
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	39	46	8	LGEVYLDS	87.5
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	48	75	28	KPAVYNYPEGAAYEFNAAAAANAQVYGQ	83.25
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	85	92	8	EAAAFGSN	77.01
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	126	136	11	QQVPYYLENEP	78.84
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	1	206	8	19	12	NDSQIEADFRLN	77.45
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	1	206	106	112	7	KENGFSS	73.91
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	1	174	8	19	12	NDSQIEADFRLN	77.45
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	1	174	106	112	7	KENGFSS	73.91
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	175	214	201	209	9	QKWKWWEEE	77.18
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	636	712	639	652	14	TFEKSMMNLQTKID	78.12
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	631	651	638	644	7	IDLAFSK	91.97
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	634	681	638	644	7	IDLAFSK	91.97
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	634	681	651	658	8	KEWLRQYE	75.33
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	634	681	666	676	11	TLKEIPISDFI	76.95
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1070	1105	1075	1085	11	IAEQINDVKGA	75.55
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1071	1105	1075	1085	11	IAEQINDVKGA	75.55
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1222	1239	18	EDKNFERILLEQKLVTKS	77.16
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1269	1277	9	SSSSIFDIK	81.53
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1285	1301	17	ELSKISNKFKKISTIFD	81.43
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1318	1329	12	DDVATKKNQTTA	75.25
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1348	1354	7	KVVELSG	77.64
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1356	1366	11	SDLEILDSYTD	81.39
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1397	1417	21	SYVETLELSDDSFIEDDEEEN	77.66
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	216	225	10	MSVASLDLTG	77.26
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	235	245	11	SEEAFTLPLLN	75.13
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	270	278	9	DDFLFPASS	91.97
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	294	306	13	LSGSFYAADWEPL	77.18
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	333	346	14	SCTAYTSSFVFTYP	87.03
DP00079	Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	Homo sapiens (Human)	1	103	12	24	13	SPSSYNCSQSILP	78.06
DP00079	Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	Homo sapiens (Human)	1	103	26	37	12	EHGSIYIPSSYV	83
DP00079	Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	Homo sapiens (Human)	1	103	44	67	24	PAMTFYSPAVMNYSIPSNVTNLEG	77.66
DP00081	P51123	Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230)	Drosophila melanogaster (Fruit fly)	11	77	20	29	10	LTGILFGNID	88.96
DP00081	P51123	Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230)	Drosophila melanogaster (Fruit fly)	11	77	52	63	12	LRENIGSLSKLG	80.94
DP00081	P51123	Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230)	Drosophila melanogaster (Fruit fly)	11	77	66	72	7	SMLLEVI	78.26
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	393	401	9	LEAEIETTT	76.33
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	410	420	11	TVSHILNVLKD	75.8
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	424	434	11	IEDVFSFNYPE	88.08
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	446	462	17	EHVKYTYGPTFLLQFKD	80.01
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	468	481	14	ADAEWVQSTASKIV	83.42
DP00083	P03069	General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	101	134	106	115	10	PMFEYENLED	78.86
DP00083	P03069	General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	101	134	118	129	12	KEWTSLFDNDIP	89.19
DP00083	P03069	General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	225	281	257	274	18	VEELLSKNYHLENEVARL	77
DP00084	P61244	Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X)	Homo sapiens (Human)	2	110	60	75	16	RAQILDKATEYIQYMR	79.58
DP00084	P61244	Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X)	Homo sapiens (Human)	2	110	90	101	12	RQNALLEQQVRA	79.77
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	437	447	11	SEALLQLQFDD	82.67
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	451	458	8	GALLGNST	76.17
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	460	484	25	PAVFTDLASVDNSEFQQLLNQGIPV	77.79
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	492	507	16	MLMEYPEAITRLVTGA	80.18
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	525	546	22	NGLLSGDEDFSSIADMDFSALL	79.45
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	93	14	26	13	LSQETFSDLWKLL	84.56
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	93	49	56	8	DIEQWFTE	78.6
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	73	14	26	13	LSQETFSDLWKLL	84.56
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	73	49	56	8	DIEQWFTE	78.6
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	39	14	26	13	LSQETFSDLWKLL	84.56
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	14	60	14	26	13	LSQETFSDLWKLL	84.56
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	14	60	49	55	7	DIEQWFT	79.31
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	20	73	49	56	8	DIEQWFTE	78.6
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	41	62	49	56	8	DIEQWFTE	78.6
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	320	393	323	352	30	LDGEYFTLQIRGRERFEMFRELNEALELKD	76.74
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	325	356	325	351	27	GEYFTLQIRGRERFEMFRELNEALELK	75.86
DP00087	P68336	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)	350	394	367	380	14	TRNNYGSTIEGLLD	80.65
DP00087	P68336	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)	413	490	417	432	16	TDVSLGDELRLDGEEV	75.92
DP00087	P68336	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)	413	490	461	469	9	DPVSYGALD	77.26
DP00087	P68336	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)	413	490	471	485	15	DDFEFEQMFTDAMGI	76.32
DP00088	P0ABI8	Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1)	Escherichia coli (strain K12)	1	51	17	46	30	VMVTIAGIILGGLALVGLITYFGKWTYLWK	83.99
DP00088	P0ABI8	Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1)	Escherichia coli (strain K12)	553	663	561	568	8	RDAFWEMK	80.85
DP00088	P0ABI8	Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1)	Escherichia coli (strain K12)	553	663	579	585	7	HYEEIHM	75.49
DP00088	P0ABI8	Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1)	Escherichia coli (strain K12)	553	663	591	658	68	AGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPVAEIEKLENQHFDEITKAG	83.22
DP00089	P0ABJ1	Cytochrome bo(3) ubiquinol oxidase subunit 2 (Cytochrome b562-o complex subunit II) (Cytochrome o ubiquinol oxidase subunit 2) (Cytochrome o subunit 2) (Oxidase bo(3) subunit 2) (Ubiquinol oxidase chain B) (Ubiquinol oxidase polypeptide II) (Ubiquinol oxidase subunit 2)	Escherichia coli (strain K12)	1	26	2	21	20	RLRKYNKSLGWLSLFAGTVL	86.07
DP00090	Q14722	Voltage-gated potassium channel subunit beta-1 (EC 1.1.1.-) (K(+) channel subunit beta-1) (Kv-beta-1)	Homo sapiens (Human)	1	62	9	19	11	AGSQISEENTK	77.26
DP00090	Q14722	Voltage-gated potassium channel subunit beta-1 (EC 1.1.1.-) (K(+) channel subunit beta-1) (Kv-beta-1)	Homo sapiens (Human)	1	62	22	28	7	RQSGFSV	75.59
DP00091	P27088	DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog)	Xenopus laevis (African clawed frog)	1	84	14	28	15	EEEKILSAAVRAKIE	77.86
DP00091	P27088	DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog)	Xenopus laevis (African clawed frog)	1	84	66	76	11	GGGFFIEEEEA	78.63
DP00091	P27088	DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog)	Xenopus laevis (African clawed frog)	181	265	184	197	14	SLEVWGSEEALEEA	79.74
DP00091	P27088	DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog)	Xenopus laevis (African clawed frog)	181	265	253	260	8	KTCITCGY	77.38
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	521	393	424	32	KEVIRNKIRAIGKMARVFSVLREESESVLTLK	80.19
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	521	444	462	19	LQSATVEAIEADEAIKGFS	84.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	521	466	473	8	KITSFEEA	74.25
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	521	492	508	17	SDANLNSINKALTSETN	83.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	468	393	424	32	KEVIRNKIRAIGKMARVFSVLREESESVLTLK	80.19
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	468	444	462	19	LQSATVEAIEADEAIKGFS	84.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	466	393	424	32	KEVIRNKIRAIGKMARVFSVLREESESVLTLK	80.19
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	466	444	461	18	LQSATVEAIEADEAIKGF	84.82
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	374	468	393	424	32	KEVIRNKIRAIGKMARVFSVLREESESVLTLK	80.19
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	374	468	444	462	19	LQSATVEAIEADEAIKGFS	84.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	390	414	393	409	17	KEVIRNKIRAIGKMARV	80.27
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	467	521	492	508	17	SDANLNSINKALTSETN	83.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	487	521	492	508	17	SDANLNSINKALTSETN	83.99
DP00094	P04177	Tyrosine 3-monooxygenase (EC 1.14.16.2) (Tyrosine 3-hydroxylase) (TH)	Rattus norvegicus (Rat)	1	71	26	36	11	AEAVTSPRFIG	74.58
DP00094	P04177	Tyrosine 3-monooxygenase (EC 1.14.16.2) (Tyrosine 3-hydroxylase) (TH)	Rattus norvegicus (Rat)	1	71	38	44	7	RQSLIED	91.97
DP00097	P10922	"Histone H1.0 (Histone H1) (Histone H1(0)) (MyD196) Cleaved into: Histone H1.0; N-terminally processed"	Mus musculus (Mouse)	1	30	1	8	8	MTENSTSA	73.91
DP00097	P10922	"Histone H1.0 (Histone H1) (Histone H1(0)) (MyD196) Cleaved into: Histone H1.0; N-terminally processed"	Mus musculus (Mouse)	96	193	103	110	8	RSVAFKKT	80.6
DP00099	P50440	Glycine amidinotransferase; mitochondrial (EC 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase)	Homo sapiens (Human)	38	63	39	46	8	TQAATASS	80.27
DP00100	P0A6H5	ATP-dependent protease ATPase subunit HslU (Heat shock protein HslU) (Unfoldase HslU)	Escherichia coli (strain K12)	175	209	182	188	7	MGVEIMA	81.37
DP00103	P09372	Protein GrpE (HSP-70 cofactor) (HSP24) (Heat shock protein B25.3)	Escherichia coli (strain K12)	1	32	13	27	15	APEEIIMDQHEEIEA	82.16
DP00104	P32773	Transcription initiation factor IIA large subunit (TFIIA large subunit) (TFIIA 32 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	240	227	234	8	DDYLISEG	81.73
DP00107	P69924	Ribonucleoside-diphosphate reductase 1 subunit beta (EC 1.17.4.1) (Protein B2) (Protein R2) (Ribonucleotide reductase 1)	Escherichia coli (strain K12)	342	376	352	364	13	VEVSSYLVGQIDS	79.21
DP00110	P40881	Carbonic anhydrase (EC 4.2.1.1)	Methanosarcina thermophila	1	37	4	27	24	NKQIFTILILSLSLALAGSGCISE	79.29
DP00111	P27577	Protein C-ets-1 (p54)	Mus musculus (Mouse)	244	301	248	260	13	GQDSFESVESYDS	79.52
DP00111	P27577	Protein C-ets-1 (p54)	Mus musculus (Mouse)	244	301	264	278	15	LTQSWSSQSSFNSLQ	81.34
DP00111	P27577	Protein C-ets-1 (p54)	Mus musculus (Mouse)	244	301	282	292	11	SYDSFDYEDYP	74.46
DP00112	P22239	Desiccation-related protein clone PCC6-19 (CDET6-19)	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	155	13	22	10	HTDEYGNPIQ	73.91
DP00112	P22239	Desiccation-related protein clone PCC6-19 (CDET6-19)	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	155	121	128	8	DQQQYGTA	76.46
DP00113	P31109	Synaptobrevin homolog 1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	93	32	51	20	LQAEIDDTVGIMRDNINKVA	82.84
DP00113	P31109	Synaptobrevin homolog 1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	93	64	75	12	ADNLAVSAQGFK	75.59
DP00116	P81455	Osteocalcin (Bone Gla protein) (BGP) (Gamma-carboxyglutamic acid-containing protein)	Canis lupus familiaris (Dog) (Canis familiaris)	1	49	32	44	13	LADHIGFQEAYQR	84.05
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	4	24	21	AAVLALLLCAGQVIALPVNSP	83.09
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	32	44	13	VMKCIVEVISDTL	82.76
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	62	85	24	GDERILSILRHQNLLKELQDLALQ	77.76
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	96	110	15	KHSSYEDELSEVLEK	77.93
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	118	126	9	KEVTEEVSS	74.58
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	306	312	7	PQVLFRG	87.96
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	423	444	22	DQELESLSAIEAELEKVAHQLE	78.46
DP00119	P10163	Basic salivary proline-rich protein 4 (Salivary proline-rich protein Po) (Parotid o protein) (Salivary proline-rich protein II-1) Cleaved into: Protein N1; Glycosylated protein A; Peptide P-D (Proline-rich peptide IB-5)	Homo sapiens (Human)	17	310	24	34	11	SQEESLFLISG	85.74
DP00120	P12957	Caldesmon (CDM)	Gallus gallus (Chicken)	636	771	636	647	12	RLEQYTSAVVGN	78.15
DP00120	P12957	Caldesmon (CDM)	Gallus gallus (Chicken)	636	771	700	710	11	VSSRINEWLTK	82.73
DP00120	P12957	Caldesmon (CDM)	Gallus gallus (Chicken)	636	771	733	744	12	KRNLWEKQSVEK	75.92
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	1	135	16	22	7	SASLTEA	77.26
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	1	135	63	69	7	SQGTYSD	90.64
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	1	135	71	108	38	KENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKG	79.04
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	136	297	146	156	11	TAALEEDLLTA	77.68
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	136	297	226	256	31	FAQTFGTNLEDIKQITEPSITVPSIGLSAEP	78.03
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	136	297	262	270	9	QKDWFIEMP	81.46
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	298	467	318	325	8	HGGSFTLP	77.01
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	298	467	337	349	13	GSQPFAPVFFQSD	78.42
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	298	467	386	410	25	SEATTVLGDVHSPAVEGFVGENISG	76.84
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	298	467	441	454	14	KLEETSKVSIEETV	75.97
DP00123	P01730	T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4)	Homo sapiens (Human)	398	458	398	421	24	ALIVLGGVAGLLLFIGLGIFFCVR	83.4
DP00125	P63292	Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH)	Bos taurus (Bovine)	30	60	31	41	11	YADAIFTNSYR	81.06
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	403	414	12	GYKTFEEIQKEE	89.05
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	425	436	12	AVDEIKQEIKFT	80.16
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	439	448	10	SSVASTRNTL	74.25
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	457	463	7	AGMNTLG	73.91
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	470	480	11	EQLNNVEGNLD	74.58
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	499	513	15	LNRSILAVHVSNPFN	74.72
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	540	568	29	SQQLSQSTQRIEGAMNANNNISEVRERYQ	77.33
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	570	585	16	KNVLEKAKRYQFENDE	74.46
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	590	608	19	MELEIDRNLDQIQQVSNRL	81.83
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	610	616	7	KMALTTG	75.54
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	625	645	21	RLNNIEESTDDLDINLHMNTN	76.25
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	9	21	13	ARVALLLLLVLGS	80.27
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	40	67	28	VDRVINVNAKNYKNVFKKYEVLALLYHE	80.84
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	81	106	26	MEELILELAAQVLEDKGVGFGLVDSE	80.06
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	114	160	47	KLGLTEEDSIYVFKEDEVIEYDGEFSADTLVEFLLDVLEDPVELIEG	82.04
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	163	209	47	ELQAFENIEDEIKLIGYFKNKDSEHYKAFKEAAEEFHPYIPFFATFD	83.35
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	216	237	22	LTLKLNEIDFYEAFMEEPVTIP	83.9
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	242	253	12	SEEEIVNFVEEH	84.36
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	266	272	7	MYETWED	82.61
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	275	286	12	DGIHIVAFAEEA	83.86
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	289	317	29	DGYEFLEILKSVAQDNTDNPDLSIIWIDP	78.06
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	322	355	34	LLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEM	76.8
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	364	383	20	AEELEDWLEDVLEGEINTED	80.27
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	12	18	7	GLECIRA	79.93
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	25	41	17	GSLAIEEAMAAWSEISD	76.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	64	72	9	CLSAIGSTE	81.94
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	99	115	17	NLQASSTGLQCYYVYDH	85.58
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	125	131	7	DADSIMV	79.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	161	167	7	EGYAITD	83.18
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	235	253	19	RLASFGTEIASLLTGGATQ	77.28
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	278	287	10	NAALIQEWTP	81.34
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	12	18	7	GLECIRA	79.93
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	25	41	17	GSLAIEEAMAAWSEISD	76.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	64	72	9	CLSAIGSTE	81.94
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	99	115	17	NLQASSTGLQCYYVYDH	85.58
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	125	131	7	DADSIMV	79.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	161	167	7	EGYAITD	83.18
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	12	18	7	GLECIRA	79.93
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	25	41	17	GSLAIEEAMAAWSEISD	76.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	64	72	9	CLSAIGSTE	81.94
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	99	115	17	NLQASSTGLQCYYVYDH	85.58
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	125	131	7	DADSIMV	79.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	161	167	7	EGYAITD	83.18
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	50	12	18	7	GLECIRA	79.93
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	50	25	41	17	GSLAIEEAMAAWSEISD	76.84
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	282	288	7	AEDVIQV	79.93
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	300	309	10	NGKLIQEIVD	91.84
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	314	325	12	VRVRIEAENEKN	75.5
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	356	366	11	LDIKENSTHFS	75.13
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	376	388	13	VLVASSVVAGESQ	85.62
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	397	417	21	GMVPFVFVGTKDSIANATVLL	82.18
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	457	465	9	KEKSYVTDD	77.26
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	493	504	12	NSEASNASETES	73.91
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	507	516	10	RDELSDWSLA	77.39
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	577	587	11	SLQIRVDCNNE	76.25
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	594	600	7	TLQNTSS	80.7
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	457	465	9	KEKSYVTDD	77.26
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	493	504	12	NSEASNASETES	73.91
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	507	516	10	RDELSDWSLA	77.39
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	577	587	11	SLQIRVDCNNE	76.25
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	594	600	7	TLQNTSS	80.7
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	516	632	577	587	11	SLQIRVDCNNE	76.25
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	516	632	594	600	7	TLQNTSS	80.7
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	3	16	14	NAANTGTTNESNVS	75.44
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	31	45	15	DIEKILQPNDIFTTD	84.3
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	48	62	15	DASTTSSTAIEDIIN	80.18
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	76	83	8	SSSFFHDS	77.93
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	98	108	11	PLGIYQTNLYG	87.23
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	119	127	9	STLLSSKLL	75.92
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	142	148	7	QHAVYRA	79.79
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	260	332	268	274	7	LLEKIIR	80.98
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	260	332	304	327	24	GSNNSNNNISSSNSFFNNGHLLQG	78.62
DP00136	P15865	Histone H1.4 (H1d)	Rattus norvegicus (Rat)	31	119	40	52	13	VSELITKAVAASK	76.33
DP00136	P15865	Histone H1.4 (H1d)	Rattus norvegicus (Rat)	31	119	56	63	8	GVSLAALK	73.91
DP00136	P15865	Histone H1.4 (H1d)	Rattus norvegicus (Rat)	31	119	67	81	15	AAAGYDVEKNNSRIK	75.52
DP00138	P12272	Parathyroid hormone-related protein (PTH-rP) (PTHrP) (Parathyroid hormone-like protein) (PLP) Cleaved into: PTHrP1-36; PTHrP38-94; Osteostatin (PTHrP107-139)	Homo sapiens (Human)	68	144	68	76	9	HTAEIRATS	77.26
DP00138	P12272	Parathyroid hormone-related protein (PTH-rP) (PTHrP) (Parathyroid hormone-like protein) (PLP) Cleaved into: PTHrP1-36; PTHrP38-94; Osteostatin (PTHrP107-139)	Homo sapiens (Human)	68	144	99	115	17	DEGRYLTQETNKVETYK	79.26
DP00140	P0A7L8	50S ribosomal protein L27 (Large ribosomal subunit protein bL27)	Escherichia coli (strain K12)	1	85	28	38	11	GESVLAGSIIV	87.44
DP00140	P0A7L8	50S ribosomal protein L27 (Large ribosomal subunit protein bL27)	Escherichia coli (strain K12)	1	85	56	63	8	DHTLFAKA	75.92
DP00140	P0A7L8	50S ribosomal protein L27 (Large ribosomal subunit protein bL27)	Escherichia coli (strain K12)	1	85	65	71	7	GKVKFEV	80.27
DP00141	O95405	Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation)	Homo sapiens (Human)	663	751	676	682	7	GQFGISA	82.7
DP00141	O95405	Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation)	Homo sapiens (Human)	663	751	710	716	7	ARFTFTK	88.96
DP00141	O95405	Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation)	Homo sapiens (Human)	663	751	737	743	7	CKLLYMD	77.16
DP00145	P0A7S3	30S ribosomal protein S12 (Small ribosomal subunit protein uS12)	Escherichia coli (strain K12)	1	27	2	8	7	ATVNQLV	79.93
DP00146	P0A7T7	30S ribosomal protein S18 (Small ribosomal subunit protein bS18)	Escherichia coli (strain K12)	1	75	9	15	7	KFCRFTA	80.6
DP00146	P0A7T7	30S ribosomal protein S18 (Small ribosomal subunit protein bS18)	Escherichia coli (strain K12)	1	75	17	45	29	GVQEIDYKDIATLKNYITESGKIVPSRIT	77.6
DP00146	P0A7T7	30S ribosomal protein S18 (Small ribosomal subunit protein bS18)	Escherichia coli (strain K12)	1	75	55	70	16	LARAIKRARYLSLLPY	78.49
DP00148	P03347	Gag polyprotein (Pr55Gag) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Spacer peptide 2 (SP2) (p1); p6-gag	Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1)	378	432	389	396	8	MVKCFNCG	75.92
DP00151	P02547	Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein)	Sus scrofa (Pig)	444	549	448	460	13	QEEQIEVEETIEA	82.97
DP00151	P02547	Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein)	Sus scrofa (Pig)	444	549	497	512	16	AQEEEEAAEKEESEEA	74.25
DP00152	Q13426	DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4)	Homo sapiens (Human)	178	202	178	187	10	KRFILVLNEK	76.56
DP00152	Q13426	DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4)	Homo sapiens (Human)	203	265	213	221	9	GETAICSEM	77.59
DP00152	Q13426	DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4)	Homo sapiens (Human)	203	265	254	260	7	DDSIISS	93.65
DP00154	P29353	SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1)	Homo sapiens (Human)	127	151	130	144	15	GGEEWTRHGSFVNKP	75.25
DP00154	P29353	SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1)	Homo sapiens (Human)	127	149	130	144	15	GGEEWTRHGSFVNKP	75.25
DP00156	P54725	UV excision repair protein RAD23 homolog A (HR23A) (hHR23A)	Homo sapiens (Human)	283	316	290	296	7	ELADISD	73.91
DP00156	P54725	UV excision repair protein RAD23 homolog A (HR23A) (hHR23A)	Homo sapiens (Human)	283	316	300	311	12	EVGAIGEEAPQM	79.85
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	425	512	462	470	9	QTAEIVNVK	75.96
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	425	512	490	497	8	DTTVITGN	81.9
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	446	512	462	470	9	QTAEIVNVK	75.96
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	446	512	490	497	8	DTTVITGN	81.9
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	658	684	658	666	9	AGPAYESYL	83.61
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	658	684	671	679	9	VDRVITTVD	76.44
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	751	759	9	RDNVYYYDE	96.84
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	765	773	9	EDQDFDLSQ	73.58
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	808	818	11	EIGNFIDENLK	80.36
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	844	854	11	AASLSSLNSSE	76.53
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	751	759	9	RDNVYYYDE	96.84
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	765	773	9	EDQDFDLSQ	73.58
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	808	818	11	EIGNFIDENLK	80.36
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	844	854	11	AASLSSLNSSE	76.53
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	778	884	808	818	11	EIGNFIDENLK	80.36
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	778	884	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	778	884	844	854	11	AASLSSLNSSE	76.53
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	778	884	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	784	852	808	818	11	EIGNFIDENLK	80.36
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	784	852	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	812	884	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	812	884	844	854	11	AASLSSLNSSE	76.53
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	812	884	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	855	881	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00162	O75324	Stannin (AG8_1)	Homo sapiens (Human)	34	59	37	43	7	RLQRISQ	76.49
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	8	30	23	KQELEVLESIYPDELRIINDEYP	88.12
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	34	68	35	FEVAIKLELDTGDSTSVLTKEHTIIAEFKLPENYP	79.03
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	70	89	20	EPCLISLEAQEVALNDNEED	79.08
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	106	153	48	VLKKFENLPDLISFKGYLPELTVQLESQIETDMLLGMQMCFALISSIK	78.76
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	156	175	20	CEQWYSEQLNKLEKQYELEA	84.88
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	192	210	19	TRESYLEWRSKFRQELKLD	76.18
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	227	233	7	GKQMFEQ	75.25
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	238	244	7	TGDEYME	75.54
DP00164	P05318	60S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	106	3	34	32	TESALSYAALILADSEIEISSEKLLTLTNAAN	80.47
DP00164	P05318	60S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	106	36	48	13	PVENIWADIFAKA	85.75
DP00164	P05318	60S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	106	55	65	11	KDLLVNFSAGA	80.81
DP00166	P19429	Troponin I; cardiac muscle (Cardiac troponin I)	Homo sapiens (Human)	163	210	191	200	10	WRKNIDALSG	75.25
DP00168	Q9NVS9	"Pyridoxine-5-phosphate oxidase (EC 1.4.3.5) (Pyridoxamine-phosphate oxidase)"	Homo sapiens (Human)	1	48	1	13	13	MTCWLRGVTATFG	78.34
DP00173	O00273	DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD)	Homo sapiens (Human)	1	116	33	41	9	GVAASCLED	73.8
DP00173	O00273	DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD)	Homo sapiens (Human)	1	116	45	70	26	KACDILAIDKSLTPVTLVLAEDGTIV	83.88
DP00173	O00273	DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD)	Homo sapiens (Human)	1	116	72	100	29	DDDYFLCLPSNTKFVALASNEKWAYNNSD	81.49
DP00173	O00273	DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD)	Homo sapiens (Human)	1	116	102	111	10	GTAWISQESF	87.06
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	16	26	11	SGQAFELILSP	82.55
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	44	51	8	DLSLEEIQ	84.03
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	66	75	10	AEVLKQLAEK	76.25
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	83	102	20	LQKAIEENNNFSKMAEEKLT	76.87
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	126	133	8	KDKHIEEV	75.25
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	130	15	23	9	NDELISFKD	81.23
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	130	42	60	19	ADVKSSLVNESETNQNSSS	78.52
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	130	102	109	8	GYPFIMIP	77.42
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	56	15	23	9	NDELISFKD	81.23
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	56	42	51	10	ADVKSSLVNE	80.8
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	53	15	23	9	NDELISFKD	81.23
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	53	42	48	7	ADVKSSL	81.22
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	68	7	16	10	KVSEIFQSSK	88.46
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	68	49	61	13	EKHNYQEQYNKLK	86.36
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	2	34	7	16	10	KVSEIFQSSK	88.46
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	2	32	7	16	10	KVSEIFQSSK	88.46
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	33	68	49	61	13	EKHNYQEQYNKLK	86.36
DP00180	P19972	Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain)	Millerozyma farinosa (Yeast) (Pichia farinosa)	146	222	146	154	9	GEATTIWGV	79
DP00180	P19972	Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain)	Millerozyma farinosa (Yeast) (Pichia farinosa)	146	222	169	180	12	DLQNMSADLAKN	75.25
DP00180	P19972	Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain)	Millerozyma farinosa (Yeast) (Pichia farinosa)	146	222	198	209	12	KDVYMIKFSLAG	83.97
DP00181	P08775	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit)	Mus musculus (Mouse)	1529	1959	1542	1550	9	GAAGFSPSA	77.26
DP00184	P11473	Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1)	Homo sapiens (Human)	16	125	32	40	9	TGFHFNAMT	78.82
DP00184	P11473	Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1)	Homo sapiens (Human)	16	125	54	69	16	RKALFTCPFNGDCRIT	78.2
DP00184	P11473	Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1)	Homo sapiens (Human)	16	125	83	97	15	RCVDIGMMKEFILTD	78.82
DP00184	P11473	Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1)	Homo sapiens (Human)	120	164	127	152	26	EQQRIIAILLDAHHKTYDPTYSDFCQ	79.39
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	3	10	8	SQQNQNRQ	79.93
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	14	20	7	QEQGYME	80.6
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	26	33	8	VVNAWEST	80.56
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	36	53	18	TLSSTAQAAAEKTAEFRD	74.93
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	69	76	8	KGQEFKER	77.26
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	109	115	7	KMEEYKQ	79.93
DP00187	P04273	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mesocricetus auratus (Golden hamster)	23	106	29	39	11	GGWNTGGSRYP	80.94
DP00187	P04273	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mesocricetus auratus (Golden hamster)	23	106	95	101	7	THNQWNK	74.25
DP00187	P04273	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mesocricetus auratus (Golden hamster)	90	126	95	101	7	THNQWNK	74.25
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	88	103	16	KRLTYDEIQSKTYLEV	77.42
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	125	138	14	KPGKYTAKKFCLEP	77.45
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	144	150	7	KAEGISK	75.92
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	155	161	7	DFQNTKL	79.93
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	163	174	12	TRLTYTLDEIEG	77.15
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	176	187	12	FEVSSDGTVKFE	80.77
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	194	200	7	YAAVTVQ	75.54
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	207	220	14	VPFLFTIKQLVASG	86.5
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	253	259	7	NAVALPA	79.93
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	274	290	17	KNVASSKGTITLSVTSS	76.73
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	294	306	13	TGEVIGVFQSLQP	80.7
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	317	327	11	KDVKIEGVWYA	85.25
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	62	74	13	PGITIISASQTGN	78.83
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	87	118	32	LAAKLNVKLVNAGDYKFKQIASEKLLIVVTST	78.07
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	130	138	9	ALHKFLFSK	80.16
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	142	165	24	KLENTAFAVFSLGDSSYEFFCQSG	79.7
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	168	176	9	FDSKLAELG	74.25
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	186	199	14	ADVEYQAAASEWRA	88.8
DP00192	P02668	Kappa-casein Cleaved into: Casoxin-C; Casoxin-6; Casoxin-A; Casoxin-B; Casoplatelin	Bos taurus (Bovine)	1	21	1	16	16	MMKSFFLVVTILALTL	79.95
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	2	22	21	KCLLLALALTCGAQALIVTQT	82
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	31	49	19	VAGTWYSLAMAASDISLLD	80.2
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	54	63	10	PLRVYVEELK	79.2
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	68	79	12	GDLEILLQKWEN	81.1
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	83	91	9	AQKKIIAEK	79.45
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	96	127	32	AVFKIDALNENKVLVLDTDYKKYLLFCMENSA	80.88
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	162	173	12	HIRLSFNPTQLE	78.12
DP00194	P0AFZ3	Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB)	Escherichia coli (strain K12)	111	165	112	118	7	EDTSIMN	74.1
DP00194	P0AFZ3	Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB)	Escherichia coli (strain K12)	111	165	124	135	12	ADNETVMSVIDG	83.58
DP00194	P0AFZ3	Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB)	Escherichia coli (strain K12)	118	165	124	135	12	ADNETVMSVIDG	83.58
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	153	165	13	MDAALDDLIDTLG	82.69
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	171	179	9	EEENTTYTG	76.59
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	186	195	10	MSSTYIEELG	77.26
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	232	242	11	IDALSSDFTCG	78.93
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	257	271	15	TEVLKAQSAGTVRSA	75.59
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	28	60	30	55	26	KLCYLLDGILFIYGVILTALFLRVKF	84.69
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	52	164	67	86	20	GQNQLYNELNLGRREEYDVL	78.13
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	52	164	107	115	9	QEGLYNELQ	81.57
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	52	164	119	127	9	MAEAYSEIG	89.07
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	52	164	138	159	22	HDGLYQGLSTATKDTYDALHMQ	80.42
DP00201	P02721	ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)	Bos taurus (Bovine)	33	108	39	51	13	VQKLFVDKIREYR	85.18
DP00201	P02721	ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)	Bos taurus (Bovine)	33	108	63	83	21	AGPEYQQDLDRELFKLKQMYG	75.16
DP00201	P02721	ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)	Bos taurus (Bovine)	33	108	85	97	13	ADMNTFPNFTFED	77.57
DP00201	P02721	ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)	Bos taurus (Bovine)	84	108	85	97	13	ADMNTFPNFTFED	77.57
DP00205	Q82S91	Metal-binding protein SmbP	Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)	1	117	2	29	28	KTTLIKVIAASVTALFLSMQVYASGHTA	81.09
DP00205	Q82S91	Metal-binding protein SmbP	Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)	1	117	50	57	8	TDQLLEHA	80.27
DP00205	Q82S91	Metal-binding protein SmbP	Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)	1	117	102	110	9	AQEAIEHLR	94.31
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	528	535	8	ALATFAMP	93.31
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	570	585	16	LLSRFFGALKALFSGG	77.38
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	646	653	8	AQQQTAET	77.26
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	657	665	9	RQQAEVTEK	76.37
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	697	709	13	LNVEEQSVQETEQ	74.84
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	727	760	34	QKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPA	77.58
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	779	786	8	EQQEENNA	76.25
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	828	835	8	LTVACASP	73.91
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	840	849	10	GKVWIRYPIV	81.37
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	876	882	7	VAAAIEP	76.25
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	908	946	39	EVVETTHPEVIAAAVTEQPQVITESDVAVAQEVAEQAEP	77.45
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	955	971	17	ADIEEVVETAEVVVAEP	77.65
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	980	1008	29	PVVAEVAAEVETVAAVEPEVTVEHNHATA	79.17
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	1031	1037	7	PTFAFEG	77.74
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	646	653	8	AQQQTAET	77.26
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	657	665	9	RQQAEVTEK	76.37
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	697	709	13	LNVEEQSVQETEQ	74.84
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	727	760	34	QKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPA	77.58
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	779	786	8	EQQEENNA	76.25
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	828	835	8	LTVACASP	73.91
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	646	653	8	AQQQTAET	77.26
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	657	665	9	RQQAEVTEK	76.37
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	697	709	13	LNVEEQSVQETEQ	74.84
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	727	760	34	QKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPA	77.58
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	779	786	8	EQQEENNA	76.25
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	828	835	8	LTVACASP	73.91
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	816	850	828	835	8	LTVACASP	73.91
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	2	19	18	RIAVICFCLLGITCAIPV	79.52
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	29	46	18	EKQLYNKYPDAVATWLNP	84.17
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	59	75	17	NAVSSEETNDFKQETLP	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	99	108	10	SQDSIDSNDS	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	142	149	8	ATEVFTPV	80.77
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	161	169	9	DSVVYGLRS	77.41
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	185	191	7	TDEDITS	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	198	206	9	LNGAYKAIP	80.04
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	222	229	8	KDSYETSQ	74.75
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	258	268	11	SDVIDSQELSK	75.25
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	296	309	14	KHLKFRISHELDSA	78.02
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	29	46	18	EKQLYNKYPDAVATWLNP	84.17
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	59	75	17	NAVSSEETNDFKQETLP	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	99	108	10	SQDSIDSNDS	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	142	149	8	ATEVFTPV	80.77
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	161	169	9	DSVVYGLRS	77.41
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	185	191	7	TDEDITS	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	198	206	9	LNGAYKAIP	80.04
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	222	229	8	KDSYETSQ	74.75
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	258	268	11	SDVIDSQELSK	75.25
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	296	309	14	KHLKFRISHELDSA	78.02
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	85	116	99	108	10	SQDSIDSNDS	75.92
DP00217	P05221	Nucleoplasmin	Xenopus laevis (African clawed frog)	120	200	120	131	12	MEEDYSWAEEED	76.14
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	14	23	10	LKRWIGSETD	79.93
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	34	61	28	TKVKFDDGAVFLAACSSGDTEEVLRLLE	78.94
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	64	84	21	ADINYANVDGLTALHQACIDD	80.75
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	87	101	15	DMVKFLVENGANINQ	79.84
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	104	110	7	NEGWIPL	87.96
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	114	139	26	ASCGYLDIAEYLISQGAHVGAVNSEG	82.33
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	150	168	19	AMEELLQNEVNRQGVDIEA	77.7
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	181	196	16	ARQWLNSGHINDVRHA	82.69
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	212	235	24	TEVLKLLIQARYDVNIKDYDGWTP	83.26
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	246	257	12	EACRILVENLCD	78.99
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	259	284	26	EAVNKVGQTAFDVADEDILGYLEELQ	79.17
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	286	293	8	KQNLLHSE	74.92
DP00219	O60927	E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3)	Homo sapiens (Human)	1	126	5	22	18	GAGLSETVTETTVTVTTE	78.3
DP00219	O60927	E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3)	Homo sapiens (Human)	1	126	39	46	8	KKVEWTSD	80.02
DP00219	O60927	E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3)	Homo sapiens (Human)	1	126	59	65	7	KCCCIYE	86.29
DP00219	O60927	E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3)	Homo sapiens (Human)	1	126	69	76	8	AFGESSTE	76.25
DP00220	P17810	Peripherin-2 (Retinal degeneration slow protein)	Bos taurus (Bovine)	284	346	284	292	9	RYLHTALEG	75.25
DP00220	P17810	Peripherin-2 (Retinal degeneration slow protein)	Bos taurus (Bovine)	284	346	303	323	21	SEGWLLEKSVPETWKAFLESV	79.44
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	2	12	11	SQQHTLPVTLS	76.35
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	16	23	8	SQELLKTV	75.5
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	83	103	21	QEQELQQQHWEQHEEYQKAEN	79.31
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	149	156	8	KEQLLELP	79.68
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	241	248	8	GQLELSEQ	78.22
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	251	258	8	GQLELSEQ	78.22
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	281	288	8	GQLKYLEQ	94.31
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	333	339	7	LEQLEEQ	76.92
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	367	376	10	EQQVLQLKQL	81.57
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	487	493	7	EAQLELP	75.54
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	563	569	7	GEVLLPV	80.27
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	6	20	15	ADAQIQRETYDSNES	80.91
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	63	73	11	QASSFSFLNRA	79.81
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	94	103	10	KALNLQFKAK	75.12
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	119	140	22	LFTRYELYIKNILEAPVKSIEN	79.52
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	174	180	7	PKFTIDA	76.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	185	192	8	SDSVFSFG	86.33
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	214	230	17	PEFKFSGTVSSDVFKLN	79.78
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	245	257	13	KPFSFSSATSTTE	74.38
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	275	288	14	VDNNSKAEASFTFG	83.33
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	300	306	7	PSFVFGQ	77.07
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	315	326	12	KSSFTFGSTTIE	81.13
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	329	338	10	NDENSTSNSK	79.93
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	350	358	9	PSFSFSIPS	79.78
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	383	390	8	KPVFSFGA	75.84
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	414	423	10	PAFNLISNAG	82.07
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	436	446	11	PAFSFGISNGS	81.7
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	472	484	13	PAFSFGINTNTTK	79.73
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	489	506	18	KAPTFTFGSSALADNKED	75.75
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	509	517	9	KPFSFGTSQ	76.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	548	557	10	TGFKFSLPFE	76.45
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	560	582	23	GSQTTTNDSKEESTTEATGNESQ	74.55
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	605	613	9	DEVALFSQK	81.46
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	615	627	13	KLMTFNAETKSYD	81.71
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	656	671	16	GNVLLNATVVDSFKYE	82.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	688	700	13	ADGKLVTYIVKFK	88.53
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	185	192	8	SDSVFSFG	86.33
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	214	230	17	PEFKFSGTVSSDVFKLN	79.78
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	245	257	13	KPFSFSSATSTTE	74.38
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	275	288	14	VDNNSKAEASFTFG	83.33
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	300	306	7	PSFVFGQ	77.07
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	315	326	12	KSSFTFGSTTIE	81.13
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	329	338	10	NDENSTSNSK	79.93
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	350	358	9	PSFSFSIPS	79.78
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	383	390	8	KPVFSFGA	75.84
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	414	423	10	PAFNLISNAG	82.07
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	436	446	11	PAFSFGISNGS	81.7
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	472	484	13	PAFSFGINTNTTK	79.73
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	489	506	18	KAPTFTFGSSALADNKED	75.75
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	509	517	9	KPFSFGTSQ	76.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	562	720	605	613	9	DEVALFSQK	81.46
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	562	720	615	627	13	KLMTFNAETKSYD	81.71
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	562	720	656	671	16	GNVLLNATVVDSFKYE	82.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	562	720	688	700	13	ADGKLVTYIVKFK	88.53
DP00223	P14635	G2/mitotic-specific cyclin-B1	Homo sapiens (Human)	1	78	7	22	16	RNSKINAENKAKINMA	80.06
DP00223	P14635	G2/mitotic-specific cyclin-B1	Homo sapiens (Human)	1	78	44	52	9	ALGDIGNKV	75.25
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	329	343	15	DIFATASAAAPVSSA	86.62
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	373	392	20	GATAWGDLLGEDSLAALSSV	76.51
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	417	444	28	SASASATTAVTAATTEVDLFGDAFAASP	75.37
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	463	469	7	VAAALDA	75.59
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	488	495	8	ELDLFAMK	75.38
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	525	553	29	AVAATAATTTAAAAATTTATTSAAAATTA	76.48
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	558	569	12	ALDIFGDLFDSA	81.94
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	583	592	10	SIDLFGTDAF	79.63
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	604	614	11	ESSLTADLLSG	77.38
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	625	640	16	HVPLFFTAVDAFAAPS	83.55
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	652	671	20	SSGVIDLFGDAFGSSASETQ	79.33
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	675	696	22	QAVSSSSASADLLAGFGGSFMA	77.41
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	705	722	18	AQNNLLQPNFEAAFGTTP	78.21
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	769	786	18	LDSSLASLVGNLGISGTT	75.68
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	790	797	8	GDLQWNAG	79.56
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	803	809	7	GGANWQP	80.94
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	329	343	15	DIFATASAAAPVSSA	86.62
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	373	392	20	GATAWGDLLGEDSLAALSSV	76.51
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	417	444	28	SASASATTAVTAATTEVDLFGDAFAASP	75.37
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	463	469	7	VAAALDA	75.59
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	488	495	8	ELDLFAMK	75.38
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	525	553	29	AVAATAATTTAAAAATTTATTSAAAATTA	76.48
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	558	569	12	ALDIFGDLFDSA	81.94
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	583	592	10	SIDLFGTDAF	79.63
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	604	614	11	ESSLTADLLSG	77.38
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	625	640	16	HVPLFFTAVDAFAAPS	83.55
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	652	671	20	SSGVIDLFGDAFGSSASETQ	79.33
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	675	696	22	QAVSSSSASADLLAGFGGSFMA	77.41
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	705	722	18	AQNNLLQPNFEAAFGTTP	78.21
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	745	896	769	786	18	LDSSLASLVGNLGISGTT	75.68
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	745	896	790	797	8	GDLQWNAG	79.56
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	745	896	803	809	7	GGANWQP	80.94
DP00226	Q9CXW3	Calcyclin-binding protein (CacyBP) (Siah-interacting protein)	Mus musculus (Mouse)	178	229	195	202	8	VLKKIYED	77.63
DP00226	Q9CXW3	Calcyclin-binding protein (CacyBP) (Siah-interacting protein)	Mus musculus (Mouse)	178	229	207	219	13	MKRTINKAWVESR	77
DP00229	P05455	Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B)	Homo sapiens (Human)	326	408	353	359	7	GKVQFQG	79.26
DP00229	P05455	Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B)	Homo sapiens (Human)	326	408	397	403	7	KQQKTEN	73.91
DP00230	Q14449	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Homo sapiens (Human)	361	435	361	367	7	SSQSISP	75.97
DP00230	Q14449	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Homo sapiens (Human)	361	435	375	382	8	SLVAMDFS	75.92
DP00230	Q14449	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Homo sapiens (Human)	361	435	386	408	23	SRVIENPTEALSVAVEEGLAWRK	77.5
DP00231	P14859	POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1)	Homo sapiens (Human)	1	200	35	50	16	VGGAISTAQAQAFLGH	79.18
DP00231	P14859	POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1)	Homo sapiens (Human)	1	200	52	75	24	HQVQLAGTSLQAAAQSLNVQSKSN	79.95
DP00231	P14859	POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1)	Homo sapiens (Human)	1	200	93	157	65	VQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASA	78.89
DP00231	P14859	POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1)	Homo sapiens (Human)	1	200	176	195	20	LQQLQQLQQQNLNLQQFVLV	77.76
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	248	256	9	AMSAFNNIK	93.65
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	258	264	7	MQVVLER	80.03
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	282	289	8	TGKLITSS	76.13
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	349	357	9	EGSTYHFSG	81.46
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	370	384	15	DLESFFTHDSVSTSS	78.97
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	440	451	12	KTVLTSSSSSFN	79.1
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	453	461	9	GGSTFETKS	83.95
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	144	156	13	HGSKYLATASTMD	81.04
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	171	180	10	ILDSIGRFFG	76.52
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	219	228	10	PVVHFFKNIV	86.76
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	242	252	11	GLSLSRFSWGA	76.28
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	280	291	12	AQGTLSKIFKLG	79.68
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	100	108	9	EYANSYNFA	88.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	120	134	15	DEVSIIQSMGYRNRA	91.66
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	146	165	20	SLQETSLSVQLSNLGTVRTL	79.15
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	175	184	10	KTSVYIELGS	78.73
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	192	209	18	NKATYCSVGDQELLQITP	80.1
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	213	220	8	RDEISLDS	76.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	224	237	14	AACEFSETDVTNTE	76.09
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	244	250	7	NDLNTTE	82.61
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	257	271	15	HPEKYQGSSVSNLHV	75.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	282	294	13	SLQHENSSLLLTK	76.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	369	394	26	DVPWITLNSSIQKVNEWFSRSDELLG	79.57
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	410	435	26	ADVLDVLNEVDEYSGSSEKIDLLASD	77.73
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	437	445	9	HEALICKSE	91.64
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	450	466	17	KSVESNIEDKIFGKTYR	79.87
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	475	494	20	SHVTENLIIGAFVTEPQIIQ	82.31
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	544	552	9	QVMNITNSG	85.62
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	559	567	9	GDSIQNEKN	76.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	576	604	29	KESAFKTKAEPISSSISNMELELNIHNSK	77.51
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	621	632	12	HALELVVSRNLS	76.56
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	637	643	7	TELQIDS	80.27
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	646	656	11	SSEEIKKKKYN	75.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	665	671	7	NLQLMEG	77.26
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	711	725	15	KCSNTSELKEFVNPS	76.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	765	772	8	ESSSISLV	74.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	779	792	14	TQESISLLEVSTLG	79.53
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	804	812	9	QCAAFENPK	85.95
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	852	862	11	LDAQYLQNTFK	86.11
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	865	874	10	KRQSFAPFSN	76.45
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	880	889	10	EECATFSAHS	82.71
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	897	905	9	PKVTFECEQ	74.58
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	921	927	7	QTVNITA	86.96
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	948	959	12	GGSRFCLSSQFR	78.6
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	962	969	8	ETGLITPN	85.28
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	997	1008	12	NLLEENFEEHSM	88.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1015	1062	48	GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIG	82.01
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1064	1073	10	SDENIQAELG	83.78
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1109	1135	27	KKQEYEEVVQTVNTDFSPYLISDNLEQ	77.62
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1155	1181	27	DDGEIKEDTSFAENDIKESSAVFSKSV	77.37
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1198	1204	7	LAQGYRR	75.92
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1212	1220	9	SEENLSSED	75.36
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1225	1238	14	CFQHLLFGKVNNIP	85.98
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1245	1254	10	STVATECLSK	76.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1256	1267	12	TEENLLSLKNSL	75.64
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1271	1279	9	SNQVILAKA	94.02
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1292	1320	29	SASLFSSQCSELEDLTANTNTQDPFLIGS	80.15
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1326	1337	12	HQSESQGVGLSD	75.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1361	1371	11	MDSNLGEAASG	77.26
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1387	1395	9	SQSDILTTQ	78.15
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1400	1420	21	MQHNLIKLQQEMAELEAVLEQ	78.79
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1452	1466	15	KAVLTSQKSSEYPIS	77.61
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1476	1486	11	KFEVSADSSTS	75.55
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1505	1513	9	DDRWYMHSC	91.97
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1516	1543	28	SLQNRNYPSQEELIKVVDVEEQQLEESG	79.57
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1545	1554	10	HDLTETSYLP	78.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1564	1573	10	LESGISLFSD	91.3
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1615	1632	18	AAAHTTDTAGYNAMEESV	75.03
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	175	184	10	KTSVYIELGS	78.73
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	192	209	18	NKATYCSVGDQELLQITP	80.1
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	213	220	8	RDEISLDS	76.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	224	237	14	AACEFSETDVTNTE	76.09
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	244	250	7	NDLNTTE	82.61
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	257	271	15	HPEKYQGSSVSNLHV	75.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	282	294	13	SLQHENSSLLLTK	76.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	224	237	14	AACEFSETDVTNTE	76.09
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	244	250	7	NDLNTTE	82.61
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	257	271	15	HPEKYQGSSVSNLHV	75.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	282	294	13	SLQHENSSLLLTK	76.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	369	394	26	DVPWITLNSSIQKVNEWFSRSDELLG	79.57
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	410	435	26	ADVLDVLNEVDEYSGSSEKIDLLASD	77.73
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	437	445	9	HEALICKSE	91.64
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	450	466	17	KSVESNIEDKIFGKTYR	79.87
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	475	493	19	SHVTENLIIGAFVTEPQII	82.24
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	304	394	369	389	21	DVPWITLNSSIQKVNEWFSRS	80.44
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	433	511	437	445	9	HEALICKSE	91.64
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	433	511	450	466	17	KSVESNIEDKIFGKTYR	79.87
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	433	511	475	494	20	SHVTENLIIGAFVTEPQIIQ	82.31
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	544	552	9	QVMNITNSG	85.62
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	559	567	9	GDSIQNEKN	76.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	576	604	29	KESAFKTKAEPISSSISNMELELNIHNSK	77.51
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	621	632	12	HALELVVSRNLS	76.56
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	637	643	7	TELQIDS	80.27
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	646	656	11	SSEEIKKKKYN	75.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	765	772	8	ESSSISLV	74.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	779	792	14	TQESISLLEVSTLG	79.53
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	804	812	9	QCAAFENPK	85.95
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	852	862	11	LDAQYLQNTFK	86.11
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	865	874	10	KRQSFAPFSN	76.45
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	880	889	10	EECATFSAHS	82.71
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	897	905	9	PKVTFECEQ	74.58
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	921	927	7	QTVNITA	86.96
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	948	959	12	GGSRFCLSSQFR	78.6
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	962	969	8	ETGLITPN	85.28
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	997	1008	12	NLLEENFEEHSM	88.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	1015	1062	48	GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIG	82.01
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	1064	1073	10	SDENIQAELG	83.78
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	765	772	8	ESSSISLV	74.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	779	792	14	TQESISLLEVSTLG	79.53
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	804	812	9	QCAAFENPK	85.95
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	852	862	11	LDAQYLQNTFK	86.11
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	865	874	10	KRQSFAPFSN	76.45
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	880	889	10	EECATFSAHS	82.71
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	897	905	9	PKVTFECEQ	74.58
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	921	927	7	QTVNITA	86.96
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	948	959	12	GGSRFCLSSQFR	78.6
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	962	969	8	ETGLITPN	85.28
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	997	1008	12	NLLEENFEEHSM	88.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	1015	1059	45	GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSIN	81.66
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	936	1057	948	959	12	GGSRFCLSSQFR	78.6
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	936	1057	962	969	8	ETGLITPN	85.28
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	936	1057	997	1008	12	NLLEENFEEHSM	88.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	936	1057	1015	1052	38	GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTN	81.01
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	1343	1440	1361	1371	11	MDSNLGEAASG	77.26
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	1343	1440	1387	1395	9	SQSDILTTQ	78.15
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	1343	1440	1400	1420	21	MQHNLIKLQQEMAELEAVLEQ	78.79
DP00239	P31896	Carbon monoxide dehydrogenase (CODH) (EC 1.2.7.4)	Rhodospirillum rubrum	1	27	13	22	10	ACATEMLNLA	76.29
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	444	451	8	KTRWLNSG	75.25
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	485	495	11	VPNLFVPLNTN	79.26
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	507	517	11	REQNLQDIKTA	75.62
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	534	560	27	VQGELVTASKAIIEKEYQPHVIVSTTG	77.12
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	562	569	8	NPFTTLTD	75.25
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	632	638	7	SDAATFK	79.69
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	430	446	17	KTRWLNTPNTYLRVNVA	79.15
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	481	491	11	NPNQFVPLYTD	79.96
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	493	503	11	QEVLEMRNKIR	85.95
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	516	527	12	QSQLLASVIAEK	76.95
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	557	569	13	FSQLTDQELEEYK	77.98
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	657	664	8	TAEEILSK	83.32
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	1	83	17	39	23	MEKSIVVAIERFVKHPIYGKFIK	81.82
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	1	83	51	63	13	NECGIGDVVEIRE	81.61
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	1	83	70	76	7	TKSWTLV	79.31
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	4	83	17	39	23	MEKSIVVAIERFVKHPIYGKFIK	81.82
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	4	83	51	63	13	NECGIGDVVEIRE	81.61
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	4	83	70	76	7	TKSWTLV	79.31
DP00245	P00514	cAMP-dependent protein kinase type I-alpha regulatory subunit Cleaved into: cAMP-dependent protein kinase type I-alpha regulatory subunit; N-terminally processed	Bos taurus (Bovine)	91	112	95	107	13	RRGAISAEVYTEE	83.77
DP00249	P63315	Troponin C; slow skeletal and cardiac muscles (TN-C)	Bos taurus (Bovine)	103	161	108	130	23	ADGYIDLEELKIMLQATGETITE	87.06
DP00249	P63315	Troponin C; slow skeletal and cardiac muscles (TN-C)	Bos taurus (Bovine)	103	161	144	156	13	NDGRIDYDEFLEF	83.41
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	44	50	7	GQSEYFD	88.87
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	53	61	9	TQMNINLYD	95.62
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	66	86	21	TQTGFVRHDDGYVSTSISLRS	75.71
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	90	122	33	VGQTILSGHSTYYIYVIATAPNMFNVNDVLGAY	82.39
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	135	160	26	GGIPYSQIYGWYRVHFGVLDEQLHRN	77.9
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	164	174	11	RDRYYSNLDIA	76.38
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	155	166	12	AQTATASSAAVG	77.26
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	173	179	7	AEQAWPQ	80.27
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	186	195	10	LQLQLALAMS	76.25
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	211	221	11	VQLQLALSLSR	77.32
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	238	246	9	LQMAIEESK	87.63
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	260	267	8	LADVFTTP	76.88
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	421	428	8	GELELLAG	79.43
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	525	535	11	ATLTLNQLRLS	80.27
DP00252	P0A877	Tryptophan synthase alpha chain (EC 4.2.1.20)	Escherichia coli (strain K12)	54	74	63	69	7	TIQNATL	81.08
DP00253	P26645	Myristoylated alanine-rich C-kinase substrate (MARCKS)	Mus musculus (Mouse)	1	309	1	9	9	MGAQFSKTA	78.6
DP00253	P26645	Myristoylated alanine-rich C-kinase substrate (MARCKS)	Mus musculus (Mouse)	1	309	88	94	7	AAAATEP	76.92
DP00253	P26645	Myristoylated alanine-rich C-kinase substrate (MARCKS)	Mus musculus (Mouse)	1	309	118	128	11	AEGASASSTSS	76.71
DP00253	P26645	Myristoylated alanine-rich C-kinase substrate (MARCKS)	Mus musculus (Mouse)	1	309	158	166	9	KLSGFSFKK	79.12
DP00256	P40316	Securin	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	110	8	24	17	KENNIVYTGNESSGINF	88.53
DP00256	P40316	Securin	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	110	51	65	15	RDANSNNGNTLKYIQ	81.54
DP00256	P40316	Securin	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	110	96	104	9	SKSFIFPET	87.7
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	167	3	41	39	LNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQ	83.83
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	167	89	107	19	GGGSFSTADQLEMVTELLG	77.59
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	167	120	154	35	DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQA	78.4
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	143	3	41	39	LNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQ	83.83
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	143	89	107	19	GGGSFSTADQLEMVTELLG	77.59
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	143	120	138	19	DDETFIKNIIIQDCMWSGF	79.65
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	88	3	41	39	LNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQ	83.83
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	404	437	34	AGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLP	78.82
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	442	451	10	KLQNINLAMS	79.53
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	472	479	8	QEVALKLE	77.26
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	484	491	8	SLELSFTM	80.98
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	515	543	29	SPSEYCFYVDSDMVNEFKLELVEKLFAED	79.23
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	571	582	12	DFQLRSFDQLSP	75.59
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	535	543	9	LVEKLFAED	80.9
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	571	582	12	DFQLRSFDQLSP	75.59
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	598	609	12	TVTVFQQTQIQE	76.81
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	611	627	17	TANATTTTATTDELKTV	74.11
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	633	642	10	EDIKILIASP	78.6
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	651	657	7	TTSATSS	74.25
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	673	682	10	GKGVIEQTEK	79.33
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	776	826	792	807	16	LPQLTSYDCEVNAPIQ	79.18
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	776	826	815	821	7	GEELLRA	73.91
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	776	813	792	807	16	LPQLTSYDCEVNAPIQ	79.18
DP00265	P04925	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mus musculus (Mouse)	23	120	29	39	11	GGWNTGGSRYP	80.94
DP00265	P04925	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mus musculus (Mouse)	23	120	94	100	7	THNQWNK	74.25
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1365	1374	10	IRETIINYED	83.31
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1386	1401	16	LNVLRTQPFYEEKLYK	78.09
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1418	1425	8	DIADFLGD	78.26
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1441	1462	22	DVRHYAYEGDGNSDGSLSSLAS	76.39
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1467	1478	12	GDLNFDYLSNFG	89.91
DP00271	P02699	Rhodopsin	Bos taurus (Bovine)	327	348	332	343	12	EASTTVSKTETS	76.25
DP00278	P08050	Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein)	Rattus norvegicus (Rat)	255	316	263	271	9	PKYAYFNGC	83.5
DP00278	P08050	Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein)	Rattus norvegicus (Rat)	255	316	297	311	15	SCRNYNKQASEQNWA	86.47
DP00282	Q04656	Copper-transporting ATPase 1 (EC 7.2.2.8) (Copper pump 1) (Menkes disease-associated protein)	Homo sapiens (Human)	1125	1176	1131	1171	41	HKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISN	79.34
DP00284	P16009	Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C	Enterobacteria phage T4 (Bacteriophage T4)	129	179	136	155	20	GEVGYDSSSNVIQDSNLDTA	82.06
DP00284	P16009	Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C	Enterobacteria phage T4 (Bacteriophage T4)	339	389	347	361	15	ARSLSAMAATVAKSS	78.04
DP00284	P16009	Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C	Enterobacteria phage T4 (Bacteriophage T4)	339	389	370	384	15	NDSRILFKEPVSSYK	80.25
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	164	170	7	GQPRYYP	75.25
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	201	208	8	QPGYYPTS	77.26
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	264	278	15	GQQLGQGQQGYYPTS	84.97
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	286	308	23	QPGYYPTSLQQLGQGQSGYYPTS	78.42
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	358	365	8	QPGYYPTS	77.26
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	373	380	8	QPGYYPTS	77.26
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	418	425	8	QPGYYPTS	77.26
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	1	59	4	13	10	RAENWDEAEV	77.99
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	1	59	18	24	7	AGVEEYG	86.14
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	71	80	10	PSQVIFCNRS	77.49
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	85	93	9	LPVWLNFDG	88.37
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	114	120	7	GHLWLFR	95.37
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	125	140	16	HDGLLVNQTELFVPSL	86.41
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	144	158	15	GQPIFANITLPVYTL	83.77
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	163	187	25	LQVVRSLVKPENYRRLDIVRSLYED	78.93
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	67	117	71	80	10	PSQVIFCNRS	77.49
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	67	117	85	93	9	LPVWLNFDG	88.37
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	153	184	163	179	17	LQVVRSLVKPENYRRLD	75.78
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	73	1	22	22	MQSINFRTARGNLSEVLNNVEA	79.9
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	73	24	30	7	EEVEITR	90.64
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	73	34	48	15	EPAVIVSKATFEAYK	81.74
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	73	52	64	13	LDAEFASLFDTLD	89.89
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	58	1	22	22	MQSINFRTARGNLSEVLNNVEA	79.9
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	58	24	30	7	EEVEITR	90.64
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	58	34	48	15	EPAVIVSKATFEAYK	81.74
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	57	1	22	22	MQSINFRTARGNLSEVLNNVEA	79.9
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	57	24	30	7	EEVEITR	90.64
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	57	34	48	15	EPAVIVSKATFEAYK	81.74
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	41	73	52	64	13	LDAEFASLFDTLD	89.89
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	51	73	52	64	13	LDAEFASLFDTLD	89.89
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	52	73	52	64	13	LDAEFASLFDTLD	89.89
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	66	72	7	ELELSTV	75.39
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	79	89	11	LDQLQAQTKFT	80.45
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	113	139	27	TFKLIYSQFFPQGDATTYAHFLFNAFD	86.52
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	142	196	55	GNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGCITKEEMLAIMKSIYD	84.37
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	214	223	10	HVERFFQKMD	82.98
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	228	251	24	GVVTIDEFLETCQKDENIMNSMQL	81.27
DP00298	Q07817	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Homo sapiens (Human)	28	80	28	35	8	SDVEENRT	79.93
DP00298	Q07817	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Homo sapiens (Human)	28	80	47	60	14	TPSAINGNPSWHLA	84.95
DP00298	Q07817	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Homo sapiens (Human)	71	119	77	92	16	AREVIPMAAVKQALRE	74.77
DP00298	Q07817	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Homo sapiens (Human)	71	119	94	114	21	GDEFELRYRRAFSDLTSQLHI	79.18
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	4	18	15	SEGEWQLVLHVWAKV	77.7
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	25	35	11	HGQDILIRLFK	82.43
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	40	48	9	TLEKFDRFK	85.95
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	67	77	11	VTVLTALGAIL	89.84
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	100	117	18	IPIKYLEFISEAIIHVLH	79.9
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	128	140	13	AQGAMNKALELFR	84.05
DP00304	P31751	RAC-beta serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-2) (Protein kinase B beta) (PKB beta) (RAC-PK-beta)	Homo sapiens (Human)	441	481	458	466	9	SLGLLELDQ	76.89
DP00304	P31751	RAC-beta serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-2) (Protein kinase B beta) (PKB beta) (RAC-PK-beta)	Homo sapiens (Human)	442	480	458	466	9	SLGLLELDQ	76.89
DP00306	Q07108	Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)	Homo sapiens (Human)	1	84	3	14	12	SENCFVAENSSL	80.13
DP00306	Q07108	Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)	Homo sapiens (Human)	1	84	33	76	44	HEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPGQYTFSM	82.35
DP00307	P51946	Cyclin-H (MO15-associated protein) (p34) (p37)	Homo sapiens (Human)	288	323	310	316	7	EEEEWTD	77.59
DP00314	Q9UJY5	ADP-ribosylation factor-binding protein GGA1 (Gamma-adaptin-related protein 1) (Golgi-localized; gamma ear-containing; ARF-binding protein 1)	Homo sapiens (Human)	166	189	166	172	7	NVIFEDE	77.26
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	186	193	8	MASASSSQ	75.59
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	212	224	13	GNDNFGRGGNFSG	78.88
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	243	254	12	GYNGFGNDGGYG	75.92
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	270	292	23	GGQGYGNQGSGYGGSGSYDSYNN	76.34
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	302	315	14	SGSNFGGGGSYNDF	83.8
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	193	250	212	224	13	GNDNFGRGGNFSG	78.88
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	257	305	270	292	23	GGQGYGNQGSGYGGSGSYDSYNN	76.34
DP00325	P01099	Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1)	Oryctolagus cuniculus (Rabbit)	1	166	9	15	7	KIQFTVP	86.96
DP00325	P01099	Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1)	Oryctolagus cuniculus (Rabbit)	1	166	37	44	8	ATLVLTSD	77.63
DP00328	Q08605	Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein)	Drosophila melanogaster (Fruit fly)	281	348	294	306	13	ATGEITPAQGATG	80.86
DP00328	Q08605	Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein)	Drosophila melanogaster (Fruit fly)	281	348	313	319	7	SGVLSTP	79.93
DP00328	Q08605	Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein)	Drosophila melanogaster (Fruit fly)	310	335	313	319	7	SGVLSTP	79.93
DP00328	Q08605	Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein)	Drosophila melanogaster (Fruit fly)	368	444	408	418	11	VQSLHTLQGVQ	75.92
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	1	75	75	MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVY	78.57
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	137	150	14	SQSLTLTDVENLHL	82.94
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	154	160	7	LLQSWMH	76.88
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	175	182	8	QSVLSLSQ	80.27
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	201	212	12	PIQAFLLYQEPV	79.46
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	25	1	20	20	MKVLILACLVALALARELEE	79.08
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	2	21	20	KTALILLSILGMACAFSMKN	82.64
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	24	54	31	RRVKIEDSEENGVFKYRPRYYLYKHAYFYPH	84.94
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	88	97	10	GENNEESNED	75.25
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	101	115	15	EAENTTLSATTLGYG	77.35
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	121	134	14	GTGYTGLAAIQLPK	75.44
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	169	180	12	VDENEQGINGTS	81.02
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	255	282	28	TTVEYEGEYEYTGANEYDNGYEIYESEN	83.03
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	287	312	26	GDNYRAYEDEYSYFKGQGYDGYDGQN	83.1
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	258	317	259	282	24	YEGEYEYTGANEYDNGYEIYESEN	83.54
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	258	317	287	312	26	GDNYRAYEDEYSYFKGQGYDGYDGQN	83.1
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	18	40	23	EPAVYFKEQFLDGDGWTSRWIES	79.12
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	45	59	15	DFGKFVLSSGKFYGD	82.03
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	65	85	21	GLQTSQDARFYALSASFEPFS	79.36
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	87	105	19	KGQTLVVQFTVKHEQNIDC	86.8
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	108	122	15	GYVKLFPNSLDQTDM	80.36
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	124	133	10	GDSEYNIMFG	84.18
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	143	160	18	KVHVIFNYKGKNVLINKD	97.21
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	164	175	12	KDDEFTHLYTLI	84.64
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	178	205	28	PDNTYEVKIDNSQVESGSLEDDWDFLPP	82.97
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	286	300	15	KGTWIHPEIDNPEYS	77.26
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	302	357	56	DPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQM	81.82
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	18	40	23	EPAVYFKEQFLDGDGWTSRWIES	79.12
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	45	59	15	DFGKFVLSSGKFYGD	82.03
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	65	85	21	GLQTSQDARFYALSASFEPFS	79.36
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	87	105	19	KGQTLVVQFTVKHEQNIDC	86.8
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	108	122	15	GYVKLFPNSLDQTDM	80.36
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	124	133	10	GDSEYNIMFG	84.18
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	143	160	18	KVHVIFNYKGKNVLINKD	97.21
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	164	175	12	KDDEFTHLYTLI	84.64
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	178	205	28	PDNTYEVKIDNSQVESGSLEDDWDFLPP	82.97
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	286	300	15	KGTWIHPEIDNPEYS	77.26
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	308	417	310	357	48	NFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQM	81.36
DP00334	Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	Homo sapiens (Human)	1	24	12	19	8	GAVTTSQI	86.62
DP00334	Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	Homo sapiens (Human)	210	304	233	270	38	GDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSD	78.81
DP00334	Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	Homo sapiens (Human)	210	304	272	299	28	DDEVYQVTVYQAGESDTDSFEEDPEISL	78.2
DP00335	Q64364	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p19ARF)	Mus musculus (Mouse)	1	37	4	12	9	RFLVTVRIQ	83.28
DP00335	Q64364	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p19ARF)	Mus musculus (Mouse)	1	37	19	28	10	QERVFLVKFV	88.6
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	12	29	18	SSENFDELLKALGVNAML	76.9
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	32	46	15	VAVAAASKPHVEIRQ	75.14
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	48	77	30	GDQFYIKTSTTVRTTEINFKVGEGFEEETV	80.43
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	87	95	9	TWENENKIH	78.26
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	107	113	7	KTYWTRE	75.25
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	116	124	9	NDELILTFG	89.89
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	1	133	21	48	28	AVSHWQQQSYLDSGIHSGATTTAPSLSG	85.2
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	1	133	60	76	17	SQVLYEWEQGFSQSFTQ	80.54
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	1	133	78	89	12	QVADIDGQYAMT	76.37
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	17	48	21	43	23	AVSHWQQQSYLDSGIHSGATTTA	85.11
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	664	781	674	694	21	LSVELTSSLFRTEPMAWNETA	78.15
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	664	781	769	776	8	GDSNQLAW	79.89
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	672	781	674	694	21	LSVELTSSLFRTEPMAWNETA	78.15
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	672	781	769	776	8	GDSNQLAW	79.89
DP00342	P09883	Colicin-E9 (EC 3.1.-.-)	Escherichia coli	1	83	36	43	8	GSGWSSEN	75.25
DP00342	P09883	Colicin-E9 (EC 3.1.-.-)	Escherichia coli	1	61	36	43	8	GSGWSSEN	75.25
DP00343	Q9Y6Q9	Nuclear receptor coactivator 3 (NCoA-3) (EC 2.3.1.48) (ACTR) (Amplified in breast cancer 1 protein) (AIB-1) (CBP-interacting protein) (pCIP) (Class E basic helix-loop-helix protein 42) (bHLHe42) (Receptor-associated coactivator 3) (RAC-3) (Steroid receptor coactivator protein 3) (SRC-3) (Thyroid hormone receptor activator molecule 1) (TRAM-1)	Homo sapiens (Human)	1018	1088	1054	1065	12	LDQLHTLLSNTD	79.01
DP00345	P16535	Leukotoxin (Lkt)	Mannheimia haemolytica (Pasteurella haemolytica)	884	953	884	904	21	GNGKITQDELSKVVDNYELLK	78.56
DP00345	P16535	Leukotoxin (Lkt)	Mannheimia haemolytica (Pasteurella haemolytica)	884	953	908	927	20	NVTNSLDKLISSVSAFTSSN	78.95
DP00345	P16535	Leukotoxin (Lkt)	Mannheimia haemolytica (Pasteurella haemolytica)	884	953	940	948	9	LDQSLSSLQ	78.52
DP00347	P04972	"Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)"	Bos taurus (Bovine)	1	87	46	52	7	GVQGFGD	77.26
DP00347	P04972	"Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)"	Bos taurus (Bovine)	1	87	63	82	20	DITVICPWEAFNHLELHELA	79.67
DP00347	P04972	"Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)"	Bos taurus (Bovine)	46	78	46	52	7	GVQGFGD	77.26
DP00347	P04972	"Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)"	Bos taurus (Bovine)	46	78	63	73	11	DITVICPWEAF	79.45
DP00348	P45481	Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Mus musculus (Mouse)	2059	2118	2084	2113	30	QQQVLNILKSNPQLMAAFIKQRTAKYVANQ	80
DP00348	P45481	Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Mus musculus (Mouse)	2059	2117	2084	2112	29	QQQVLNILKSNPQLMAAFIKQRTAKYVAN	80.21
DP00348	P45481	Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Mus musculus (Mouse)	2113	2152	2139	2147	9	SLQNLNAMQ	76.07
DP00349	P06709	Bifunctional ligase/repressor BirA (Biotin operon repressor) (Biotin--acetyl-CoA-carboxylase ligase) (EC 6.3.4.15) (Biotin--protein ligase) (Biotin-acetyl-CoA carboxylase synthetase)	Escherichia coli (strain K12)	212	234	217	229	13	SVVNQGWITLQEA	82.89
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	573	579	7	GEGATFD	79.31
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	592	604	13	LLGSFLNTASASS	80.55
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	624	630	7	PAVNIQP	91.97
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	632	641	10	VSGAWDWHTK	76.92
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	683	690	8	GGSSFASK	80.94
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	721	732	12	QGGGYNWQQTQS	76.48
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	745	756	12	NRPNYNVSFSSM	77.29
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	766	772	7	AAANLEG	79.93
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	780	792	13	EDLLSGQGFNAHK	75.25
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	796	803	8	GPRTIAEM	74.58
DP00352	O33599	Glycyl-glycine endopeptidase LytM (EC 3.4.24.75) (Autolysin LytM)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	147	182	150	158	9	NNQAYNSHD	78.11
DP00352	O33599	Glycyl-glycine endopeptidase LytM (EC 3.4.24.75) (Autolysin LytM)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	147	182	161	167	7	GKVNYPN	87.29
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	90	6	64	59	GNQVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQNNNSG	78.02
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	90	68	81	14	SQNNDNENNIKNTL	78.09
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	89	6	64	59	GNQVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQNNNSG	78.02
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	89	68	81	14	SQNNDNENNIKNTL	78.09
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	273	294	278	286	9	NAAAYSAGT	85.51
DP00356	Q99967	Cbp/p300-interacting transactivator 2 (MSG-related protein 1) (MRG-1) (P35srj)	Homo sapiens (Human)	220	269	220	241	22	TDFIDEEVLMSLVIEMGLDRIK	82.43
DP00356	Q99967	Cbp/p300-interacting transactivator 2 (MSG-related protein 1) (MRG-1) (P35srj)	Homo sapiens (Human)	220	269	243	262	20	LPELWLGQNEFDFMTDFVCK	79.5
DP00357	P62328	Thymosin beta-4 (T beta-4) (Fx) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Homo sapiens (Human)	1	44	6	14	9	DMAEIEKFD	81.72
DP00357	P62328	Thymosin beta-4 (T beta-4) (Fx) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Homo sapiens (Human)	1	44	31	37	7	SKETIEQ	75.92
DP00357	P62328	Thymosin beta-4 (T beta-4) (Fx) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Homo sapiens (Human)	17	44	31	37	7	SKETIEQ	75.92
DP00359	A6Q0K5	Calvin cycle protein CP12; chloroplastic (CP12 domain-containing protein) (Chloroplast protein 12)	Chlamydomonas reinhardtii (Chlamydomonas smithii)	1	50	5	11	7	KSVVISR	81.08
DP00365	P53041	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	Homo sapiens (Human)	19	147	34	41	8	QANDYFKA	79.97
DP00365	P53041	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	Homo sapiens (Human)	19	147	44	101	58	YENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYR	79.75
DP00365	P53041	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	Homo sapiens (Human)	19	147	103	113	11	AASNMALGKFR	79.93
DP00365	P53041	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	Homo sapiens (Human)	19	147	132	142	11	AKMKYQECNKI	80.12
DP00372	Q9NR00	Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)	Homo sapiens (Human)	1	106	7	18	12	HQAVIMSTSLRV	83.7
DP00372	Q9NR00	Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)	Homo sapiens (Human)	1	106	35	56	22	AVGNIFENTDQESLERLFRNSG	80.15
DP00372	Q9NR00	Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)	Homo sapiens (Human)	1	106	63	77	15	RAKIIFAIDQDVEEK	96.3
DP00372	Q9NR00	Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)	Homo sapiens (Human)	1	106	89	101	13	KDKLFQFLKLRKY	80.89
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	153	215	154	163	10	NLQNQQVLTG	83.68
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	153	215	167	199	33	VMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQD	79.12
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	153	215	202	210	9	GQIQIIPGA	92.23
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	366	382	17	DALNIQQNQTSGGSLQA	77.1
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	391	403	13	NQQTQQQQILIQP	88.6
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	408	417	10	GGQALQALQA	76.49
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	421	442	22	SGQTFTTQAISQETLQNLQLQA	80.05
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	446	452	7	SGPIIIR	79.55
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	460	483	24	GQVSWQTLQLQNLQVQNPQAQTIT	77.49
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	366	382	17	DALNIQQNQTSGGSLQA	77.1
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	391	403	13	NQQTQQQQILIQP	88.6
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	408	417	10	GGQALQALQA	76.49
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	421	442	22	SGQTFTTQAISQETLQNLQLQA	80.05
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	446	452	7	SGPIIIR	79.55
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	460	485	26	GQVSWQTLQLQNLQVQNPQAQTITLA	77.32
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	557	564	8	QNEKFFRN	77.76
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	568	591	24	GEVDFRDIDLTDEILTYVQDSLSK	81.05
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	601	611	11	QQQSLALNSSC	78.93
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	645	663	19	MQVNGMFENWNSNQFVPFN	82.91
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	668	688	21	DPQQYNVFTDLHGISQEFPYK	79.36
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	696	704	9	YTQNFISCN	83.72
DP00385	P49841	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	Homo sapiens (Human)	1	34	8	14	7	TSFAESC	75.25
DP00385	P49841	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	Homo sapiens (Human)	1	34	19	26	8	QPSAFGSM	76.25
DP00385	P49841	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	Homo sapiens (Human)	1	33	8	14	7	TSFAESC	75.25
DP00385	P49841	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	Homo sapiens (Human)	1	33	19	26	8	QPSAFGSM	76.25
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	24	34	11	ANRQFVLYTLD	81.3
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	38	58	21	NDELRVGLSVSKKIGNAVMRN	74.71
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	64	72	9	IRQAFLEEK	76.63
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	78	85	8	KDYIIIAR	96.82
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	88	97	10	ASQLTYEETK	90.87
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	99	111	13	SLQHLFRKSSLYK	85.03
DP00389	P09983	Hemolysin; chromosomal	Escherichia coli	962	1023	962	994	33	DALAYGSQGNLNPLINEISKIISAAGNFDVKEE	81.23
DP00389	P09983	Hemolysin; chromosomal	Escherichia coli	962	1023	996	1018	23	AAASLLQLSGNASDFSYGRNSIT	81.34
DP00396	O74718	Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF3) (ERF2) (Polypeptide release factor 3) (Translation release factor 3)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	280	307	282	296	15	KESWYLSWALDSTSE	78.97
DP00398	P07342	Acetolactate synthase catalytic subunit; mitochondrial (EC 2.2.1.6) (Acetohydroxy-acid synthase catalytic subunit) (AHAS) (ALS)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	647	687	660	668	9	GLDEFINFD	90.71
DP00399	P50097	"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)"	Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis)	102	221	112	124	13	PDQTFADVLAISQ	82.22
DP00399	P50097	"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)"	Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis)	102	221	140	161	22	HGVLLGLVTQRDYPIDLTQTET	80.27
DP00399	P50097	"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)"	Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis)	102	221	184	201	18	EANKIIWEKKLNALPIID	82.5
DP00399	P50097	"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)"	Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis)	102	221	204	213	10	QHLRYIVFRK	79.67
DP00407	P07363	Chemotaxis protein CheA (EC 2.7.13.3)	Escherichia coli (strain K12)	124	158	124	130	7	RQLALEA	79.26
DP00410	P12497	Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)	Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1)	108	143	122	138	17	TGNNSQVSQNYPIVQNL	76.45
DP00410	P12497	Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)	Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1)	123	143	126	138	13	SQVSQNYPIVQNL	77.23
DP00415	P0ABE0	Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)	Escherichia coli O157:H7	49	76	57	70	14	AQSNAAAPATVPSM	77.26
DP00418	P78504	Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339)	Homo sapiens (Human)	1094	1218	1118	1124	7	QLNQIKN	79.93
DP00418	P78504	Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339)	Homo sapiens (Human)	1094	1218	1129	1137	9	HGANTVPIK	76.03
DP00418	P78504	Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339)	Homo sapiens (Human)	1094	1218	1172	1179	8	KQPAYTLV	80.27
DP00418	P78504	Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339)	Homo sapiens (Human)	1094	1218	1207	1213	7	SAQSLNR	78.17
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	13	54	42	GIKLSADVKPFVPRFAGLNVAWLESSEACVFPSSAATYYPFV	79.57
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	60	96	37	TEQKIYTEDMAFGASTFPPQYLSSEITLHPYAYSPYT	80.22
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	100	106	7	TQNVYSV	87.86
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	108	126	19	GSQYLYNQPSCYRGFQTVK	77.06
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	139	149	11	MKALFKKKTYD	77.26
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	164	175	12	ADGTISSEIKSA	81.83
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	179	190	12	HHLSIYAENSLK	83.25
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	201	224	24	KSRIIAKNVSTSKPEFEFTTLDFP	81.41
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	226	237	12	LQGAENNMSEIQ	81.77
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	262	275	14	AAVLSKGEIVVKNN	78.36
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	277	289	13	NESVTANAATNSP	77.72
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	293	314	22	RELSWTPMGYVVRQTLSTELSA	75.05
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	317	332	16	KNVTSMINLKTIASSA	85.68
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	335	359	25	KNVSIPSSEALSSDPSYNKEKHIIH	76.63
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	388	397	10	STSKYEVLTV	86.05
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	405	417	13	DAEEFPNLAVASE	78.65
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	453	461	9	GGMLTALEK	73.91
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	531	539	9	SLKKIILKE	79.45
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	547	559	13	LQENAVSPAFTSD	75.92
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	584	590	7	MDELIST	79.74
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	776	854	780	786	7	VQQELVG	82.61
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	776	854	817	825	9	EPHYIEIWK	84.58
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	776	854	827	849	23	HLEAYSGCTLELEESLEASTSQM	75.88
DP00421	P07516	Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)	Bos taurus (Bovine)	1	202	37	43	7	MLFRLSE	74.96
DP00421	P07516	Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)	Bos taurus (Bovine)	1	202	81	105	25	AVQRIAESHLQSISNLGENQASEEE	81.78
DP00422	P0A6R3	DNA-binding protein Fis (Factor-for-inversion stimulation protein) (Hin recombinational enhancer-binding protein)	Escherichia coli (strain K12)	1	23	4	18	15	QRVNSDVLTVSTVNS	80.38
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	166	252	176	188	13	SSLTYKEMILKSM	77.87
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	166	252	196	212	17	GSSRIVLKKYVKDTFSS	82.06
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	166	252	216	229	14	TSSNFDYLFNSAIK	85.16
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	171	258	176	188	13	SSLTYKEMILKSM	77.87
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	171	258	196	212	17	GSSRIVLKKYVKDTFSS	82.06
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	171	258	216	229	14	TSSNFDYLFNSAIK	85.16
DP00424	P04325	Protein Rev (ART/TRS) (Anti-repression transactivator) (Regulator of expression of viral proteins)	Human immunodeficiency virus type 1 group M subtype B (isolate PCV12) (HIV-1)	62	116	99	111	13	SPQILVESPTILE	74.35
DP00427	P0AFG8	Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1)	Escherichia coli (strain K12)	1	55	15	27	13	RDWLQAIESVIRE	79.93
DP00427	P0AFG8	Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1)	Escherichia coli (strain K12)	1	55	32	44	13	RAQYLIDQLLAEA	85.49
DP00435	Q01853	Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP)	Mus musculus (Mouse)	736	806	751	764	14	DIRKYEMFAQTLQQ	81.15
DP00435	Q01853	Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP)	Mus musculus (Mouse)	736	806	767	774	8	GFGSFRFP	76.51
DP00435	Q01853	Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP)	Mus musculus (Mouse)	736	806	792	799	8	GGSVYTED	83.15
DP00436	P50477	Canavalin	Canavalia ensiformis (Jack bean) (Dolichos ensiformis)	1	45	2	29	28	AFSARFPLWLLLGVVLLASVSASFAHSG	78.33
DP00437	P43351	DNA repair protein RAD52 homolog	Homo sapiens (Human)	1	23	4	10	7	TEEAILG	89.97
DP00438	Q05158	Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2)	Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)	68	115	76	83	8	GAGTLNMD	78.93
DP00438	Q05158	Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2)	Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)	82	117	106	112	7	NTSKFAQ	85.91
DP00446	O35718	Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (Protein EF-10)	Mus musculus (Mouse)	186	225	200	206	7	HLDSYEK	75.35
DP00446	O35718	Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (Protein EF-10)	Mus musculus (Mouse)	186	225	213	220	8	PIREFLDQ	74.25
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	16	29	14	RATKFLESIKGKFT	78.88
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	37	67	31	KDSIISVNSTDIEVTKESPITSNSTIINPTN	82.19
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	83	90	8	PLVSFKED	78.26
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	94	133	40	SDNPFSKLYKETIETFDNNEEESSYSYEEINDQTNDNITA	82.79
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	141	157	17	KLSEILGMLHTLVVASA	78.73
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	174	196	23	REEMIEKIRTEALMTNDRLEAMA	80.28
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	222	230	9	KLNNLLEGN	74.84
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	118	16	29	14	RATKFLESIKGKFT	78.88
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	118	37	67	31	KDSIISVNSTDIEVTKESPITSNSTIINPTN	82.19
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	118	83	90	8	PLVSFKED	78.26
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	118	94	113	20	SDNPFSKLYKETIETFDNNE	79.25
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	102	16	29	14	RATKFLESIKGKFT	78.88
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	102	37	67	31	KDSIISVNSTDIEVTKESPITSNSTIINPTN	82.19
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	102	83	90	8	PLVSFKED	78.26
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	161	241	174	196	23	REEMIEKIRTEALMTNDRLEAMA	80.28
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	161	241	222	230	9	KLNNLLEGN	74.84
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	164	241	174	196	23	REEMIEKIRTEALMTNDRLEAMA	80.28
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	164	241	222	230	9	KLNNLLEGN	74.84
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	198	241	222	230	9	KLNNLLEGN	74.84
DP00448	Q9Y613	FH1/FH2 domain-containing protein 1 (Formin homolog overexpressed in spleen 1) (FHOS) (Formin homology 2 domain-containing protein 1)	Homo sapiens (Human)	1104	1164	1110	1117	8	LLVQSVTK	77.26
DP00448	Q9Y613	FH1/FH2 domain-containing protein 1 (Formin homolog overexpressed in spleen 1) (FHOS) (Formin homology 2 domain-containing protein 1)	Homo sapiens (Human)	1104	1164	1150	1158	9	LVQALGLSK	75.92
DP00449	P53563	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Rattus norvegicus (Rat)	31	80	47	60	14	TPSAINGNPSWHLA	84.95
DP00455	P84092	AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein)	Rattus norvegicus (Rat)	130	158	130	140	11	KTFITQQGIKS	79.69
DP00455	P84092	AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein)	Rattus norvegicus (Rat)	130	158	147	153	7	EQSQITS	77.11
DP00455	P84092	AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein)	Rattus norvegicus (Rat)	135	158	147	153	7	EQSQITS	77.11
DP00458	P37727	Rab proteins geranylgeranyltransferase component A 1 (Choroideremia protein homolog) (Rab escort protein 1) (REP-1)	Rattus norvegicus (Rat)	108	208	110	141	32	KDVEEAGALQKNHASVTSAQSAEAAEAAETSC	77.58
DP00461	P08083	Colicin-N	Escherichia coli	1	90	6	15	10	ADNAHNNAFG	80.13
DP00461	P08083	Colicin-N	Escherichia coli	1	90	21	27	7	GIGNTSG	80.27
DP00461	P08083	Colicin-N	Escherichia coli	1	90	42	48	7	NGWSWSN	82.04
DP00461	P08083	Colicin-N	Escherichia coli	1	90	58	70	13	SDGSYHITFHGDN	78.44
DP00461	P08083	Colicin-N	Escherichia coli	2	90	6	15	10	ADNAHNNAFG	80.13
DP00461	P08083	Colicin-N	Escherichia coli	2	90	21	27	7	GIGNTSG	80.27
DP00461	P08083	Colicin-N	Escherichia coli	2	90	42	48	7	NGWSWSN	82.04
DP00461	P08083	Colicin-N	Escherichia coli	2	90	58	70	13	SDGSYHITFHGDN	78.44
DP00461	P08083	Colicin-N	Escherichia coli	40	76	42	48	7	NGWSWSN	82.04
DP00461	P08083	Colicin-N	Escherichia coli	40	76	58	70	13	SDGSYHITFHGDN	78.44
DP00462	P11157	Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)	Mus musculus (Mouse)	1	64	14	21	8	QQQLQLSP	76.76
DP00462	P11157	Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)	Mus musculus (Mouse)	1	64	47	59	13	AARRIFQDSAELE	77.44
DP00462	P11157	Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)	Mus musculus (Mouse)	353	390	353	371	19	NISLEGKTNFFEKRVGEYQ	78.61
DP00462	P11157	Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)	Mus musculus (Mouse)	353	390	373	385	13	MGVMSNSTENSFT	77.31
DP00463	Q9Z0U4	Gamma-aminobutyric acid type B receptor subunit 1 (GABA-B receptor 1) (GABA-B-R1) (GABA-BR1) (GABABR1) (Gb1)	Rattus norvegicus (Rat)	17	98	49	66	18	QVKAINFLPVDYEIEYVC	86.55
DP00463	Q9Z0U4	Gamma-aminobutyric acid type B receptor subunit 1 (GABA-B receptor 1) (GABA-B-R1) (GABA-BR1) (GABABR1) (Gb1)	Rattus norvegicus (Rat)	17	98	82	89	8	ANGSWTDM	79.14
DP00466	P04156	Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Homo sapiens (Human)	23	124	29	39	11	GGWNTGGSRYP	80.94
DP00466	P04156	Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Homo sapiens (Human)	23	124	95	101	7	THSQWNK	73.91
DP00468	P25963	NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3)	Homo sapiens (Human)	1	66	38	54	17	KDEEYEQMVKELQEIRL	82.71
DP00468	P25963	NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3)	Homo sapiens (Human)	276	317	285	312	28	DEESYDTESEFTEFTEDELPYDDCVFGG	79.47
DP00469	O24646	Transcription factor HY5 (Protein LONG HYPOCOTYL 5) (bZIP transcription factor 56) (AtbZIP56)	Arabidopsis thaliana (Mouse-ear cress)	1	77	2	15	14	QEQATSSLAASSLP	74.18
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	20	27	8	LAGHFTQD	84.28
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	54	69	16	LGVASEDELVAEFLQD	78.66
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	78	100	23	APQTFKMDDLLAEMQQIEQSNFR	81.42
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	110	125	16	ADLALSENWAQEFLAA	79.93
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	129	148	20	VDVTQDYNETDWSQEFISEV	81.3
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	159	175	17	WAEEYLEQSEEKLWLGE	75.96
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	181	190	10	TDRWYDEYHP	80.27
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	193	205	13	DLQHTASDFVAKV	76.85
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	209	223	15	KLANSEFLKFVRQIG	87.78
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	225	231	7	GQVSLES	79.41
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	239	298	60	QAEQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEM	78.64
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	306	319	14	HPWLSDYDDLTSAT	79.67
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	110	20	27	8	LAGHFTQD	84.28
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	110	54	69	16	LGVASEDELVAEFLQD	78.66
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	110	78	100	23	APQTFKMDDLLAEMQQIEQSNFR	81.42
DP00473	Q49AN0	Cryptochrome-2	Homo sapiens (Human)	490	593	496	522	27	SRLNIERMKQIYQQLSRYRGLCLLASV	78.53
DP00474	Q43125	Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2)	Arabidopsis thaliana (Mouse-ear cress)	506	681	511	524	14	GDSAEVEEAPIEFP	76.9
DP00474	Q43125	Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2)	Arabidopsis thaliana (Mouse-ear cress)	506	681	565	572	8	SLNLRNSV	75.75
DP00474	Q43125	Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2)	Arabidopsis thaliana (Mouse-ear cress)	506	681	599	619	21	NQVTAMIPEFNIRIVAESTED	79.61
DP00474	Q43125	Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2)	Arabidopsis thaliana (Mouse-ear cress)	506	681	660	676	17	TTSSYLQNHHEILNWRR	79.64
DP00475	Q6Q547	H/ACA ribonucleoprotein complex subunit NOP10 (Nucleolar protein 10) (Nucleolar protein family A member 3) (snoRNP protein NOP10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	17	38	22	28	7	ESGEITK	75.25
DP00482	Q08826	Sorting nexin-3 (Golgi retention deficient protein 19)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	29	3	18	16	REFKSFGSTEKSLLSK	73.91
DP00485	Q9UBE0	SUMO-activating enzyme subunit 1 (Ubiquitin-like 1-activating enzyme E1A) Cleaved into: SUMO-activating enzyme subunit 1; N-terminally processed	Homo sapiens (Human)	289	311	290	299	10	DFVRYCFSEM	78.66
DP00486	Q9UBT2	SUMO-activating enzyme subunit 2 (EC 2.3.2.-) (Anthracycline-associated resistance ARX) (Ubiquitin-like 1-activating enzyme E1B) (Ubiquitin-like modifier-activating enzyme 2)	Homo sapiens (Human)	551	640	562	568	7	AAKSITN	79.93
DP00486	Q9UBT2	SUMO-activating enzyme subunit 2 (EC 2.3.2.-) (Anthracycline-associated resistance ARX) (Ubiquitin-like 1-activating enzyme E1B) (Ubiquitin-like modifier-activating enzyme 2)	Homo sapiens (Human)	551	640	585	593	9	DDVLIVDSD	98.33
DP00487	P09938	Ribonucleoside-diphosphate reductase small chain 1 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 1) (Ribonucleotide reductase small subunit 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	41	11	36	26	ADALSDLEIKDSKSNLNKELETLREE	79.07
DP00488	P49723	Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	51	3	15	13	AHNQFLKTFQKER	80.19
DP00488	P49723	Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	51	23	46	24	KDEILLMENSRRFVMFPIKYHEIW	76.99
DP00490	O88900	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Rattus norvegicus (Rat)	361	435	369	380	12	VSENSLVAMDFS	75.25
DP00490	O88900	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Rattus norvegicus (Rat)	361	435	383	389	7	KTRVIDN	74.25
DP00490	O88900	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Rattus norvegicus (Rat)	361	435	391	406	16	TEALSVAVEEGLAWRK	77.17
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	654	662	9	VVEWTNNTL	80.27
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	669	680	12	KEQIIGLSRRIA	91.97
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	689	695	7	AFSNALE	78.26
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	699	708	10	KALSIAVTGS	80.67
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	713	719	7	HLQFIPV	81.89
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	182	205	24	KDILSEASTMQLLQQQQQEAVSEG	76.2
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	221	233	13	SKDNYLGGTSTIS	83.43
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	250	258	9	GVEALEHLS	76.7
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	305	318	14	DTAEYSPFKGGYTK	74.41
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	344	351	8	TLSLYKSG	92.64
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	355	371	17	EAAAYQSRDYYNFPLAL	83.12
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	395	416	22	YGSAWAAAAAQCRYGDLASLHG	79.74
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	433	449	17	SSWHTLFTAEEGQLYGP	82.59
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	310	316	7	EQASIEM	80.32
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	320	329	10	AAREIRRAIT	77.26
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	338	354	17	NCVNKDHLTAATHWASM	77.06
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	364	372	9	NGAAYSRYP	79.97
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	386	399	14	AVEGIVPSAMSLSH	81.27
DP00505	P04234	T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d)	Homo sapiens (Human)	127	171	138	151	14	DTQALLRNDQVYQP	76.37
DP00505	P04234	T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d)	Homo sapiens (Human)	127	171	156	166	11	DDAQYSHLGGN	79.26
DP00506	P07766	T-cell surface glycoprotein CD3 epsilon chain (T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e)	Homo sapiens (Human)	153	207	195	202	8	QRDLYSGL	76.09
DP00508	P09693	T-cell surface glycoprotein CD3 gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g)	Homo sapiens (Human)	139	182	156	162	7	NDQLYQP	97.99
DP00508	P09693	T-cell surface glycoprotein CD3 gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g)	Homo sapiens (Human)	139	182	170	177	8	QYSHLQGN	75.25
DP00510	O60356	Nuclear protein 1 (Candidate of metastasis 1) (Protein p8)	Homo sapiens (Human)	1	82	26	38	13	ESDLYSLAHSYLG	78.85
DP00517	P52179	Myomesin-1 (190 kDa connectin-associated protein) (190 kDa titin-associated protein) (Myomesin family member 1)	Homo sapiens (Human)	836	931	871	877	7	KDALLGS	75.92
DP00517	P52179	Myomesin-1 (190 kDa connectin-associated protein) (190 kDa titin-associated protein) (Myomesin family member 1)	Homo sapiens (Human)	836	931	891	907	17	LGQTEVSKVSETVQEEL	75.37
DP00518	O54918	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	Mus musculus (Mouse)	1	113	73	86	14	SPLFIFVRRSSLLS	95.63
DP00518	O54918	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	Mus musculus (Mouse)	1	113	88	97	10	SSSGYFSFDT	88.8
DP00518	O54918	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	Mus musculus (Mouse)	85	113	88	97	10	SSSGYFSFDT	88.8
DP00518	O54918	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	Mus musculus (Mouse)	139	171	153	166	14	IGDEFNETYTRRVF	82.51
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1393	1405	13	LDSFESRSIASSV	77.93
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1413	1420	8	MVSGIISP	86.2
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1470	1484	15	AAVNAAVQRVQVLPD	78.66
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1487	1495	9	TLLHFATES	79.86
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1505	1525	21	SLSALSLDEPFIQKDVELRIM	77.15
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1528	1539	12	VQENDNGNETES	75.25
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1543	1558	16	KESNENQEKEAEKTID	77.45
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1570	1582	13	DDIEILEECIISA	79.21
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1647	1662	16	TPINFSTATSLSDLTI	80.73
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1722	1731	10	DILAECINSA	76.42
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1459	1532	1470	1484	15	AAVNAAVQRVQVLPD	78.66
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1459	1532	1487	1495	9	TLLHFATES	79.86
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1459	1532	1505	1525	21	SLSALSLDEPFIQKDVELRIM	77.15
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1614	1679	1647	1662	16	TPINFSTATSLSDLTI	80.73
DP00520	Q969F2	Protein naked cuticle homolog 2 (Naked-2) (hNkd2)	Homo sapiens (Human)	1	217	23	32	10	SFVASAYASG	93.38
DP00520	Q969F2	Protein naked cuticle homolog 2 (Naked-2) (hNkd2)	Homo sapiens (Human)	1	217	105	114	10	QRLNIDALQC	86.29
DP00520	Q969F2	Protein naked cuticle homolog 2 (Naked-2) (hNkd2)	Homo sapiens (Human)	1	217	123	134	12	RQEWTFTLYDFD	83.92
DP00520	Q969F2	Protein naked cuticle homolog 2 (Naked-2) (hNkd2)	Homo sapiens (Human)	1	217	147	163	17	LMHTIYEVVDASVNHSS	78.6
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	1	8	8	MATLIYVD	97.37
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	65	75	11	GTVNRATEKSV	76.25
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	107	121	15	SDDAYPEIEKFFPFN	81.61
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	123	129	7	LDFESFD	84.85
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	144	150	7	VPLMILD	77.26
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	155	162	8	LEKLFQLG	82.61
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	174	194	21	WESNLLQSPSSILSTLDVELP	76.84
DP00527	P02783	Seminal vesicle secretory protein 4 (Androgen-dependent protein) (ADP) (Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV) (SVS protein S)	Rattus norvegicus (Rat)	1	70	3	21	19	STSLFLCSLLLLLVTGAIG	79.39
DP00527	P02783	Seminal vesicle secretory protein 4 (Androgen-dependent protein) (ADP) (Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV) (SVS protein S)	Rattus norvegicus (Rat)	1	70	24	42	19	TKEKYSQSEEVVSESFASG	77.93
DP00530	P12950	Dehydrin DHN1 (M3) (RAB-17 protein)	Zea mays (Maize)	1	168	139	147	9	TGGAYATGT	79.34
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	115	8	15	8	HHHLFHHK	74.58
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	115	21	30	10	GPVDYEKEIK	73.91
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	115	34	54	21	HLEQIGKLGTVAAGAYALHEK	79.9
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	115	69	89	21	IEEEIAAAAAVGAGGFAFHEH	81.73
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	61	115	69	89	21	IEEEIAAAAAVGAGGFAFHEH	81.73
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	270	287	18	THGSISPQEESVSPNISS	76.87
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	309	330	22	SKELIVSEEIPINSSEQESDYE	76.77
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	332	340	9	NNETSVLSS	78.15
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	356	365	10	GRENFVYANN	88.36
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	386	393	8	SDEAIIPV	84.99
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	401	432	32	GSELSSKIRKIHIQETQEFSKNYTTETDNEMN	77.98
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	459	483	25	NAKMIDFATLSKLKKKYQIILDRFA	81.69
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	493	514	22	QLNKLTDEQSSLDVAGLEDKFR	73.91
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	521	540	20	GRETILSNFNADINLEESIR	81.44
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	1	131	2	20	19	ATIATGLNIATQRVFVTSE	80.46
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	1	131	28	44	17	GPVHLNNSWNLGSRTTN	79.17
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	1	131	84	96	13	CVAAWDEVEELSA	77.21
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	1	131	112	118	7	PLEEYCK	79.93
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	54	131	84	96	13	CVAAWDEVEELSA	77.21
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	54	131	112	118	7	PLEEYCK	79.93
DP00537	O43236	Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2)	Homo sapiens (Human)	1	119	20	27	8	GIKRFLED	75.25
DP00537	O43236	Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2)	Homo sapiens (Human)	1	119	33	47	15	ELSKFVKDFSGNASC	86.96
DP00537	O43236	Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2)	Homo sapiens (Human)	1	119	68	78	11	APDLYDDDLEF	78.47
DP00537	O43236	Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2)	Homo sapiens (Human)	1	119	88	97	10	DNQQYFCAPA	79.63
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	207	215	9	VQVKRVLEK	75.92
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	310	319	10	ETVSIEVKEV	78.29
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	323	329	7	LLVSTLG	76.02
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	438	451	14	PAVATAATAAEKYK	80.48
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	207	310	207	215	9	VQVKRVLEK	75.92
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	207	310	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	261	330	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	261	330	310	319	10	ETVSIEVKEV	78.29
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	285	313	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	285	309	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	335	486	438	451	14	PAVATAATAAEKYK	80.48
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	7	28	22	EETKISTEPVDNAWSMKIPAFR	76.06
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	35	67	33	GMVEESSFATLFPKYRERYLKEVWPLVEQCLAE	75.62
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	90	98	9	WDPYIIIKA	78.78
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	123	133	11	GCDIIKIGNLV	81.73
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	153	179	27	TLKSIELLTDCYVLVQGNTVSALGPYK	76.66
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	186	193	8	DIVLETMN	77.01
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	195	207	13	VHPIYNIKALMIK	79.26
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	262	274	13	KQLASGEYFLNQE	78.65
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	187	199	13	RLLSFRDVDFEED	76.97
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	210	216	7	TLGLSSV	77.26
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	223	232	10	LQSLSGEPYS	80.27
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	242	252	11	GLEETGARALG	73.91
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	302	313	12	LPSQYLADVDTS	74.25
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	337	344	8	ETQILELN	80.23
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	349	361	13	AVEHLLVHLENTV	79.8
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	388	398	11	LEELTSNISGS	87.84
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	1	63	3	10	8	GLVDSNPA	74.58
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	1	63	33	40	8	RDACIIEK	77.97
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	1	63	45	51	7	CGHLIEA	77.4
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	1	29	3	10	8	GLVDSNPA	74.58
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	25	63	33	40	8	RDACIIEK	77.97
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	25	63	45	51	7	CGHLIEA	77.4
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	25	60	33	40	8	RDACIIEK	77.97
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	25	60	45	51	7	CGHLIEA	77.4
DP00544	B0FRH7	Protein LLP (Protein LAPS18-like)	"Aplysia kurodai (Kurodas sea hare)"	1	120	35	55	21	KAQELDLDNVVTMKSAEEIKN	74.79
DP00544	B0FRH7	Protein LLP (Protein LAPS18-like)	"Aplysia kurodai (Kurodas sea hare)"	1	120	81	94	14	TQQNEDGHYPQWMN	76.59
DP00546	Q9NX55	Huntingtin-interacting protein K (Huntingtin yeast partner K)	Homo sapiens (Human)	1	129	13	23	11	GDVELELETET	75.22
DP00546	Q9NX55	Huntingtin-interacting protein K (Huntingtin yeast partner K)	Homo sapiens (Human)	1	129	54	69	16	EIQSSNLETAMSVIGD	80.23
DP00546	Q9NX55	Huntingtin-interacting protein K (Huntingtin yeast partner K)	Homo sapiens (Human)	1	129	94	105	12	DLELIMTEMEIS	79.4
DP00546	Q9NX55	Huntingtin-interacting protein K (Huntingtin yeast partner K)	Homo sapiens (Human)	1	129	118	124	7	GNVVEAL	83.52
DP00549	O00488	Zinc finger protein 593 (Zinc finger protein T86)	Homo sapiens (Human)	36	77	65	72	8	ACARYFID	78.64
DP00549	O00488	Zinc finger protein 593 (Zinc finger protein T86)	Homo sapiens (Human)	78	116	89	102	14	LKQLSVEPYSQEEA	75.25
DP00550	P02628	Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3)	Esox lucius (Northern pike)	1	108	19	36	18	AEGSFNHKKFFALVGLKA	86.79
DP00550	P02628	Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3)	Esox lucius (Northern pike)	1	108	53	70	18	ASGFIEEEELKFVLKSFA	79.49
DP00550	P02628	Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3)	Esox lucius (Northern pike)	1	108	80	88	9	ETKAFLKAA	75.62
DP00550	P02628	Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3)	Esox lucius (Northern pike)	1	108	92	103	12	GDGKIGIDEFET	79.6
DP00551	P16860	Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)	Homo sapiens (Human)	1	77	9	24	16	RALLLLLFLHLAFLGG	80.18
DP00551	P16860	Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)	Homo sapiens (Human)	1	77	36	42	7	SDLETSG	74.92
DP00551	P16860	Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)	Homo sapiens (Human)	1	77	53	66	14	KLSELQVEQTSLEP	75.92
DP00552	P0AFX7	Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein)	Escherichia coli (strain K12)	121	216	123	129	7	GQSETSQ	79.93
DP00552	P0AFX7	Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein)	Escherichia coli (strain K12)	121	216	134	140	7	PVFNTLP	76.49
DP00552	P0AFX7	Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein)	Escherichia coli (strain K12)	121	216	176	183	8	MLQDYELQ	75.67
DP00552	P0AFX7	Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein)	Escherichia coli (strain K12)	121	216	189	204	16	EQLQFEQAQTQQAAVQ	76.42
DP00553	Q9NZ94	Neuroligin-3 (Gliotactin homolog)	Homo sapiens (Human)	731	848	783	797	15	TLRLTALPDYTLTLR	75.14
DP00553	Q9NZ94	Neuroligin-3 (Gliotactin homolog)	Homo sapiens (Human)	731	848	807	838	32	TPNTITMIPNSLVGLQTLHPYNTFAAGFNSTG	77.08
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	1	10	10	MDVFMKGLSM	75.59
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	14	41	28	GVVAAAEKTKQGVTEAAEKTKEGVLYVG	81.4
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	50	60	11	QGVASVAEKTK	79.93
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	67	90	24	GGAVFSGAGNIAAATGLVKREEFP	90.73
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	115	121	7	EGESYED	77.07
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	123	129	7	PQEEYQE	79.84
DP00557	Q00955	Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) Includes: Biotin carboxylase (EC 6.3.4.14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	2048	2080	2055	2062	8	RSQLSNKS	75.25
DP00557	Q00955	Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) Includes: Biotin carboxylase (EC 6.3.4.14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	2048	2080	2067	2073	7	VHQQISK	80.22
DP00563	Q61337	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	Mus musculus (Mouse)	1	204	40	50	11	AQSMFQIPEFE	78.29
DP00563	Q61337	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	Mus musculus (Mouse)	1	204	82	88	7	LGSNIHQ	82.27
DP00563	Q61337	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	Mus musculus (Mouse)	1	204	140	148	9	NLWAAQRYG	82.5
DP00563	Q61337	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	Mus musculus (Mouse)	1	204	183	196	14	WTRIIQSWWDRNLG	90.64
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	3	24	22	LHVSLANGNRDLDYDSVQPYFM	78.5
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	63	69	7	HAGLYSP	76.64
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	73	79	7	AVAVSFA	91.16
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	85	92	8	GDSFSIAD	85.79
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	111	140	30	DDETFVKNIILQDCMWNGFSASAKLVSKLD	81.55
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	150	159	10	TGVSLAADVE	74.05
DP00566	P13102	Hemagglutinin Cleaved into: Hemagglutinin HA1 chain; Hemagglutinin HA2 chain	Influenza A virus (strain A/Whale/Maine/328/1984 H13N2)	141	175	156	170	15	GTNSFYRNLVWFVKK	89.07
DP00573	P03305	Genome polyprotein Cleaved into: Leader protease (Lb(pro)) (EC 3.4.22.46); Capsid protein VP0 (VP4-VP2); Capsid protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Capsid protein VP1 (P1D) (Virion protein 1); Protein 2A (P2A) (P52); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Protein 3B-1 (P3B-1) (Genome-linked protein VPg1); Protein 3B-2 (P3B-2) (Genome-linked protein VPg2); Protein 3B-3 (P3B-3) (Genome-linked protein VPg3); Protease 3C (EC 3.4.22.28) (Picornain 3C) (P3C) (Protease P20B); RNA-directed RNA polymerase 3D-POL (P3D-POL) (EC 2.7.7.48) (P56A)	Foot-and-mouth disease virus (isolate Bovine/Germany/O1Kaufbeuren/1966 serotype O) (FMDV)	852	890	871	877	7	DLQVLAQ	79.65
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	174	183	10	ADQLLQMIRV	76.45
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	229	242	14	LQRALALSRQEIDM	76.68
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	249	258	10	LRRAIQLSMQ	85.15
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	260	266	7	SSRNISQ	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	284	297	14	RREAYFEKQQQKQQ	86.48
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	341	351	11	QAAVTMSLETV	76.19
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	182	291	229	242	14	LQRALALSRQEIDM	76.68
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	182	291	249	258	10	LRRAIQLSMQ	85.15
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	182	291	260	266	7	SSRNISQ	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	182	291	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	229	242	14	LQRALALSRQEIDM	76.68
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	249	258	10	LRRAIQLSMQ	85.15
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	260	266	7	SSRNISQ	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	284	297	14	RREAYFEKQQQKQQ	86.48
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	341	351	11	QAAVTMSLETV	76.19
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	229	242	14	LQRALALSRQEIDM	76.68
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	249	258	10	LRRAIQLSMQ	85.15
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	260	266	7	SSRNISQ	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	284	297	14	RREAYFEKQQQKQQ	86.48
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	262	361	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	262	361	284	297	14	RREAYFEKQQQKQQ	86.48
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	262	361	341	351	11	QAAVTMSLETV	76.19
DP00583	P16006	Deoxycytidylate deaminase (EC 3.5.4.12) (dCMP deaminase) (dCD)	Enterobacteria phage T4 (Bacteriophage T4)	63	83	64	70	7	KHAIIQG	87.63
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	7	21	15	FVPLILAFVGVSISA	87.05
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	37	49	13	DQRHIFTVQFNVG	77.85
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	56	62	7	GDSVTTD	74.1
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	202	211	10	GDSASAEKTD	79.26
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	522	530	9	SDSASVEAN	76.25
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	12	40	29	LEALESIYPDSFTVLSESPPSFTITVTSE	80.59
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	47	61	15	TVQTTLKFTYSEKYP	77.75
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	63	77	15	ETPLYEIFSQENLED	78.28
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	79	121	43	DVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTR	82.45
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	144	166	23	TPVTIENFLSWKAKFDAELLEIK	79.96
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	183	204	22	GKQLFETDHNLDTSDIQFLEDA	82.65
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	210	225	16	VDESLFQEMDDLELED	77.15
DP00588	P27958	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1a (isolate H77) (HCV)	1	82	20	36	17	QDVKFPGGGQIVGGVYL	81.53
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1009	1015	7	HVQHIIG	91.26
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1026	1034	9	AHDNFLAGG	80.6
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1053	1061	9	EGQNTVIGG	74.92
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1063	1078	16	GDDVFLQDLGVWSNQL	83.13
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1120	1138	19	PALNLFSVDHVKNIENLHG	78.75
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1186	1197	12	GNDIFLQDDETV	79.1
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1208	1222	15	DTVDYSAMIHPGRIV	79.93
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1225	1240	16	HEYGFGIEADLSREWV	79.95
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1246	1279	34	LGVDYYDNVRNVENVIGTSMKDVLIGDAQANTLM	83.18
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1292	1298	7	GDDLLFG	88.72
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1328	1336	9	GNDWFGQTQ	77.63
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1350	1356	7	DTVDYSQ	79.93
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1359	1376	18	AHAGIAAGRIGLGILADL	78.34
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1388	1412	25	GSSAYDTVSGIENVVGTELADRITG	78.33
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1414	1421	8	AQANVLRG	74.25
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1460	1476	17	GDDWFFQDAANAGNLLD	89.67
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1497	1513	17	AKGVFLSLGKGFASLMD	76.73
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1518	1531	14	SNVLRNIENAVGSA	76.47
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1533	1539	7	DDVLIGD	96.32
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1541	1556	16	GANVLNGLAGNDVLSG	79.06
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1586	1605	20	GDDTYLFGVGYGHDTIYESG	78.04
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1609	1615	7	DTIRINA	79.93
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1617	1625	9	ADQLWFARQ	97.81
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1627	1635	9	NDLEIRILG	81.68
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1637	1648	12	DDALTVHDWYRD	79.93
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1651	1662	12	HRVEIIHAANQA	76.92
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1664	1680	17	DQAGIEKLVEAMAQYPD	77.06
DP00592	P48539	Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4)	Homo sapiens (Human)	1	62	25	33	9	KVQEEFDID	79.71
DP00592	P48539	Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4)	Homo sapiens (Human)	1	62	42	54	13	AAVAIQSQFRKFQ	79.78
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	545	555	11	LQQLHTLQSQA	79.87
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	576	597	22	NSGGYNYHGHFNAINASANLSP	81.01
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	601	610	10	ASSLYEYNGV	92.17
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	612	619	8	AADNFYGQ	95.23
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	624	667	44	QQQSYQQHNYNSHNGERYSLPTFPTISELAAATAAVEAAAAATV	81.89
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	695	702	8	KLAKITLN	75.5
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	712	718	7	ALQLNSA	85.28
DP00605	Q24246	Cytoplasmic dynein 1 intermediate chain (DH IC) (Dynein intermediate chain; cytosolic) (Protein short wing)	Drosophila melanogaster (Fruit fly)	109	135	109	121	13	NLSVYNVQATNIP	81.35
DP00605	Q24246	Cytoplasmic dynein 1 intermediate chain (DH IC) (Dynein intermediate chain; cytosolic) (Protein short wing)	Drosophila melanogaster (Fruit fly)	109	135	124	130	7	ETLVYTK	86.67
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	1	9	9	MAEEYKNTV	75.73
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	31	38	8	GMFDFLKK	80.6
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	57	67	11	KTQISEPESFV	75.25
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	134	148	15	DHVKTVEEENQGVMD	74.16
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	209	224	16	QVVNTTPLVETATPIA	79.35
DP00607	Q16595	Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN)	Homo sapiens (Human)	1	41	9	16	8	VAGLLASP	79.93
DP00607	Q16595	Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN)	Homo sapiens (Human)	1	41	20	27	8	QAQTLTRV	74.67
DP00607	Q16595	Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN)	Homo sapiens (Human)	42	86	61	79	19	GLNQIWNVKKQSVYLMNLR	80.21
DP00608	Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	Homo sapiens (Human)	59	129	63	75	13	AFPEIHVAQYPLD	75.25
DP00608	Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	Homo sapiens (Human)	59	129	84	102	19	NALAIQVDSEGKIKYDAIA	80.87
DP00608	Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	Homo sapiens (Human)	59	129	108	118	11	KDKVIYSKYTD	85.92
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	11	19	9	TNPFYASSG	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	21	37	17	SGKTYASVVAAAAAAAA	74.9
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	118	125	8	DDVSSLSP	75.25
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	154	162	9	GESKIENGS	84.62
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	210	239	30	SDNVIEEEGVELTDKGDVIVNSSPVESVHV	83.71
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	256	278	23	EELKINADAETLEVANKFDQIGD	83.36
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	288	308	21	SDKAIEEVEEKFTSESDSIAD	81.27
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	324	330	7	VVAAESG	73.91
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	344	361	18	KGMTYAEVIKAASAVADN	77.63
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	392	403	12	DSSAIEAVNVDV	76.51
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	414	427	14	VEVSEVLETDGNIP	81.77
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	442	449	8	GEVELESD	74.96
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	475	484	10	VDADINVAEP	75.72
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	493	500	8	KEAVIKED	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	506	515	10	VDKTISNIEE	91
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	519	536	18	LTAAYDGNFELAVKEISE	82.66
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	549	556	8	VEVEELPV	77.26
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	575	581	7	AESQFEV	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	636	656	21	TEEMIFGSSEAAKQFLAELEK	80.24
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	666	675	10	DEANISNNMS	78.8
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	678	686	9	IDGQIVTDS	76.44
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	705	713	9	ALAALLKAA	75.88
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	210	239	30	SDNVIEEEGVELTDKGDVIVNSSPVESVHV	83.71
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	256	278	23	EELKINADAETLEVANKFDQIGD	83.36
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	288	308	21	SDKAIEEVEEKFTSESDSIAD	81.27
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	324	330	7	VVAAESG	73.91
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	344	361	18	KGMTYAEVIKAASAVADN	77.63
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	414	427	14	VEVSEVLETDGNIP	81.77
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	442	449	8	GEVELESD	74.96
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	475	484	10	VDADINVAEP	75.72
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	493	500	8	KEAVIKED	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	506	515	10	VDKTISNIEE	91
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	519	536	18	LTAAYDGNFELAVKEISE	82.66
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	549	556	8	VEVEELPV	77.26
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	575	581	7	AESQFEV	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	646	656	11	AAKQFLAELEK	79.14
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	666	675	10	DEANISNNMS	78.8
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	678	686	9	IDGQIVTDS	76.44
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	705	713	9	ALAALLKAA	75.88
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	720	729	10	EGGNFTITSQ	81.24
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	731	738	8	GTKLFSMD	82.27
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	759	783	25	NRSNIFSNSNVTMADETEINLSEEE	81.74
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	790	825	36	LQSLRVKFLRLLQRLGHSAEDSIAAQVLYRLALLAG	78.37
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	828	834	7	AGQLFSL	80.36
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	3	12	10	DGTEFVVRSD	75.25
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	44	56	13	EDEVFEEAIGSEN	78.06
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	66	73	8	KRELFESD	76.92
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	76	82	7	PLVETLK	73.91
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	91	97	7	EDFEEAV	75.92
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	100	108	9	LDETSSNEG	75.25
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	111	119	9	KDFTAVGES	74.58
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	123	134	12	GEAEFDVLATKM	79.93
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	160	182	23	TENATSTNTNGSNLAAEHVGIEN	78.03
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	186	194	9	HSFLGNGIA	74.8
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	217	227	11	NDGIEVDNWEE	80.12
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	231	252	22	GIQTEQEVEEGEGTTENQFEKR	78.96
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	264	272	9	SKNLFEKQT	80.27
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	284	291	8	KDLFENGS	80.27
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	306	320	15	TGAAYTSNIVTNASG	83.9
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	322	331	10	NEVSSAVTSS	79.06
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	368	375	8	TEVHSNSG	80.27
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	22	29	8	RQKLIFSP	87.29
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	51	59	9	EDSAFQEPD	86.96
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	111	123	13	GDSWEEEGFGSSS	80.27
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	129	140	12	AAPYFLGSSFSP	83.05
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	231	239	9	PQVNINPFT	85.73
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	242	248	7	SLLLHSS	75.63
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	255	262	8	KRTYWNDS	78.76
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	42	70	29	LGLVFGVIVVCFAMLYPTLFHPMLMGFLG	84.85
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	113	119	7	QAQAESQ	76.21
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	125	147	23	GMFTWMLPVYTIGVVLFLLYTLF	82.01
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	157	165	9	KKRNYFDSE	83.5
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	173	182	10	SETKYGGKFG	74.98
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	199	210	12	AMSKILEQLESV	81.16
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	226	232	7	SEQLEED	74.25
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	238	267	30	AVGLTETNEQYIKDLEVALKEFQSLSKEYD	80.21
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	294	305	12	ELSEIEEEEEEV	85.28
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2213	2308	2223	2235	13	DADLIEANLLWRQ	80.6
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2213	2308	2237	2258	22	MGGNITRVESENKVVILDSFEP	86.96
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2213	2308	2297	2303	7	LLESWKD	75.25
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2218	2314	2223	2235	13	DADLIEANLLWRQ	80.6
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2218	2314	2237	2258	22	MGGNITRVESENKVVILDSFEP	86.96
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2218	2314	2297	2303	7	LLESWKD	75.25
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2221	2314	2223	2235	13	DADLIEANLLWRQ	80.6
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2221	2314	2237	2258	22	MGGNITRVESENKVVILDSFEP	86.96
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2221	2314	2297	2303	7	LLESWKD	75.25
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	194	211	18	SSELYTEASGYISSLEYP	77.31
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	218	226	9	LRCNYSIRV	79.71
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	232	243	12	LHLKFLEPFDID	77.26
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	252	267	16	YDQLQIYANGKNIGEF	83.57
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	282	291	10	AVDLLFFTDE	80.1
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	1	174	1	13	13	MNSYFEQASGFYG	82.66
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	1	174	36	79	44	AAAAYRGFPLSLGMSPYANHHLQRTTQDSPYDASITAACNKIYG	80.65
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	1	174	95	107	13	DAVNGYKDIWNTG	81.07
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	1	174	137	148	12	NAANANGQNNPA	73.91
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	235	286	235	246	12	SNHTFYPWMAIA	77.65
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	235	286	264	281	18	QYGGISTDMGKRYSESLA	75.92
DP00624	P35638	DNA damage-inducible transcript 3 protein (DDIT-3) (C/EBP zeta) (C/EBP-homologous protein) (CHOP) (C/EBP-homologous protein 10) (CHOP-10) (CCAAT/enhancer-binding protein homologous protein) (Growth arrest and DNA damage-inducible protein GADD153)	Homo sapiens (Human)	116	168	132	147	16	AQLAEENERLKQEIER	74.87
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	80	88	9	DLEVIISLG	78.67
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	98	109	12	LLDSYSTAATSS	77.2
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	111	136	26	KDVISVATDVSNTITKTSDERLITEG	82.81
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	139	147	9	NQGVTATTV	75.81
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	168	181	14	KEGIFDSVGITTID	82.27
DP00626	P0AG11	"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD"	Escherichia coli (strain K12)	1	139	8	27	20	DLREIVTFPLFSDLVQCGFP	82.54
DP00626	P0AG11	"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD"	Escherichia coli (strain K12)	1	139	31	80	50	ADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITA	83.16
DP00626	P0AG11	"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD"	Escherichia coli (strain K12)	1	139	83	96	14	GDIVIAAVDGEFTV	78.88
DP00626	P0AG11	"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD"	Escherichia coli (strain K12)	1	139	104	134	31	TVQLIPMNSAYSPITISSEDTLDVFGVVIHV	81.51
DP00628	P15309	"Prostatic acid phosphatase (PAP) (EC 3.1.3.2) (5-nucleotidase) (5-NT) (EC 3.1.3.5) (Acid phosphatase 3) (Ecto-5-nucleotidase) (Protein tyrosine phosphatase ACP3) (EC 3.1.3.48) (Thiamine monophosphatase) (TMPase) Cleaved into: PAPf39"	Homo sapiens (Human)	248	286	260	271	12	GGVLVNEILNHM	78.76
DP00629	Q07097	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Sendai virus (strain Fushimi) (SeV)	401	524	413	432	20	GGGAIEVALDNADIDLETEA	77.46
DP00629	Q07097	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Sendai virus (strain Fushimi) (SeV)	401	524	454	462	9	SGGHFVTLH	80.01
DP00629	Q07097	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Sendai virus (strain Fushimi) (SeV)	402	524	413	432	20	GGGAIEVALDNADIDLETEA	77.46
DP00629	Q07097	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Sendai virus (strain Fushimi) (SeV)	402	524	454	462	9	SGGHFVTLH	80.01
DP00630	O76070	Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR)	Homo sapiens (Human)	1	127	6	12	7	KGFSIAK	87.29
DP00630	O76070	Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR)	Homo sapiens (Human)	1	127	24	40	17	QGVTEAAEKTKEGVMYV	80.27
DP00630	O76070	Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR)	Homo sapiens (Human)	1	127	47	93	47	NVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSG	79.06
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	67	76	10	MTSPFNGLTS	74.45
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	88	97	10	KRTLFQFESH	77.46
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	111	139	29	RVNRILFPTQQNVDIDAAEEEEEGEVLLP	79.23
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	147	155	9	RQLHLSLER	74.58
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	175	191	17	SDKVITFELAKNWNNNS	78.65
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	204	212	9	EEDIIINPV	95.13
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	225	231	7	VTQEIRN	80.03
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	244	254	11	IEDVITYVNKK	90.12
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	90	67	76	10	MTSPFNGLTS	74.45
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	67	76	10	MTSPFNGLTS	74.45
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	88	97	10	KRTLFQFESH	77.46
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	111	139	29	RVNRILFPTQQNVDIDAAEEEEEGEVLLP	79.23
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	147	155	9	RQLHLSLER	74.58
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	175	185	11	SDKVITFELAK	79.96
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	4	11	8	TDYSTYSQ	89.88
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	14	23	10	AQQGYSAYTA	81.97
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	29	45	17	YAQTTQAYGQQSYGTYG	84.87
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	48	72	25	TDVSYTQAQTTATYGQTAYATSYGQ	82.69
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	82	88	7	APQAYSQ	87.29
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	94	128	35	GTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYG	83.73
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	166	174	9	GQSNYSYPQ	78.52
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	203	233	31	YDQSSYSQQNTYGQPSSYGQQSSYGQQSSYG	83.55
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	243	259	17	QTGSYSQAPSQYSQQSS	76.37
DP00633	Q09472	Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)	Homo sapiens (Human)	401	566	425	432	8	NQQPILTG	82.61
DP00633	Q09472	Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)	Homo sapiens (Human)	401	566	455	480	26	TVSQIDPSSIERAYAALGLPYQVNQM	80.74
DP00633	Q09472	Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)	Homo sapiens (Human)	401	566	533	541	9	LHSAINSQN	80.3
DP00636	P17120	Kinesin-like protein bimC	Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)	1	71	44	50	7	KTAAISR	86.29
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	400	525	414	429	16	QAQVSFLHGDQSENEL	85.03
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	400	525	492	508	17	ADALLRLQAMAGISEEQ	75.76
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	400	525	514	520	7	TPIVYND	80.55
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	401	525	414	429	16	QAQVSFLHGDQSENEL	85.03
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	401	525	492	508	17	ADALLRLQAMAGISEEQ	75.76
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	401	525	514	520	7	TPIVYND	80.55
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	401	486	414	429	16	QAQVSFLHGDQSENEL	85.03
DP00641	P51671	Eotaxin (C-C motif chemokine 11) (Eosinophil chemotactic protein) (Small-inducible cytokine A11)	Homo sapiens (Human)	1	31	4	19	16	SAALLWLLLIAAAFSP	80.56
DP00644	P22362	C-C motif chemokine 1 (Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309)	Homo sapiens (Human)	1	23	1	18	18	MQIITTALVCLLLAGMWP	82.29
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	5	19	15	QCVEELEDDVFQSED	75.25
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	27	41	15	GGLLSADLFAQSQLD	76.21
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	46	53	8	RLQLFPLT	87.29
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	69	75	7	ATQTLSP	79.26
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	92	104	13	PQRLFYGNAGYRL	80.42
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	123	135	13	GQFLQHRAEVQIA	83.33
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	137	148	12	KLQCIADQFHRL	75.61
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	153	176	24	HQQNRDRAWWQVFLFLQNLALNRQ	80.48
DP00646	Q01231	Gap junction alpha-5 protein (Connexin-40) (Cx40)	Mus musculus (Mouse)	251	355	275	287	13	SGEKFFSDFSNNM	77.95
DP00646	Q01231	Gap junction alpha-5 protein (Connexin-40) (Cx40)	Mus musculus (Mouse)	251	355	303	329	27	NQEQIPGEGFIHMHYSQKPEYASGASA	79.39
DP00654	Q9ZPI5	Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 (AtMPF2) Includes: Enoyl-CoA hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase (EC 4.2.1.17) (EC 5.1.2.3) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)	Arabidopsis thaliana (Mouse-ear cress)	576	596	582	590	9	RKGFYLYDD	94.83
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	141	250	160	174	15	VIEDILNLESSSTSS	79.15
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	141	250	179	195	17	SPGLYSKTMTPTYDPIN	76.02
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	141	250	199	208	10	ALSTMTWFGD	82.68
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	141	250	215	222	8	NCSVLAFS	80.14
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	653	677	658	672	15	KDQNETLDEDLFHKL	76.01
DP00656	P07674	Transcriptional repressor protein KorB	Escherichia coli	1	64	30	42	13	GLDSIGDLSSLLD	75.3
DP00656	P07674	Transcriptional repressor protein KorB	Escherichia coli	252	294	259	266	8	TVDAFNGQ	84.62
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	1	7	7	MAEEYKN	76.06
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	31	40	10	DRGLFDFLGK	84.82
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	60	66	7	KAQISEP	79.93
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	73	91	19	EEVKENKITLLEELQEKTE	76.71
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	97	110	14	KPSVIEKLHRSNSS	73.91
DP00658	P42758	Dehydrin Xero 2 (Low-temperature-induced protein LTI30)	Arabidopsis thaliana (Mouse-ear cress)	1	193	87	98	12	GTNTTYGTTNTG	79.49
DP00658	P42758	Dehydrin Xero 2 (Low-temperature-induced protein LTI30)	Arabidopsis thaliana (Mouse-ear cress)	1	193	126	140	15	TNTAYGTNTNVVHHE	79.93
DP00658	P42758	Dehydrin Xero 2 (Low-temperature-induced protein LTI30)	Arabidopsis thaliana (Mouse-ear cress)	1	193	163	185	23	TTTSYGNTGVVHHENKSTMDKIK	74.49
DP00659	P16458	Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit)	Sterkiella nova (Ciliate) (Oxytricha nova)	233	385	275	283	9	SVDKIVKYT	89.97
DP00659	P16458	Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit)	Sterkiella nova (Ciliate) (Oxytricha nova)	233	385	333	345	13	TMAQFVKYLDWHE	84.54
DP00659	P16458	Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit)	Sterkiella nova (Ciliate) (Oxytricha nova)	233	385	366	372	7	KASATSG	75.92
DP00661	Q9CX60	Protein LBH (Limb bud and heart-expressed protein)	Mus musculus (Mouse)	1	105	1	15	15	MSVYFPIHCSDYLRS	79.82
DP00661	Q9CX60	Protein LBH (Limb bud and heart-expressed protein)	Mus musculus (Mouse)	1	105	27	34	8	SMEEIGLS	79.93
DP00661	Q9CX60	Protein LBH (Limb bud and heart-expressed protein)	Mus musculus (Mouse)	1	105	37	47	11	KDGLSYQIFPD	86.87
DP00661	Q9CX60	Protein LBH (Limb bud and heart-expressed protein)	Mus musculus (Mouse)	1	105	71	81	11	GEVESGELRWP	76.25
DP00662	Q8LBP4	Inner membrane protein ALBINO3; chloroplastic	Arabidopsis thaliana (Mouse-ear cress)	339	462	341	354	14	NNVLSTAQQVYLRK	83.44
DP00662	Q8LBP4	Inner membrane protein ALBINO3; chloroplastic	Arabidopsis thaliana (Mouse-ear cress)	339	462	365	372	8	NASKIISA	85.54
DP00662	Q8LBP4	Inner membrane protein ALBINO3; chloroplastic	Arabidopsis thaliana (Mouse-ear cress)	339	462	408	421	14	DTVELVEESQSESE	76.21
DP00662	Q8LBP4	Inner membrane protein ALBINO3; chloroplastic	Arabidopsis thaliana (Mouse-ear cress)	339	462	434	442	9	GALASSTTS	76.14
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	10	22	13	HGSKYLASASTMD	78.31
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	39	46	8	SLGRFFGA	79.01
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	85	94	10	PVVHFFKNIV	86.76
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	108	118	11	GLSLSRFSWGA	76.28
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	147	158	12	AQGTLSKIFKLG	79.68
DP00664	Q01417	18 kDa seed maturation protein	Glycine max (Soybean) (Glycine hispida)	1	173	7	24	18	AGESIKETATNIGASAKA	78.71
DP00664	Q01417	18 kDa seed maturation protein	Glycine max (Soybean) (Glycine hispida)	1	173	77	83	7	KQSATTA	79.93
DP00664	Q01417	18 kDa seed maturation protein	Glycine max (Soybean) (Glycine hispida)	1	173	98	109	12	GTATYSTTGEYG	78.62
DP00666	P32004	Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171)	Homo sapiens (Human)	1144	1257	1147	1153	7	KGGKYSV	78.26
DP00666	P32004	Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171)	Homo sapiens (Human)	1144	1257	1169	1181	13	KDETFGEYRSLES	85.7
DP00666	P32004	Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171)	Homo sapiens (Human)	1144	1257	1215	1231	17	VDVQFNEDGSFIGQYSG	82.06
DP00667	P42763	Dehydrin ERD14	Arabidopsis thaliana (Mouse-ear cress)	1	185	1	7	7	MAEEIKN	75.25
DP00667	P42763	Dehydrin ERD14	Arabidopsis thaliana (Mouse-ear cress)	1	185	27	36	10	DRGLFDFLGK	84.82
DP00667	P42763	Dehydrin ERD14	Arabidopsis thaliana (Mouse-ear cress)	1	185	48	60	13	IASEFEQKVHISE	86.13
DP00669	P81019	Seminal plasma protein BSP-30 kDa (BSP-30K)	Bos taurus (Bovine)	26	96	52	66	15	PPEIYTTTFLPRTIY	76.79
DP00672	Q92886	Neurogenin-1 (NGN-1) (Class A basic helix-loop-helix protein 6) (bHLHa6) (Neurogenic basic-helix-loop-helix protein) (Neurogenic differentiation factor 3) (NeuroD3)	Homo sapiens (Human)	90	150	127	145	19	KLTKIETLRFAYNYIWALA	83.51
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	1	24	12	18	7	RAVNMLK	77.26
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	12	18	7	RAVNMLK	77.26
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	24	30	7	GLSLIGL	95.32
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	45	60	16	RFVLALLAFFRFTAIA	84.64
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	79	85	7	KHLLSFK	80.27
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	89	96	8	GTLTSAIN	87.88
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	76	105	79	85	7	KHLLSFK	80.27
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	76	105	89	96	8	GTLTSAIN	87.88
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	80	105	89	96	8	GTLTSAIN	87.88
DP00674	Q69422	Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Hepatitis GB virus B (GBV-B) (GB virus B)	2	155	21	34	14	QTQASYPVSIKTSV	78.19
DP00674	Q69422	Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Hepatitis GB virus B (GBV-B) (GB virus B)	2	155	51	71	21	RNYKIAGIHDGLQTLAQAALP	79.07
DP00674	Q69422	Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Hepatitis GB virus B (GBV-B) (GB virus B)	2	155	86	104	19	NLGILLDYPLGWIGDVTTH	78.56
DP00674	Q69422	Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Hepatitis GB virus B (GBV-B) (GB virus B)	2	155	119	150	32	PVCQIVRLLEDGVNWATGWFGVHLFVVCLLSL	79.95
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	169	270	208	221	14	PDATIVVEGVKYQV	83.44
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	169	270	233	241	9	QDGLYHNKN	86.96
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	169	270	253	265	13	ALLAWAIIAIVLF	87.39
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	170	260	208	221	14	PDATIVVEGVKYQV	83.44
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	170	260	233	241	9	QDGLYHNKN	86.96
DP00677	P12810	16.9 kDa class I heat shock protein 1 (HSP 16.9) (Heat shock protein 16.9A) (Heat shock protein 17) (Low molecular weight heat shock protein)	Triticum aestivum (Wheat)	1	42	6	19	14	RSNVFDPFADLWAD	76.97
DP00677	P12810	16.9 kDa class I heat shock protein 1 (HSP 16.9) (Heat shock protein 16.9A) (Heat shock protein 17) (Low molecular weight heat shock protein)	Triticum aestivum (Wheat)	1	42	23	32	10	TFRSIVPAIS	81.07
DP00678	P11171	Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1)	Homo sapiens (Human)	800	864	800	807	8	TTQITKTV	75.92
DP00678	P11171	Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1)	Homo sapiens (Human)	800	864	818	841	24	KRIVITGDADIDHDQVLVQAIKEA	82.65
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	26	37	12	LTSFLIQDILRD	82.83
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	73	79	7	NDQLSTG	81.27
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	86	94	9	EAETLAETE	74.25
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	98	111	14	HLGSYLLDSENTSG	78.12
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	127	151	25	SRAAFSHTQVIELERKFSHQKYLSA	78.53
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	166	176	11	TQVKIWFQNRR	85.95
DP00689	P30185	Dehydrin Rab18	Arabidopsis thaliana (Mouse-ear cress)	1	186	9	29	21	GGQATDEYGNPIQQQYDEYGN	76.7
DP00689	P30185	Dehydrin Rab18	Arabidopsis thaliana (Mouse-ear cress)	1	186	46	73	28	GGQGYGTGGQGYGSGGQGYGTGGQGYGT	75.25
DP00693	P45561	Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP)	Sus scrofa (Pig)	2	173	2	16	15	GTWILFACLLGAAFS	79.75
DP00693	P45561	Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP)	Sus scrofa (Pig)	2	173	25	47	23	HPGYINFSYEVLTPLKWYQNMIR	83.36
DP00693	P45561	Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP)	Sus scrofa (Pig)	2	173	63	72	10	HHQIIPVVSQ	75.85
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	20	45	26	ADEGFWDCSVCTFRNSAEAFKCSICD	77.48
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	60	70	11	QLVAQQVAQQY	77.29
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	124	144	21	EANSIQSANATTKTSETNHTS	77.35
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	156	176	21	AQQLAVTVGNVTVIITDFKEK	80.12
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	194	202	9	EQQNQSSSG	73.58
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	145	179	156	174	19	AQQLAVTVGNVTVIITDFK	80.04
DP00697	Q9IK92	Nucleoprotein (Protein N) (Nucleocapsid protein)	Nipah virus	400	532	418	430	13	GGVLIGGSDQDID	86.91
DP00697	Q9IK92	Nucleoprotein (Protein N) (Nucleocapsid protein)	Nipah virus	400	532	441	459	19	RQSVTFKREMSISSLANSV	80.16
DP00697	Q9IK92	Nucleoprotein (Protein N) (Nucleocapsid protein)	Nipah virus	400	532	469	481	13	GTRLTNSLLNLRS	75.56
DP00697	Q9IK92	Nucleoprotein (Protein N) (Nucleocapsid protein)	Nipah virus	400	532	498	511	14	DDPAISNRTQGESE	75.78
DP00698	O89339	Nucleoprotein (Protein N) (Nucleocapsid protein)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	400	532	425	437	13	GEQDIDEEEEPIE	77.26
DP00698	O89339	Nucleoprotein (Protein N) (Nucleocapsid protein)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	400	532	441	447	7	RQSVTFK	85.05
DP00698	O89339	Nucleoprotein (Protein N) (Nucleocapsid protein)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	400	532	469	481	13	GTRLTNSLLNLRS	75.56
DP00698	O89339	Nucleoprotein (Protein N) (Nucleocapsid protein)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	400	532	484	498	15	AAKAIKESTAQSSSE	77.53
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	9	39	31	DGLNIIDFIQKNQKEIQKTYGRSSIQQPSIK	79.91
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	46	59	14	EDFLQCTSGESEQV	75.78
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	112	118	7	TDVVYHD	79.07
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	125	131	7	GYGFTSS	79.41
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	135	153	19	GWSDYTSGANNGNVCLVSD	74.67
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	155	169	15	KMLSYAPEIAVSKED	80.25
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	173	185	13	DLVHLENKLSTTG	74.79
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	189	200	12	TAVPFTLRNLSD	76.56
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	208	220	13	IAEHYYGLGVKEQ	90.66
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	228	241	14	RNVNLDSIKLYTSD	76.92
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	245	267	23	ADQLEFEDEFAGSSSEVIVGISP	81.85
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	283	304	22	IGRTIEGQSIRDNLQAKDNKST	75.49
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	328	335	8	LAEEFECS	77.26
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	338	355	18	EDPIIRELLKENSLINCQ	81.94
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	364	373	10	YHWSIERSIS	80.47
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	378	388	11	EIVNGAVQTAD	76.89
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	100	9	39	31	DGLNIIDFIQKNQKEIQKTYGRSSIQQPSIK	79.91
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	100	46	59	14	EDFLQCTSGESEQV	75.78
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	10	34	25	GLDIIDFIQKNQKEIQKTYGRSSIQ	78.74
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	46	54	9	EDFLQSTSG	75.88
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	79	101	23	SSVTSSDGTIGQRVSNTRAWAED	78.19
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	112	118	7	TDVVYHD	79.07
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	134	140	7	RGWSYHM	79.93
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	168	184	17	EVREIDLIGLEDKFASA	76.92
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	207	215	9	VIPEYYYGS	86.36
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	228	241	14	GNVNLDSIKIYTSD	80.67
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	245	265	21	ENQLEYEDEFAKSSSEVVIDT	83.53
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	327	335	9	MLSEEFECS	79.34
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	338	347	10	DDPIIQELER	75.82
DP00702	P46937	Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog)	Homo sapiens (Human)	50	171	50	57	8	AGHQIVHV	75.59
DP00702	P46937	Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog)	Homo sapiens (Human)	50	171	59	73	15	GDSETDLEALFNAVM	78.13
DP00705	P22943	12 kDa heat shock protein (Glucose and lipid-regulated protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	109	21	35	15	SQKSYAEQGKEYITD	80.22
DP00705	P22943	12 kDa heat shock protein (Glucose and lipid-regulated protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	109	49	55	7	NKGVFQG	74.25
DP00705	P22943	12 kDa heat shock protein (Glucose and lipid-regulated protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	109	69	82	14	GQGESLADQARDYM	74.25
DP00705	P22943	12 kDa heat shock protein (Glucose and lipid-regulated protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	109	91	98	8	DAVEYVSG	77.3
DP00706	Q15517	Corneodesmosin (S protein)	Homo sapiens (Human)	60	171	64	70	7	GFSSYSG	92.64
DP00706	Q15517	Corneodesmosin (S protein)	Homo sapiens (Human)	60	171	74	80	7	SGSSISS	76.78
DP00706	Q15517	Corneodesmosin (S protein)	Homo sapiens (Human)	60	171	109	119	11	GTGYSQVSYSS	79.6
DP00706	Q15517	Corneodesmosin (S protein)	Homo sapiens (Human)	60	171	157	166	10	SSSSFQFSSS	77.39
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	161	243	170	176	7	NAENTAS	81.61
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	161	243	191	203	13	LEQLLALYVAEIR	81.73
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	161	243	218	228	11	PDSAYLQEARL	84.62
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	347	420	372	383	12	LDEVISKYAMLQ	89.72
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	347	420	398	406	9	LQGTSSHSA	75.25
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	498	509	12	SSLQISNEKNLE	77.26
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	539	550	12	APSSIDAESNGE	75.14
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	563	575	13	VSQLFELEIEALP	79.6
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	598	614	17	TTVLENGAGMVSSTSFN	79.58
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	644	652	9	LGNSYVERQ	86.96
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	692	702	11	GLVTSSLCIPS	85.62
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	566	739	566	575	10	LFELEIEALP	78.56
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	566	739	598	614	17	TTVLENGAGMVSSTSFN	79.58
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	566	739	644	652	9	LGNSYVERQ	86.96
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	566	739	692	702	11	GLVTSSLCIPS	85.62
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	570	578	9	SQLAELEME	79.34
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	596	613	18	SLPTILENGAAVVTSTSV	77.93
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	643	650	8	LLGNSYIK	86.37
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	658	664	7	SGQNTSV	80.22
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	673	684	12	ASVASVADSSTR	80.6
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	690	698	9	HELVTSSLC	79.34
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	711	726	16	AQSLRQCIYKTSVATQ	82.63
DP00709	Q9Y3M2	Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1)	Homo sapiens (Human)	1	63	3	9	7	FFGNTFS	86.34
DP00709	Q9Y3M2	Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1)	Homo sapiens (Human)	1	63	18	27	10	SASLSNLHSL	80.6
DP00709	Q9Y3M2	Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1)	Homo sapiens (Human)	1	63	35	42	8	ELGLEYGS	84.16
DP00709	Q9Y3M2	Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1)	Homo sapiens (Human)	1	63	49	58	10	GQSLKFENGQ	81.47
DP00716	P02545	Prelamin-A/C Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32)	Homo sapiens (Human)	567	664	575	583	9	DPAEYNLRS	77.33
DP00716	P02545	Prelamin-A/C Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32)	Homo sapiens (Human)	567	664	617	627	11	ASSVTVTRSYR	74.25
DP00716	P02545	Prelamin-A/C Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32)	Homo sapiens (Human)	567	664	633	652	20	GGGSFGDNLVTRSYLLGNSS	75.69
DP00717	P35521	Methylosome subunit pICln (Chloride channel; nucleotide sensitive 1A) (Chloride conductance regulatory protein ICln) (I(Cln))	Canis lupus familiaris (Dog) (Canis familiaris)	93	115	103	110	8	DVEPIAEF	80.31
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	9	111	14	31	18	SDSFTDTLSANISQEMTM	76.77
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	9	111	41	55	15	TNFGISSVDLSVMED	82.45
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	9	111	63	84	22	KPFTTVDFSSISTPHYEDIPFT	75.68
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	9	111	91	106	16	ADYKYDLKLQEYQSAI	85.64
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	112	174	119	125	7	KTQLYNK	96.99
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	112	174	133	139	7	SLMAIEC	75.2
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	112	174	147	153	7	SGFHYGV	87.29
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	238	278	243	255	13	AKHLYDSYIKSFP	78.85
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	238	278	260	267	8	KARAILTG	75.84
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	453	477	456	472	17	SSQLFAKLLQKMTDLRQ	78.18
DP00719	Q13569	G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG)	Homo sapiens (Human)	1	50	5	29	25	NAGSYSLQQAQAFYTFPFQQLMAEA	82.78
DP00719	Q13569	G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG)	Homo sapiens (Human)	51	111	94	103	10	KQEKITDTFK	87.29
DP00719	Q13569	G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG)	Homo sapiens (Human)	340	410	360	369	10	SNGLIESVEL	79.97
DP00719	Q13569	G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG)	Homo sapiens (Human)	340	410	371	399	29	GESAFSGIPNGQWMTQSFTDQIPSFSNHC	79.77
DP00720	Q05344	FACT complex subunit Ssrp1 (Chorion-factor 5) (Facilitates chromatin transcription complex subunit Ssrp1) (Recombination signal sequence recognition protein) (Single-strand recognition protein) (dSSRP1)	Drosophila melanogaster (Fruit fly)	437	518	488	501	14	SDVAEEYDSNVESD	86.86
DP00720	Q05344	FACT complex subunit Ssrp1 (Chorion-factor 5) (Facilitates chromatin transcription complex subunit Ssrp1) (Recombination signal sequence recognition protein) (Single-strand recognition protein) (dSSRP1)	Drosophila melanogaster (Fruit fly)	625	723	659	665	7	SKEYISD	78.4
DP00721	Q8IRG6	FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16)	Drosophila melanogaster (Fruit fly)	889	1044	889	916	28	KEWLNSCDIRYSEGVQSLNWQKIMKTIT	78.83
DP00721	Q8IRG6	FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16)	Drosophila melanogaster (Fruit fly)	889	1044	919	932	14	PEGFFEQGGWTFLD	85.12
DP00721	Q8IRG6	FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16)	Drosophila melanogaster (Fruit fly)	889	1044	939	953	15	GENETAESEEDEAYN	82.34
DP00721	Q8IRG6	FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16)	Drosophila melanogaster (Fruit fly)	889	1044	965	979	15	EDSEYSEASEDSEES	87.29
DP00722	P0AGE2	Single-stranded DNA-binding protein (SSB)	Escherichia coli O157:H7	113	177	144	151	8	GGNQFSGG	75.59
DP00724	Q9LQT8	DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2)	Arabidopsis thaliana (Mouse-ear cress)	11	113	27	38	12	MDELLAVLGYKV	80.16
DP00724	Q9LQT8	DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2)	Arabidopsis thaliana (Mouse-ear cress)	11	113	47	58	12	AQKLEQLEVMMS	78.93
DP00724	Q9LQT8	DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2)	Arabidopsis thaliana (Mouse-ear cress)	11	113	66	89	24	SQLATETVHYNPAELYTWLDSMLT	81.55
DP00724	Q9LQT8	DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2)	Arabidopsis thaliana (Mouse-ear cress)	11	113	96	108	13	SNAEYDLKAIPGD	78.36
DP00725	P41851	Type II secretion system protein M (T2SS protein M) (Cholera toxin secretion protein EpsM) (General secretion pathway protein M)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	44	85	58	75	18	KQLLSWVSENANDIVTLR	76.92
DP00728	P00760	Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2	Bos taurus (Bovine)	4	47	4	16	13	FIFLALLGAAVAF	85.23
DP00728	P00760	Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2	Bos taurus (Bovine)	4	47	20	42	23	DDDKIVGGYTCGANTVPYQVSLN	78.92
DP00728	P00760	Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2	Bos taurus (Bovine)	68	89	74	84	11	GEDNINVVEGN	82.61
DP00729	P00974	Pancreatic trypsin inhibitor (Aprotinin) (Basic protease inhibitor) (BPI) (BPTI)	Bos taurus (Bovine)	14	38	15	23	9	LLGTLAAST	75.59
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	18	24	7	TAGNLET	75.82
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	26	43	18	GSQGIAEEVAEGTVGTSD	76.25
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	69	80	12	GEASILDELKTD	78.9
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	169	181	13	GAEVTVNEAETES	80.4
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	231	237	7	RAAVIPS	78.26
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	313	336	24	NRKAIMDKFGGAASGPTALFRNTK	75.5
DP00747	P01160	Natriuretic peptides A (Atrial natriuretic factor prohormone) (proANF) (Atrial natriuretic peptide prohormone) (preproANP) (proANP) (Atriopeptigen) (Cardiodilatin) (CDD) (preproCDD-ANF) Cleaved into: Long-acting natriuretic peptide (LANP) (Long-acting natriuretic hormone) (LANH) (Pro atrial natriuretic factor 1-30) (proANF 1-30) (Pro atrial natriuretic peptide 1-30) (proANP 1-30); Vessel dilator (VSDL) (Pro atrial natriuretic factor 31-67) (proANF 31-67) (Pro atrial natriuretic peptide 31-67) (proANP 31-67); Kaliuretic peptide (KP) (Pro atrial natriuretic factor 79-98) (proANF 79-98) (Pro atrial natriuretic peptide 79-98) (proANP 79-98); Urodilatin (URO) (CDD 95-126) (CDD-ANP (95-126)) (Pro atrial natriuretic peptide 95-126) (proANP 95-126); Auriculin-C (Atrial natriuretic factor 1-33) (ANF 1-33); Auriculin-D (Atrial natriuretic factor 3-33) (ANF 3-33); Atrial natriuretic peptide (ANP) (Alpha-atrial natriuretic peptide) (Alpha-hANP) (Atrial natriuretic factor) (ANF) (CDD-ANF) (CDD-ANP (99-126)) (Cardionatrin) (Pro atrial natriuretic factor 99-126) (proANF 99-126); Auriculin-B (Atrial natriuretic factor 8-33) (ANF 8-33); Auriculin-A; Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II); Atriopeptin-3 (Atriopeptin III)	Homo sapiens (Human)	56	123	70	76	7	AGAALSP	73.91
DP00748	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	192	223	196	203	8	SVSALIGG	85.41
DP00748	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	238	293	239	278	40	YARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGE	79.84
DP00749	Q9TY14	Apical membrane antigen 1 (Fragment)	Plasmodium vivax	413	445	414	440	27	AEIKENNQVVIKEEFRNYYENGEEKSN	77.16
DP00750	Q38151	39 protein	Bacillus phage SPP1 (Bacteriophage SPP1)	68	126	73	96	24	RDRFIPSYEETQRILKEQAEAEEA	74.83
DP00750	Q38151	39 protein	Bacillus phage SPP1 (Bacteriophage SPP1)	68	126	105	121	17	AAQEENMRKIREMLGIN	78.63
DP00750	Q38151	39 protein	Bacillus phage SPP1 (Bacteriophage SPP1)	68	112	73	96	24	RDRFIPSYEETQRILKEQAEAEEA	74.83
DP00752	E6PBU9	40S ribosomal protein rpS31e	Tetrahymena thermophila	1	71	10	52	43	GETKIYTLEQGTSVLDLKSQISQDMGFEIDMMTLVNNGFIAPN	78.47
DP00752	E6PBU9	40S ribosomal protein rpS31e	Tetrahymena thermophila	1	71	58	66	9	DDVTYYLSL	85.99
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	1	81	12	25	14	EQQEYKEAFQLFDK	90.8
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	1	81	27	38	12	NDNKLTAEELGT	73.91
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	1	81	48	60	13	TKQKISEIVKDYD	89.19
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	1	81	63	76	14	NSGKFDQETFLTIM	84.78
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	82	150	91	97	7	KAFEIFD	97.75
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	82	150	100	122	23	KNGYISASELKHVLTTLGEKLTE	79.45
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	82	150	128	145	18	LLKEIGVEEGLINVDDFV	84.97
DP00754	Q70Q12	FXYD domain-containing ion transport regulator	Squalus acanthias (Spiny dogfish)	62	94	81	87	7	TAQHLLQ	79.55
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	18	52	18	24	7	AYEHITH	91.97
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	18	52	33	47	15	NKNKISTVSDYFRNI	81.14
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	75	114	78	92	15	NNNKYSVNIENVRIR	80.31
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	145	188	154	163	10	TIEVTTVPSN	84.08
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	145	188	167	175	9	GAVTTYNTD	81.64
DP00759	P80220	TSC22 domain family protein 3 (DSIP-immunoreactive peptide) (DIP protein) (Delta sleep-inducing peptide immunoreactor) (Glucocorticoid-induced leucine zipper protein)	Sus scrofa (Pig)	48	77	48	57	10	QLEKFQSRLS	86.62
DP00765	O00585	C-C motif chemokine 21 (6Ckine) (Beta-chemokine exodus-2) (Secondary lymphoid-tissue chemokine) (SLC) (Small-inducible cytokine A21)	Homo sapiens (Human)	71	111	83	91	9	VQQLMQHLD	80.27
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	14	99	43	50	8	TELEEVSL	73.91
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	14	99	61	67	7	VAAVTLG	82.99
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	14	99	70	77	8	GTQETALT	75.92
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	14	99	83	89	7	QAQVSVA	75.54
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	117	166	121	131	11	PSQNIAAGLES	76.86
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	117	166	136	143	8	AGAQILGQ	77.01
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	288	296	9	DVQTISILP	81.16
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	301	309	9	ESHLILEEV	79.04
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	340	346	7	GEVVEQT	76.25
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	466	475	10	HSVLLDSYLV	84.25
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	505	521	17	GAQALSEESETQDQSEV	76.18
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	552	567	16	QDQSTSHQELQEEALA	74.87
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	570	585	16	SGGSFQMSPFEALQEC	73.58
DP00769	Q24F70	40S ribosomal protein S10; putative	Tetrahymena thermophila (strain SB210)	106	162	147	157	11	GAAETAQGNQE	75.92
DP00771	P20435	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	71	4	30	27	YEEAFNDGNENFEDFDVEHFSDEETYE	83.66
DP00771	P20435	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	71	44	52	9	NGKTIVTGG	80.27
DP00771	P20435	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	71	58	65	8	FQQHEQIR	75.25
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	40	52	13	VDELFDTQLMLFA	91.23
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	58	66	9	LDLNEINAA	90.64
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	83	94	12	DDALTFAIFTHD	84.03
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	106	123	18	EDIPYSYQREGFADGQLV	76.14
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	127	134	8	DPWRFVWM	79.93
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	139	152	14	GKYRIVVGQEWEYR	83.13
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	386	417	396	404	9	ALARIGERF	79.71
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	130	150	130	141	12	VQAKFGDYNKEV	81.86
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	320	327	8	RQQLETEK	77.55
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	350	357	8	RLQDYEEK	75.25
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	365	378	14	LSEQIQRALQLEEE	75.51
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	416	434	19	QLAAELAEYTAKIALLEEA	80.55
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	484	491	8	HVQESLQD	74.67
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	498	506	9	GYSAELSSE	77.41
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	506	586	529	540	12	RQLLTLSSELSQ	76.11
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	506	586	549	557	9	HNDIIHNEN	76.66
DP00776	P0ACF8	DNA-binding protein H-NS (Heat-stable nucleoid-structuring protein) (Histone-like protein HLP-II) (Protein B1) (Protein H1)	Escherichia coli (strain K12)	57	89	57	67	11	KLQQYREMLIA	82.24
DP00776	P0ACF8	DNA-binding protein H-NS (Heat-stable nucleoid-structuring protein) (Histone-like protein HLP-II) (Protein B1) (Protein H1)	Escherichia coli (strain K12)	57	89	74	84	11	ELLNSLAAVKS	77.04
DP00778	P46670	Tubulin-specific chaperone C (Chromosome instability protein 2) (Tubulin-folding cofactor C)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	220	245	225	240	16	RDHLIIQDFSNPFQSE	76.15
DP00783	P10279	Major prion protein (PrP) (Major scrapie-associated fibril protein 1) (CD antigen CD230)	Bos taurus (Bovine)	23	121	32	42	11	GGWNTGGSRYP	80.94
DP00786	G4NEJ8	PC4 domain-containing protein	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)	117	158	147	153	7	KKANIEA	80.12
DP00787	B2LME8	Alginase	Pseudoalteromonas sp. SM0524	32	155	36	61	26	NAGFESGFSNWNETDPAAISSDAYSG	78.13
DP00787	B2LME8	Alginase	Pseudoalteromonas sp. SM0524	32	155	72	150	79	ARVYQVVDIQPNTEYTLSAYVLGKGQIGVNDLNGLFKNQTFNVSSWTKVTKTFTSANTNSLQVFAKHYNNTSDVRFDNF	80.49
DP00788	P38801	Exosome complex protein LRP1 (Like an rRNA processing protein 1) (Yeast C1D domain-containing protein) (rRNA processing protein 47)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	118	184	148	157	10	AESTTTKIID	79.26
DP00790	P08245	Uncharacterized protein YciH	Escherichia coli (strain K12)	1	31	6	18	13	SRLVYSTETGRID	77.67
DP00791	P9WHJ5	RNA polymerase-binding protein RbpA	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	26	12	19	8	GAVSYETD	82.15
DP00791	P9WHJ5	RNA polymerase-binding protein RbpA	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	25	12	19	8	GAVSYETD	82.15
DP00792	P36886	Photosystem I reaction center subunit psaK; chloroplastic (Light-harvesting complex I 7 kDa protein) (PSI-K) (Photosystem I subunit X)	Hordeum vulgare (Barley)	1	42	2	11	10	ASQLSAMTSV	79.93
DP00793	P05387	60S acidic ribosomal protein P2 (Large ribosomal subunit protein P2) (Renal carcinoma antigen NY-REN-44)	Homo sapiens (Human)	63	115	69	76	8	GAVAVSAA	75.25
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	116	138	124	133	10	LDKEIKNSFN	77.66
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	124	133	10	LDKEIKNSFN	77.66
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	135	143	9	EAQVFMPIS	78.45
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	172	188	17	TQPLTFTTATFAATKFG	80.44
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	218	236	19	KQKAISSSMHSLYGLGLGS	84.83
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	260	268	9	QQQKTSALS	77.93
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	270	278	9	NAKEFIFPN	90.23
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	300	340	41	PLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQ	82.45
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	172	188	17	TQPLTFTTATFAATKFG	80.44
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	218	236	19	KQKAISSSMHSLYGLGLGS	84.83
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	260	268	9	QQQKTSALS	77.93
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	270	278	9	NAKEFIFPN	90.23
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	300	340	41	PLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQ	82.45
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	285	172	188	17	TQPLTFTTATFAATKFG	80.44
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	285	218	236	19	KQKAISSSMHSLYGLGLGS	84.83
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	285	260	268	9	QQQKTSALS	77.93
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	285	270	278	9	NAKEFIFPN	90.23
DP00795	P62326	Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Bos taurus (Bovine)	1	44	6	14	9	DMAEIEKFD	81.72
DP00795	P62326	Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Bos taurus (Bovine)	1	44	31	37	7	SKETIEQ	75.92
DP00795	P62326	Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Bos taurus (Bovine)	13	44	31	37	7	SKETIEQ	75.92
DP00795	P62326	Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Bos taurus (Bovine)	22	44	31	37	7	SKETIEQ	75.92
DP00796	P15382	Potassium voltage-gated channel subfamily E member 1 (Delayed rectifier potassium channel subunit IsK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel)	Homo sapiens (Human)	107	129	109	117	9	VENHLAIEQ	79.26
DP00797	O15273	Telethonin (Titin cap protein)	Homo sapiens (Human)	91	167	112	123	12	QLQELLALETAL	80.6
DP00797	O15273	Telethonin (Titin cap protein)	Homo sapiens (Human)	91	167	131	138	8	QEVAEITK	78.05
DP00798	O14214	tRNA (guanine(9)-N1)-methyltransferase (EC 2.1.1.221) (tRNA methyltransferase 10) (tRNA(m1G9)-methyltransferase) (tRNA(m1G9)MTase)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	83	42	48	7	RQQEWDA	76.59
DP00798	O14214	tRNA (guanine(9)-N1)-methyltransferase (EC 2.1.1.221) (tRNA methyltransferase 10) (tRNA(m1G9)-methyltransferase) (tRNA(m1G9)MTase)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	271	304	274	288	15	GILLKSDESFDVSED	76.19
DP00799	P9WNK3	ESAT-6-like protein EsxH (10 kDa antigen CFP7) (CFP-7) (Low molecular weight protein antigen 7) (Protein TB10.4)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	76	96	76	82	7	HEANTMA	79.93
DP00803	P22179	Photosystem I reaction center subunit VI; chloroplastic (PSI-H) (Light-harvesting complex I 11 kDa protein)	Spinacia oleracea (Spinach)	1	58	2	15	14	ASLATLAAVQPTTL	75.94
DP00803	P22179	Photosystem I reaction center subunit VI; chloroplastic (PSI-H) (Light-harvesting complex I 11 kDa protein)	Spinacia oleracea (Spinach)	1	58	33	41	9	ARQSFKLNN	76.81
DP00803	P22179	Photosystem I reaction center subunit VI; chloroplastic (PSI-H) (Light-harvesting complex I 11 kDa protein)	Spinacia oleracea (Spinach)	1	58	43	53	11	RSGAIVAKYGD	81.76
DP00806	A1B8N7	ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta)	Paracoccus denitrificans (strain Pd 1222)	116	188	118	128	11	ADVVSAQALTD	84.43
DP00806	A1B8N7	ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta)	Paracoccus denitrificans (strain Pd 1222)	116	188	144	174	31	KTVKLNARVDESLIGGMIVKLGSQMIDSSIR	80.43
DP00806	A1B8N7	ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta)	Paracoccus denitrificans (strain Pd 1222)	116	188	177	183	7	LASLQNA	74.63
DP00808	P24937	Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	51	2	10	9	EDINFASLA	80.75
DP00808	P24937	Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	51	18	46	29	FMGNWQDIGTSNMSGGAFSWGSLWSGIKN	79.41
DP00808	P24937	Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	158	250	200	206	7	AVVVTRP	77.93
DP00808	P24937	Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	158	250	225	245	21	ASGNWQSTLNSIVGLGVQSLK	87.55
DP00809	P80870	General stress protein 13 (GSP13)	Bacillus subtilis (strain 168)	81	130	95	112	18	AAQVSEEASTPQGFNTLK	78.93
DP00809	P80870	General stress protein 13 (GSP13)	Bacillus subtilis (strain 168)	81	130	114	123	10	KLEEWIEMSN	80
DP00810	P0A882	Trp operon repressor	Escherichia coli O157:H7	63	92	75	87	13	LGAGIATITRGSN	88.37
DP00811	Q9V452	Chromatin accessibility complex 16kD protein	Drosophila melanogaster (Fruit fly)	1	28	15	23	9	TAETFLPLS	90.3
DP00811	Q9V452	Chromatin accessibility complex 16kD protein	Drosophila melanogaster (Fruit fly)	101	140	103	109	7	HQFQEML	75.68
DP00814	P01252	Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1	Bos taurus (Bovine)	1	110	8	15	8	TSSEITTK	74.79
DP00814	P01252	Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1	Bos taurus (Bovine)	1	110	22	29	8	EVVEEAEN	75.92
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	1	206	49	58	10	DEMNILATYH	83.68
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	1	206	83	89	7	DEDAYSD	75.87
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	1	206	145	164	20	RKLHYNEGLNIKLARQLISK	77.68
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	1	206	184	196	13	MNVEESSQGSTTS	73.91
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	57	129	83	89	7	DEDAYSD	75.87
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	170	206	184	196	13	MNVEESSQGSTTS	73.91
DP00816	P41236	Protein phosphatase inhibitor 2 (IPP-2)	Homo sapiens (Human)	9	164	24	31	8	SMVASAEQ	75.67
DP00816	P41236	Protein phosphatase inhibitor 2 (IPP-2)	Homo sapiens (Human)	9	164	36	42	7	VDEELSK	75.25
DP00816	P41236	Protein phosphatase inhibitor 2 (IPP-2)	Homo sapiens (Human)	9	164	48	57	10	DEMNILATYH	83.68
DP00816	P41236	Protein phosphatase inhibitor 2 (IPP-2)	Homo sapiens (Human)	9	164	144	159	16	RKLHYNEGLNIKLARQ	78.11
DP00818	P40422	DNA-directed RNA polymerases I; II; and III subunit RPABC4 (RNA polymerases I; II; and III subunit ABC4) (ABC10-alpha)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	24	4	11	8	EGFQIPTN	75.08
DP00823	N1NXA6	SAGA-associated factor 11	"Saccharomyces cerevisiae (strain CEN.PK113-7D) (Bakers yeast)"	64	99	67	73	7	SSQYIHC	76.54
DP00824	Q9NJS1	Salivary anti-thrombin peptide anophelin	Anopheles albimanus (New world malaria mosquito)	23	83	47	71	25	NDTSITDEDYAAIEASLSETFNTAA	79.71
DP00824	Q9NJS1	Salivary anti-thrombin peptide anophelin	Anopheles albimanus (New world malaria mosquito)	54	83	55	71	17	DYAAIEASLSETFNTAA	80.7
DP00824	Q9NJS1	Salivary anti-thrombin peptide anophelin	Anopheles albimanus (New world malaria mosquito)	56	83	56	71	16	YAAIEASLSETFNTAA	80.29
DP00827	O31467	Sec-independent protein translocase protein TatAd	Bacillus subtilis (strain 168)	49	70	57	65	9	SAELTAVKQ	80.27
DP00828	P13183	Cytochrome c oxidase subunit 7B; mitochondrial (Cytochrome c oxidase polypeptide VIIb) (IHQ)	Bos taurus (Bovine)	36	56	39	51	13	NAVLASGATFCVA	80.45
DP00833	P22995	Antitoxin ParD	Escherichia coli	38	83	42	58	17	ADQAWQELKTMLGNRIN	80.62
DP00833	P22995	Antitoxin ParD	Escherichia coli	38	83	69	78	10	SVGEILDEEL	76.42
DP00833	P22995	Antitoxin ParD	Escherichia coli	50	83	69	78	10	SVGEILDEEL	76.42
DP00833	P22995	Antitoxin ParD	Escherichia coli	58	83	69	78	10	SVGEILDEEL	76.42
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	21	89	32	38	7	LGASIKG	75.25
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	21	89	55	65	11	QDADFTAKTIA	78.63
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	22	44	32	38	7	LGASIKG	75.25
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	44	89	55	65	11	QDADFTAKTIA	78.63
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	47	89	55	65	11	QDADFTAKTIA	78.63
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	54	1	7	7	MSQRIIQ	87.1
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	54	19	26	8	SDGYEYTV	85.74
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	54	29	49	21	KQAITSEASTTYIPSRIYSES	76.7
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	104	164	115	126	12	RASAFLSQNESS	77.06
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	104	164	129	136	8	LSNASNSP	74.08
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	104	164	138	150	13	MLANSSTATSASA	78.08
DP00836	P01139	Beta-nerve growth factor (Beta-NGF)	Mus musculus (Mouse)	19	128	39	45	7	KLQHSLD	75.25
DP00836	P01139	Beta-nerve growth factor (Beta-NGF)	Mus musculus (Mouse)	19	128	66	72	7	QTRNITV	76.64
DP00836	P01139	Beta-nerve growth factor (Beta-NGF)	Mus musculus (Mouse)	19	128	85	92	8	PRVLFSTQ	79.68
DP00836	P01139	Beta-nerve growth factor (Beta-NGF)	Mus musculus (Mouse)	19	128	101	114	14	LDLDFQAHGTIPFN	77.45
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	1	21	4	11	8	SGALFPSL	79.93
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	132	252	144	151	8	GHELSALG	75.92
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	132	252	155	174	20	GLQSLLGNMSHSQLMQLIGP	84.62
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	132	252	182	188	7	GLGALTG	75.59
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	132	252	190	197	8	GLASLLGS	79.18
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	253	285	261	275	15	PIQLSDLQSILATMN	77.08
DP00840	P46065	Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A)	Bos taurus (Bovine)	74	108	76	86	11	YVAALSLVLKG	76.28
DP00840	P46065	Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A)	Bos taurus (Bovine)	74	108	91	100	10	KLRWYFKLYD	91.14
DP00841	O14733	Dual specificity mitogen-activated protein kinase kinase 7 (MAP kinase kinase 7) (MAPKK 7) (EC 2.7.12.2) (JNK-activating kinase 2) (MAPK/ERK kinase 7) (MEK 7) (Stress-activated protein kinase kinase 4) (SAPK kinase 4) (SAPKK-4) (SAPKK4) (c-Jun N-terminal kinase kinase 2) (JNK kinase 2) (JNKK 2)	Homo sapiens (Human)	30	100	86	95	10	SMESIEIDQK	78.63
DP00842	P12506	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) (HIV-1)	1	86	4	12	9	VDPNIEPWN	77.48
DP00842	P12506	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) (HIV-1)	1	86	34	49	16	CQVCFITKGLGISYGR	82.53
DP00847	P20220	Protein F-112	Sulfolobus spindle-shape virus 1 (SSV1)	74	112	85	94	10	TQDNIAKIFD	86.96
DP00847	P20220	Protein F-112	Sulfolobus spindle-shape virus 1 (SSV1)	74	112	96	107	12	QPANFEQTDQGF	82
DP00848	Q49ZM2	Putative secretory antigen	Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)	1	49	5	22	18	VTATTLTAGIGAAIVGLD	77.07
DP00848	Q49ZM2	Putative secretory antigen	Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)	1	49	27	34	8	ADAAEQTQ	75.25
DP00848	Q49ZM2	Putative secretory antigen	Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)	1	49	37	44	8	NQSTTQST	77.76
DP00849	Q9Q8E9	M156R	Myxoma virus (strain Lausanne) (MYXV)	1	32	14	27	14	KNKNIKVNTYRTSA	82.18
DP00850	P36932	Integrase (EC 2.7.7.-) (EC 3.1.-.-)	Escherichia phage P2 (Bacteriophage P2)	46	161	61	71	11	LSELTQIWWDL	83.37
DP00850	P36932	Integrase (EC 2.7.7.-) (EC 3.1.-.-)	Escherichia phage P2 (Bacteriophage P2)	46	161	82	113	32	NLGKIEIFTKITNDPCAFQITKSLISQYCATR	83.29
DP00850	P36932	Integrase (EC 2.7.7.-) (EC 3.1.-.-)	Escherichia phage P2 (Bacteriophage P2)	46	161	126	146	21	DLTCISGMFTALIEAELFFGE	83.02
DP00851	Q9KX51	PmoC	Methylosinus trichosporium	177	256	177	196	20	HGFSLAFLIVAIGPFMIIPN	83.63
DP00851	Q9KX51	PmoC	Methylosinus trichosporium	177	256	198	247	50	GLNEWGHTFWFMEELFVAPLHWGFVFFGWMALGVFGVVLQILMGVKRLIG	81.48
DP00853	P00127	Cytochrome b-c1 complex subunit 6; mitochondrial (Complex III subunit 6) (Complex III subunit VI) (Cytochrome c1 non-heme 17 kDa protein) (Mitochondrial hinge protein) (Ubiquinol-cytochrome c oxidoreductase subunit 6) (Ubiquinol-cytochrome c reductase 17 kDa protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	72	2	18	17	GMLELVGEYWEQLKITV	79.34
DP00858	A8AZZ3	Amylase-binding protein AbpA	Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)	24	44	24	39	16	ADEATDAARNNDGAYY	81.4
DP00863	Q9X0Q3	Transcriptional regulator; crp family	Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)	130	201	134	143	10	KLMNFLVRHM	81.07
DP00863	Q9X0Q3	Transcriptional regulator; crp family	Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)	130	201	154	163	10	TLEELSRLFG	78.06
DP00863	Q9X0Q3	Transcriptional regulator; crp family	Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)	130	201	169	182	14	LSRVFQELEREGYI	78.76
DP00866	O54465	Hypothetical mobile element-associated protein (Pathogenicity island protein)	Staphylococcus aureus	42	72	46	52	7	LQQSEQS	73.91
DP00866	O54465	Hypothetical mobile element-associated protein (Pathogenicity island protein)	Staphylococcus aureus	42	72	56	67	12	QYGTTLQNLAKQ	82
DP00869	F2Z293	Chlorophyll a-b binding protein; chloroplastic	Spinacia oleracea (Spinach)	1	87	19	38	20	KAPEYLDGSLVGDYGFDPFG	77.58
DP00869	F2Z293	Chlorophyll a-b binding protein; chloroplastic	Spinacia oleracea (Spinach)	1	87	41	51	11	KPAEYLQYDYD	79.78
DP00869	F2Z293	Chlorophyll a-b binding protein; chloroplastic	Spinacia oleracea (Spinach)	1	87	53	68	16	LDQNLAKNLAGDIIGT	83.61
DP00869	F2Z293	Chlorophyll a-b binding protein; chloroplastic	Spinacia oleracea (Spinach)	1	87	73	82	10	ADVKSTSLQP	79.93
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	379	392	14	VARLFSLFGCQEED	92.76
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	402	422	21	LALALAHAGELEALQALMELG	77.5
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	431	442	12	NGQTLLHVAARN	75.92
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	445	451	7	DGVVTML	79.26
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	514	520	7	GLQAWGQ	76.97
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	536	558	23	LCVAEAAGNQEVLALLRNLALVG	77.74
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	379	392	14	VARLFSLFGCQEED	92.76
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	402	422	21	LALALAHAGELEALQALMELG	77.5
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	431	442	12	NGQTLLHVAARN	75.92
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	445	451	7	DGVVTML	79.26
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	514	520	7	GLQAWGQ	76.97
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	536	558	23	LCVAEAAGNQEVLALLRNLALVG	77.74
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	4	16	13	NTVSSFQDILLRM	78.18
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	18	25	8	KMQLESSS	77.01
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	28	42	15	LNGMITQFESLKLYR	79.64
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	53	62	10	GDLHSLQNRN	75.72
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	69	83	15	LGQKFEEIRWLIEEV	80.89
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	85	116	32	HKLKITENSFEQITFMQALHLLLEVEQEIRTF	81.9
DP00872	P80428	Actin-related protein 4 (Actin-like protein ARP4) (Actin-like protein 4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	199	226	203	211	9	IIPLFAIKQ	85.69
DP00872	P80428	Actin-related protein 4 (Actin-like protein ARP4) (Actin-like protein 4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	199	226	213	221	9	KPEFIKKTF	76.37
DP00873	Q9H981	Actin-related protein 8 (hArp8) (INO80 complex subunit N)	Homo sapiens (Human)	401	507	420	430	11	HDEHYLLATQS	81.03
DP00873	Q9H981	Actin-related protein 8 (hArp8) (INO80 complex subunit N)	Homo sapiens (Human)	401	507	485	496	12	NDSEEALTALMS	75.47
DP00874	Q12406	Actin-related protein 7 (Actin-like protein ARP7) (Chromatin structure-remodeling complex protein ARP7) (SWI/SNF complex component ARP7)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	353	379	359	374	16	GTSHINTNVGDNNSTA	79.56
DP00875	P69723	Virion infectivity factor (Vif) (SOR protein) Cleaved into: p17; p7	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	141	192	143	156	14	GSLQYLALAALITP	81.56
DP00876	P14340	Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)	Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2)	1	100	26	37	12	VQQLTKRFSLGM	80.94
DP00876	P14340	Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)	Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2)	1	100	43	60	18	PLKLFMALVAFLRFLTIP	85.28
DP00876	P14340	Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)	Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2)	1	100	74	83	10	KSKAINVLRG	75.89
DP00877	P9WHN5	Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	64	39	59	21	LLDEIDDVLEENAEDFVRAYV	82.13
DP00877	P9WHN5	Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	21	61	39	56	18	LLDEIDDVLEENAEDFVR	81.22
DP00877	P9WHN5	Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	21	51	39	46	8	LLDEIDDV	79.93
DP00878	G8HXD9	NepR	Sphingomonas sp. Fr1	28	56	32	44	13	LRSAYQKTIEEQV	82.71
DP00884	P50106	DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	49	79	51	60	10	IDSTTMNTIS	84.75
DP00884	P50106	DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	101	137	102	116	15	AQDFSAAPIQVSTTE	75.67
DP00884	P50106	DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	102	137	102	116	15	AQDFSAAPIQVSTTE	75.67
DP00889	P9WF19	Putative antitoxin VapB5	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	45	24	30	7	EDVTITV	77.88
DP00892	O31818	UPF0291 protein YnzC	Bacillus subtilis (strain 168)	41	77	50	56	7	KSVKIID	85.14
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	1	10	10	MLDFFTIFSK	91.54
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	12	23	12	GLVLWCFQGVSD	91.36
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	29	40	12	VNALIRSVLLQE	77.48
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	42	91	50	GGNNSFTHEALTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFR	82.19
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	100	122	23	QQSALSLLNGTFDFQNDFLRLLR	81.42
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	200	211	12	NGVELSKEELIR	80.99
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	213	220	8	KREEFIQK	85.7
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	256	264	9	KEVLDYSTP	76.92
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	274	282	9	LSEDINLIR	85.28
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	303	309	7	AAQNSTK	82.94
DP00894	Q7B2Z6	Intrinsic membrane protein PufX (PUFX protien)	Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)	54	82	69	77	9	GALETGIEL	83.28
DP00895	P03421	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain A2)	1	102	16	29	14	RATKFLESIKGKFT	78.88
DP00895	P03421	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain A2)	1	102	37	67	31	KDSIISVNSIDIEVTKESPITSNSTIINPTN	83.53
DP00895	P03421	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain A2)	1	102	83	90	8	PLVSFKED	78.26
DP00896	P10121	Signal recognition particle receptor FtsY (SRP receptor)	Escherichia coli (strain K12)	1	187	6	16	11	KRGFFSWLGFG	78.29
DP00896	P10121	Signal recognition particle receptor FtsY (SRP receptor)	Escherichia coli (strain K12)	1	187	34	43	10	VVEEIVQAQE	91.97
DP00896	P10121	Signal recognition particle receptor FtsY (SRP receptor)	Escherichia coli (strain K12)	1	187	62	82	21	AEAETFAADVVEVTEQVAESE	82.4
DP00896	P10121	Signal recognition particle receptor FtsY (SRP receptor)	Escherichia coli (strain K12)	1	187	130	169	40	AEAETVEIVEAAEEEAAKEEITDEELETALAAEAAEEAVM	79.75
DP00898	P13338	RNA polymerase-associated protein Gp33	Enterobacteria phage T4 (Bacteriophage T4)	1	31	1	10	10	MTQFSLNDIR	76.05
DP00899	P44654	Periplasmic nitrate reductase; electron transfer subunit (Diheme cytochrome c NapB)	Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)	28	62	37	44	8	TQAAENIP	88.21
DP00900	Q04660	Ribosome biogenesis protein ERB1 (Eukaryotic ribosome biogenesis protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	535	570	544	552	9	KSNLEVNEN	82.83
DP00900	Q04660	Ribosome biogenesis protein ERB1 (Eukaryotic ribosome biogenesis protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	535	570	559	565	7	GENESAK	74.25
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	1	101	32	38	7	RDEIIEK	89.97
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	1	101	40	96	57	MRLVWSVVQRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQ	83.52
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	159	250	169	193	25	NDGDPITLLDQIADADEASWFDKIA	80.84
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	159	250	204	215	12	RERLIVYLRYYR	85.76
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	159	250	236	245	10	LEKKILQHIK	83.08
DP00903	P47813	Eukaryotic translation initiation factor 1A; X-chromosomal (eIF-1A X isoform) (Eukaryotic translation initiation factor 4C) (eIF-4C)	Homo sapiens (Human)	124	144	125	135	11	DDDEIQFDDIG	75.8
DP00904	Q58876	Uncharacterized protein MJ1481	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	104	213	109	124	16	EGALYIVSNKKLFKKL	81.35
DP00904	Q58876	Uncharacterized protein MJ1481	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	104	213	138	149	12	GMLDIEDMRAIG	74.58
DP00904	Q58876	Uncharacterized protein MJ1481	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	104	213	168	208	41	NVERFIEKYKPEKIFVVVEDDKDELLYLRAKNLYNAEKLDA	82.85
DP00907	Q9HB71	Calcyclin-binding protein (CacyBP) (hCacyBP) (S100A6-binding protein) (Siah-interacting protein)	Homo sapiens (Human)	48	80	51	57	7	KAELLDN	75.63
DP00907	Q9HB71	Calcyclin-binding protein (CacyBP) (hCacyBP) (S100A6-binding protein) (Siah-interacting protein)	Homo sapiens (Human)	48	80	63	75	13	VVAPITTGYTDGI	76.28
DP00908	P9WJ35	Antitoxin VapB30	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	46	27	33	7	EAVVTAL	76.78
DP00910	P41567	Eukaryotic translation initiation factor 1 (eIF1) (A121) (Protein translation factor SUI1 homolog) (Sui1iso1)	Homo sapiens (Human)	1	28	3	14	12	AIQNLHSFDPFA	79.29
DP00912	Q8N4Q1	Mitochondrial intermembrane space import and assembly protein 40 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 4)	Homo sapiens (Human)	107	142	121	134	14	AEQAEETAPIEATA	75.25
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	2	9	8	KFGFIAHP	94.65
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	13	69	57	GLKRYVKMLDLLQRNSTEQHSGYTRELWERQNLVPFMNFARITSATGATCEGVIKYM	78.74
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	87	95	9	VVQGIEELA	79.34
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	103	111	9	GLGGFTSIV	83.5
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	129	151	23	GNSLTTYAGYKALMQIQSWLEIR	79.02
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	155	187	33	EPVAIVGYPGSICLALSRLLLAHGFSLHLLHRA	81.25
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	219	234	16	RCKLFAAATSAGGVID	78.57
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	239	250	12	QPGSIFIDVALP	78.93
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	262	319	58	DDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAETIVLALENRRENFSLGRYLA	84.86
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	322	366	45	KVLEIGEIAERHGFFAYPLASYGERIDRQSVTNLKRYYHHDIYAG	82.07
DP00915	Q5JH72	PCNA-inhibitor (Thermococcales inhibitor of PCNA) (TIP)	Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1))	1	27	4	11	8	KLDEFIGD	89.97
DP00918	A0MHA3	Patellamide protein	uncultured Prochloron sp.	36	64	38	53	16	GLEASVTACITFCAYD	88.52
DP00919	C6KEI3	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus 1	1	75	6	17	12	SKSSIVGWPAIR	76.25
DP00919	C6KEI3	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus 1	1	75	49	61	13	HGALTSSNTDTTN	75.25
DP00919	C6KEI3	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus 1	152	180	153	160	8	GEVEEATE	75.17
DP00922	P67966	Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1)	Gallus gallus (Chicken)	67	115	76	83	8	GAGTLSTD	74.58
DP00922	P67966	Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1)	Gallus gallus (Chicken)	67	115	88	94	7	LGIKYEE	80.94
DP00926	Q9BQB4	Sclerostin	Homo sapiens (Human)	25	79	25	42	18	GWQAFKNDATEIIPELGE	80.12
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	1	72	2	36	35	KQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEA	79.73
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	1	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	32	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	37	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	41	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	46	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	46	71	53	66	14	AEVARFIEMNGSFA	78.74
DP00929	P04608	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	1	86	34	49	16	CQVCFITKALGISYGR	82.38
DP00929	P04608	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	1	86	65	71	7	HQASLSK	74.44
DP00929	P04608	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	50	86	65	71	7	HQASLSK	74.44
DP00931	Q5ZYC9	IcmR	Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)	1	27	1	16	16	MGNNTDDSARNPFGFY	76.76
DP00932	P35926	Recombination enhancement function protein	Escherichia phage P1 (Bacteriophage P1)	1	76	4	15	12	IEQKIEQCRKWQ	85.28
DP00934	P61925	cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform)	Homo sapiens (Human)	1	76	2	15	14	TDVETTYADFIASG	79.34
DP00934	P61925	cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform)	Homo sapiens (Human)	1	76	22	51	30	AIHDILVSSASGNSNELALKLAGLDINKTE	77.65
DP00937	Q12972	Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1)	Homo sapiens (Human)	144	225	163	172	10	LDNLTEFNTA	85.82
DP00937	Q12972	Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1)	Homo sapiens (Human)	144	225	176	190	15	RISTLTIEEGNLDIQ	80.25
DP00937	Q12972	Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1)	Homo sapiens (Human)	144	225	199	211	13	SRVTFSEDDEIIN	90.17
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	13	21	9	TDFLEEWKA	78.3
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	51	65	15	LAQTTAAGTSELNHG	77.95
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	156	171	16	GVVNIPAAECLDEYED	90.05
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	181	197	17	REDAITQQNTIQNEAAS	80.64
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	218	233	16	YKSTISAPEEEILNRY	79.08
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	250	265	16	APANFASSSTLEKRIE	76.71
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	295	305	11	LKEEIDLLNRD	75.31
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	13	21	9	TDFLEEWKA	78.3
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	51	65	15	LAQTTAAGTSELNHG	77.95
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	156	171	16	GVVNIPAAECLDEYED	90.05
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	181	197	17	REDAITQQNTIQNEAAS	80.64
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	218	233	16	YKSTISAPEEEILNRY	79.08
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	250	265	16	APANFASSSTLEKRIE	76.71
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	1	154	19	29	11	HRSAYEAGIQA	78.78
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	1	154	57	67	11	IKSMFLQMGTT	75.55
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	1	154	109	124	16	ALLKLGTSVSERVSRF	74.16
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	417	494	447	468	22	RKIHFSTAPIQVFSTYSNEDYD	80.1
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	417	494	478	487	10	AASAEYELEK	76.69
DP00944	P12736	50S ribosomal protein L32e (Hl5)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	1	94	10	21	12	AEEEYTELTDIS	77.87
DP00944	P12736	50S ribosomal protein L32e (Hl5)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	1	94	34	41	8	AGFESVED	79.93
DP00944	P12736	50S ribosomal protein L32e (Hl5)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	1	94	46	65	20	DQSALADVSGIGNALAARIK	77.26
DP00944	P12736	50S ribosomal protein L32e (Hl5)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	1	94	71	84	14	LEVESETEAEVEEE	76.54
DP00947	O10609	Protein E7	Human papillomavirus 45	1	41	7	16	10	TLQEIVLHLE	80.43
DP00947	O10609	Protein E7	Human papillomavirus 45	1	41	24	36	13	VDLLCYEQLSESE	79.78
DP00947	O10609	Protein E7	Human papillomavirus 45	72	106	72	81	10	RIELTVESSA	78.36
DP00947	O10609	Protein E7	Human papillomavirus 45	72	106	86	101	16	TLQQLFLSTLSFVCPW	83.36
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	161	210	169	176	8	PKGFYAEG	78.43
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	168	208	169	176	8	PKGFYAEG	78.43
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	182	247	218	226	9	TALALLLLD	85.88
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	182	247	228	234	7	LNQLESK	73.96
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	343	402	348	364	17	KDNVILLNKHIDAYKTF	80.86
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	366	422	407	413	7	QLQNSMS	84.62
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	430	486	455	481	27	EGGIWEDEDARNFYENLIDLKAFVPAI	81.79
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	481	530	517	525	9	DLELELENL	80.45
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	1105	1129	1110	1118	9	DEDFIQALD	80.16
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	1167	1207	1181	1187	7	QQFKILN	82.61
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	1167	1207	1195	1202	8	AANHWNQQ	79.52
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	16	22	7	DDQKIEQ	83.61
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	34	47	14	AATKIQASFRGHIT	77.81
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	59	67	9	VQAAEAEAN	77.26
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	116	122	7	GDAATEQ	75.25
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	172	182	11	AAVTAAAATTP	78.96
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	203	213	11	SQAEENIEAVD	77.14
DP00953	Q9H832	Ubiquitin-conjugating enzyme E2 Z (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme Z) (Uba6-specific E2 conjugating enzyme 1) (Use1) (Ubiquitin carrier protein Z) (Ubiquitin-protein ligase Z)	Homo sapiens (Human)	1	99	76	84	9	GAALLSHWD	79.86
DP00954	Q9YGY0	Axin-1 (Axis inhibition protein 1) (xAxin)	Xenopus laevis (African clawed frog)	435	465	445	455	11	HHFNSRYSETG	78.29
DP00955	P06836	Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43)	Bos taurus (Bovine)	1	242	16	22	7	EDQKIEQ	82.61
DP00955	P06836	Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43)	Bos taurus (Bovine)	1	242	34	47	14	AATKIQASFRGHIT	77.81
DP00955	P06836	Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43)	Bos taurus (Bovine)	1	242	61	77	17	AAEAEANEKDEAAVAEG	78.32
DP00955	P06836	Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43)	Bos taurus (Bovine)	1	242	176	185	10	AAVTAAAATA	79.06
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	265	272	8	DAELIARA	92.64
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	331	341	11	QTVTTAELSST	80.05
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	352	365	14	LKVALSKLVLDETN	78.93
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	415	422	8	EEVLVNRK	74.92
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	437	445	9	KRNEYWNDA	77.07
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	448	456	9	DDYDYGYED	74.73
DP00958	P46984	EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	13	19	7	GVEKSFA	75.35
DP00958	P46984	EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	61	87	27	GSQLTYLGQLRTQLTGLQDDINEFLTG	78.67
DP00958	P46984	EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	105	115	11	IQEEINQLLDG	83.34
DP00958	P46984	EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	65	113	77	87	11	LQDDINEFLTG	82.61
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	301	313	13	VNPYYVNAGYALA	79.21
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	322	328	7	EQQSLSS	81.08
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	330	337	8	ADTLSLTD	79.43
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	384	394	11	EPQKFAEELIH	81.88
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	466	472	7	NPESILD	75.92
DP00961	P52630	Signal transducer and activator of transcription 2 (p113)	Homo sapiens (Human)	786	816	802	811	10	PMEIFRNCVK	82.14
DP00961	P52630	Signal transducer and activator of transcription 2 (p113)	Homo sapiens (Human)	817	838	824	833	10	AGQNTVDEVY	80.2
DP00962	P42224	Signal transducer and activator of transcription 1-alpha/beta (Transcription factor ISGF-3 components p91/p84)	Homo sapiens (Human)	720	750	733	745	13	EVSRIVGSVEFDS	84.44
DP00965	P0C6L3	Small delta antigen (S-HDAg) (p24)	Hepatitis delta virus genotype I (isolate D380) (HDV)	12	60	14	23	10	EEVLEQWVSG	77.86
DP00968	Q60795	Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2)	Mus musculus (Mouse)	1	98	16	29	14	DMDLIDILWRQDID	76.73
DP00968	Q60795	Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2)	Mus musculus (Mouse)	1	98	33	41	9	SREVFDFSQ	78.6
DP00968	Q60795	Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2)	Mus musculus (Mouse)	1	98	66	93	28	QEKAFFAQFQLDEETGEFLPIQPAQHIQ	79.23
DP00969	Q02548	Paired box protein Pax-5 (B-cell-specific transcription factor) (BSAP)	Homo sapiens (Human)	1	30	18	25	8	GGVNQLGG	76.09
DP00970	P0ABD8	Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)	Escherichia coli (strain K12)	1	77	2	25	24	DIRKIKKLIELVEESGISELEISE	76
DP00970	P0ABD8	Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)	Escherichia coli (strain K12)	1	77	44	52	9	MQQAYAAPM	77.74
DP00970	P0ABD8	Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)	Escherichia coli (strain K12)	1	77	57	70	14	AQSNAAAPATVPSM	77.26
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	10	16	7	RSSWYWG	87.58
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	22	29	8	EAVALLQG	80.89
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	31	43	13	RHGVFLVRDSSTS	84.46
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	45	54	10	GDYVLSVSEN	78.46
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	56	64	9	RVSHYIINS	84.36
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	90	117	28	GDQEFDSLPALLEFYKIHYLDTTTLIEP	83.6
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	124	146	23	GSGVILRQEEAEYVRALFDFNGN	81.42
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	166	174	9	EEQWWNAED	85.43
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	182	191	10	IPVPYVEKYR	78.8
DP00974	P42866	Mu-type opioid receptor (M-OR-1) (MOR-1)	Mus musculus (Mouse)	1	51	26	34	9	PGSWLNLSH	74.69
DP00974	P42866	Mu-type opioid receptor (M-OR-1) (MOR-1)	Mus musculus (Mouse)	361	398	384	393	10	NHQLENLEAE	77.06
DP00975	Q86FP9	Thrombin inhibitor madanin 1	Haemaphysalis longicornis (Bush tick)	20	79	47	56	10	GDADYDEYEE	77.26
DP00975	Q86FP9	Thrombin inhibitor madanin 1	Haemaphysalis longicornis (Bush tick)	50	73	50	56	7	DYDEYEE	77.26
DP00976	P04578	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	127	196	136	149	14	NDTNTNSSSGRMIM	79.93
DP00976	P04578	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	127	196	155	165	11	KNCSFNISTSI	81.42
DP00976	P04578	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	127	196	169	185	17	VQKEYAFFYKLDIIPID	81.57
DP00976	P04578	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	297	331	315	324	10	RAFVTIGKIG	86.66
DP00977	Q86FP8	Thrombin inhibitor madanin 2	Haemaphysalis longicornis (Bush tick)	20	80	41	58	18	VQERYQGNQGDYDEYDQD	81.03
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	34	41	8	WVTVYYGV	79.47
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	48	71	24	TTTLFCASDAKAYDTEVHNVWATH	79.89
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	81	114	34	QEVKLENVTENFNMWKNNMVEQMHEDIISLWDQS	82.85
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	124	132	9	LCVTLNCTD	86.96
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	135	147	13	NATNTTSSSWETM	77.05
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	153	165	13	KNCSFNITTSIRD	77.03
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	167	200	34	VQKEYALFYNLDVVPIDNASYRLISCNTSVITQA	81.71
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	217	230	14	AGFAILKCNDKKFN	79.55
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	236	246	11	TNVSTVQCTHG	77.26
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	252	293	42	STQLLLNGSLAEEEIVIRSENFTNNAKTIIVQLNESVVINCT	82.54
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	308	322	15	GRALYTTGEIIGDIR	85.26
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	324	359	36	AHCNLSKTQWENTLEQIAIKLKEQFGNNKTIIFNPS	81.41
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	362	391	30	GDPEIVTHSFNCGGEFFYCNSTQLFTWNDT	85.65
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	393	403	11	KLNNTGRNITL	77.17
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	407	423	17	IKQIINMWQEVGKAMYA	77
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	432	441	10	CSSNITGLLL	79.26
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	467	479	13	RSELYKYKVVKIE	85.16
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	127	193	135	147	13	NATNTTSSSWETM	77.05
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	127	193	153	165	13	KNCSFNITTSIRD	77.03
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	127	193	167	188	22	VQKEYALFYNLDVVPIDNASYR	81.83
DP00980	P36595	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (DNA-directed RNA polymerases I; II; and III 15 kDa polypeptide) (RPC16)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	59	14	28	15	GAVMEEEVDELEMID	77.26
DP00980	P36595	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (DNA-directed RNA polymerases I; II; and III 15 kDa polypeptide) (RPC16)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	59	44	54	11	STTVITEDVAS	81.33
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	70	164	73	99	27	PSLVISLSTGLSLFLGRFVFFNFQREN	82.26
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	70	164	109	117	9	GMSHFEAGD	82.61
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	70	164	119	130	12	RAKEYVSLLKSN	77.01
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	70	164	133	159	27	VGFNIVDVLAWGSIGHIVAYYILATAS	82.87
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	73	167	73	99	27	PSLVISLSTGLSLFLGRFVFFNFQREN	82.26
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	73	167	109	117	9	GMSHFEAGD	82.61
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	73	167	119	130	12	RAKEYVSLLKSN	77.01
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	73	167	133	162	30	VGFNIVDVLAWGSIGHIVAYYILATASNGY	82.11
DP00985	Q87WW0	Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) (SAT)	Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)	217	305	219	236	18	NGTLIMIDDERILEHLTD	79.1
DP00985	Q87WW0	Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) (SAT)	Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)	217	305	259	280	22	GAVESEATSLTDIIQEMLLTRT	77.55
DP00986	Q8QWD4	VP4 (Fragment)	Human enterovirus D68 (EV68) (EV-68)	2	29	14	24	11	ENANIATNGSH	84.16
DP00990	P12355	Photosystem I reaction center subunit III; chloroplastic (Light-harvesting complex I 17 kDa protein) (PSI-F)	Spinacia oleracea (Spinach)	1	77	1	11	11	MSFTIPTNLYK	82.82
DP00990	P12355	Photosystem I reaction center subunit III; chloroplastic (Light-harvesting complex I 17 kDa protein) (PSI-F)	Spinacia oleracea (Spinach)	1	77	54	70	17	AAAALALSSVLLSSWSV	79.38
DP00992	P27356	Methane monooxygenase regulatory protein B	Methylosinus trichosporium	1	35	4	30	27	AHNAYNAGIMQKTGKAFADEFFAEENQ	80.04
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	253	25	35	11	RAQQIAFEQAL	79.2
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	253	50	60	11	GDETTEAAATA	74.7
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	253	191	197	7	TAQASVQ	80.27
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	253	242	248	7	GDRLLAR	75.59
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	20	40	25	35	11	RAQQIAFEQAL	79.2
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	142	168	146	163	18	TAQLSLQDYLNQQANNQF	80.01
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	177	273	202	234	33	KTKEYLEFDATFVESNTRKNFGDRNNNSRNNFN	86.43
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	177	273	244	268	25	KGNNTANATNSANTVQKNRNIDVSN	77.95
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	273	202	234	33	KTKEYLEFDATFVESNTRKNFGDRNNNSRNNFN	86.43
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	273	244	268	25	KGNNTANATNSANTVQKNRNIDVSN	77.95
DP00995	P01097	ATPase inhibitor; mitochondrial (ATP synthase F1 subunit epsilon)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	28	50	35	43	9	SEDSFVKRE	73.91
DP00997	P0A4T9	HTH-type transcriptional activator TipA	Streptomyces lividans	111	159	111	127	17	GINLTPEEKFEVFGDFD	79.82
DP00997	P0A4T9	HTH-type transcriptional activator TipA	Streptomyces lividans	111	159	141	147	7	NTDAYRQ	74.58
DP00998	Q05127	Polymerase cofactor VP35 (Ebola VP35) (eVP35)	Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)	20	48	25	36	12	LSGWISEQLMTG	80.85
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	131	137	7	GYACLVG	73.91
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	146	152	7	VKGVIDN	73.96
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	156	174	19	AKLAFKKSSKYDLECAQIP	79.93
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	189	210	22	PEGHYNWHHGAVQYSGGRFTIP	81.06
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	229	241	13	RVVAIVLGGANEG	83.71
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	246	255	10	LSVVTWNKDM	90.13
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	340	354	15	LRSLFGITKGVESTG	80.4
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	367	383	17	SACPFNKGISQGDLKTD	75.66
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	387	393	7	LAGNYGQ	91.3
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	400	407	8	DVSNFAMG	91.97
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	427	436	10	RRSVIFSASA	81.04
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	444	454	11	VHSYSAVSNLD	79.72
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	475	483	9	SSQAYSHSG	75.77
DP01011	P68390	Ovomucoid	Meleagris gallopavo (Wild turkey)	1	65	17	25	9	KDVLVCTED	75.62
DP01011	P68390	Ovomucoid	Meleagris gallopavo (Wild turkey)	1	65	38	55	18	SECLLCAYNIEYGTNISK	79.58
DP01014	O94742	26S proteasome complex subunit SEM1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	89	3	18	16	TDVAAAQAQSKIDLTK	84.34
DP01014	O94742	26S proteasome complex subunit SEM1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	89	36	65	30	EDFPIDTWANGETIKSNAVTQTNIWEENWD	81.56
DP01015	Q83AR4	Elongation factor P (EF-P)	Coxiella burnetii (strain RSA 493 / Nine Mile phase I)	132	188	159	176	18	GAVVRVPLFLNEGEIIKV	78.86
DP01016	Q20MD5	Matrix protein 2 (Fragment)	Influenza A virus (strain A/Udorn/1972 H3N2)	1	21	1	10	10	MSLLTEVETP	77.06
DP01022	Q6URW6	Myosin-14 (Myosin heavy chain 14) (Myosin heavy chain; non-muscle IIc) (Non-muscle myosin heavy chain IIc) (NMHC II-C)	Mus musculus (Mouse)	1954	2000	1961	1978	18	VRQVFRLEEGVASDEEEA	76.14
DP01025	P02619	Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2)	Esox lucius (Northern pike)	1	107	8	39	32	ADVAAALAACSAADSFKHKEFFAKVGLASKSL	75.56
DP01025	P02619	Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2)	Esox lucius (Northern pike)	1	107	43	51	9	KKAFYVIDQ	82.09
DP01025	P02619	Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2)	Esox lucius (Northern pike)	1	107	53	88	36	KSGFIEEDELKLFLQNFSPSARALTDAETKAFLADG	77.19
DP01025	P02619	Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2)	Esox lucius (Northern pike)	1	107	92	102	11	GDGMIGVDEFA	79.93
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2131	2145	15	AVAHILGIRDVASIN	81.03
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2155	2169	15	LDSLMGVEVRQILER	73.58
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2171	2177	7	HDLVLSM	85.67
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2180	2196	17	VRQLSLRKLQELSSKTS	78.52
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2213	2228	16	RQQATLNLSTLLVNPE	80.1
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2251	2277	27	IEGSITVFHGLAAKLSIPTYGLQCTGA	75.87
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2280	2296	17	LDSIQSLASYYIECIRQ	80.56
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2301	2320	20	GPYRIAGYSYGACVAFEMCS	78.11
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2332	2354	23	NHSLFLFDGSHTFVLAYTQSVRA	87.09
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2359	2379	21	GCEAEAEAKAMYFFVQQFTDM	78.26
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2382	2407	26	GKVLEALIPLQGLEARVAATVDLITQ	81.98
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2415	2449	35	HALSFAARSFYQKLRAAENYWPQATYHGNVTLLRA	82.7
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2459	2467	9	LGADYNLSQ	79.82
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2474	2480	7	SVHVIEG	79.55
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2490	2501	12	GLESILSIIHSC	88.46
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2188	2212	2188	2196	9	LQELSSKTS	82.61
DP01028	Q59471	Diol dehydrase beta subunit (EC 4.2.1.28)	Klebsiella oxytoca	1	45	7	19	13	LLRQIIEDVLSEM	79.5
DP01028	Q59471	Diol dehydrase beta subunit (EC 4.2.1.28)	Klebsiella oxytoca	1	45	24	35	12	KPVSFNAPAASA	81.61
DP01029	Q59472	Diol dehydrase gamma subunit (EC 4.2.1.28) (Propanediol dehydratase) (Propanediol dehydratase small subunit PduE)	Klebsiella oxytoca	1	36	2	16	15	NTDAIESMVRDVLSR	77.61
DP01031	Q99IB8	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 2a (isolate JFH-1) (HCV)	2224	2317	2231	2246	16	VDANLLMEGGVAQTEP	80.27
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	815	831	17	GENNLGGQSEEITITED	81.84
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	855	873	19	SQEDIVLGGPGQVIDFTED	77.57
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	882	889	8	NSHTITED	79.93
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	895	901	7	EDEVIIG	94.46
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	903	912	10	QGQVIDFTED	80
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	926	932	7	GTVLEED	80.27
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	938	944	7	EDEVIIG	94.46
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	946	955	10	QGQVIDFTED	80
DP01033	Q91006	Tropomodulin	Gallus gallus (Chicken)	1	92	18	27	10	ILGALTEEEL	73.91
DP01033	Q91006	Tropomodulin	Gallus gallus (Chicken)	1	92	29	38	10	KLENELEELD	76.25
DP01034	P73124	Ssl1911 protein	Synechocystis sp. (strain PCC 6803 / Kazusa)	1	65	4	12	9	QQQARALMM	73.91
DP01034	P73124	Ssl1911 protein	Synechocystis sp. (strain PCC 6803 / Kazusa)	1	65	14	20	7	HHQFIKN	84.09
DP01034	P73124	Ssl1911 protein	Synechocystis sp. (strain PCC 6803 / Kazusa)	1	65	29	45	17	AAAEIGVEAEKDFWTTV	81.88
DP01035	Q39805	Dehydrin-like protein	Glycine max (Soybean) (Glycine hispida)	1	226	14	20	7	KVDEYGN	75.35
DP01035	Q39805	Dehydrin-like protein	Glycine max (Soybean) (Glycine hispida)	1	226	24	30	7	QTDEYGN	73.91
DP01035	Q39805	Dehydrin-like protein	Glycine max (Soybean) (Glycine hispida)	1	226	34	43	10	AASVTYVATR	85.15
DP01035	Q39805	Dehydrin-like protein	Glycine max (Soybean) (Glycine hispida)	1	226	45	51	7	AAGGYSD	74.77
DP01035	Q39805	Dehydrin-like protein	Glycine max (Soybean) (Glycine hispida)	1	226	59	65	7	TTNAYGV	87.29
DP01035	Q39805	Dehydrin-like protein	Glycine max (Soybean) (Glycine hispida)	1	226	100	108	9	TTGVYGIDT	79.93
DP01035	Q39805	Dehydrin-like protein	Glycine max (Soybean) (Glycine hispida)	1	226	126	140	15	QHGNIGGPYYGTNTA	80.71
DP01036	I1JLC8	Protein SLE2 (Em protein) (Protein Glycine max physiologically mature 11) (Protein GmD-19) (Soybean group-1 late embryogenesis abundant protein 2) (Soybean group-1 lea protein 2) (Sle2)	Glycine max (Soybean) (Glycine hispida)	1	105	33	40	8	AQQHLAEG	82.94
DP01036	I1JLC8	Protein SLE2 (Em protein) (Protein Glycine max physiologically mature 11) (Protein GmD-19) (Soybean group-1 late embryogenesis abundant protein 2) (Soybean group-1 lea protein 2) (Sle2)	Glycine max (Soybean) (Glycine hispida)	1	105	53	61	9	GTEGYQEMG	75.59
DP01038	Q9FUM5	BN28a	Brassica napus (Rape)	1	65	4	12	9	NKQSFQAGQ	74.58
DP01038	Q9FUM5	BN28a	Brassica napus (Rape)	1	65	29	48	20	KDAATAAGASAQTAGQKITE	76.27
DP01038	Q9FUM5	BN28a	Brassica napus (Rape)	1	65	52	60	9	GAVNLVKEK	91.97
DP01039	Q85258	Polyprotein (Fragment)	Potato virus Y	336	523	356	375	20	AGFEIDNNDDTIEEFFGSAY	82.78
DP01039	Q85258	Polyprotein (Fragment)	Potato virus Y	336	523	392	413	22	SRRFINMYGFDPTEYSFIQFVD	81.96
DP01039	Q85258	Polyprotein (Fragment)	Potato virus Y	336	523	416	436	21	TGAQIEENVYADIRDIQERFS	83.39
DP01039	Q85258	Polyprotein (Fragment)	Potato virus Y	336	523	453	464	12	LGSNTTIHAYFR	79.77
DP01039	Q85258	Polyprotein (Fragment)	Potato virus Y	336	523	487	495	9	KTNGIAKFP	78.6
DP01040	Q9FUW7	Omega gliadin storage protein	Triticum aestivum (Wheat)	1	280	2	24	23	KTFLIFVLLAMAMKIATAARELN	83.03
DP01040	Q9FUW7	Omega gliadin storage protein	Triticum aestivum (Wheat)	1	280	33	45	13	PQQSFSYQQQPFP	77.64
DP01040	Q9FUW7	Omega gliadin storage protein	Triticum aestivum (Wheat)	1	280	77	83	7	SQQPFTQ	77.26
DP01040	Q9FUW7	Omega gliadin storage protein	Triticum aestivum (Wheat)	1	280	125	131	7	TQQSFPL	82.94
DP01040	Q9FUW7	Omega gliadin storage protein	Triticum aestivum (Wheat)	1	280	155	169	15	QSEQIIPQQLQQPFP	81.76
DP01040	Q9FUW7	Omega gliadin storage protein	Triticum aestivum (Wheat)	1	280	195	201	7	PQQSFPQ	73.91
DP01040	Q9FUW7	Omega gliadin storage protein	Triticum aestivum (Wheat)	1	280	213	225	13	PQQLFPELQQPIP	79.39
DP01040	Q9FUW7	Omega gliadin storage protein	Triticum aestivum (Wheat)	1	280	252	258	7	PQQSFPQ	73.91
DP01040	Q9FUW7	Omega gliadin storage protein	Triticum aestivum (Wheat)	1	280	266	275	10	QQQPYGSSLT	77.99
DP01043	Q80FJ1	Membrane fusion protein p14	Reptilian orthoreovirus	2	31	4	21	18	GPSNFVNHAPGEAIVTGL	83.22
DP01044	Q47785	Bacteriocin immunity protein (EntI protein) (Immunity protein for enterocin A) (Orf2 protein) (Probable immunity protein)	Enterococcus faecium (Streptococcus faecium)	82	103	89	95	7	INGLYRA	80.6
DP01045	Q7DB66	Lipoprotein	Escherichia coli O157:H7	60	85	66	79	14	FVRAITILNNNGFP	81.75
DP01047	O50835	Fibronectin-binding protein BBK32	Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)	56	205	87	103	17	NKSNFLQKNVILEEESL	79.52
DP01047	O50835	Fibronectin-binding protein BBK32	Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)	56	205	130	139	10	TQGSLNSLSG	76.05
DP01047	O50835	Fibronectin-binding protein BBK32	Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)	56	205	148	158	11	IESNEIDLTID	85.77
DP01047	O50835	Fibronectin-binding protein BBK32	Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)	56	205	166	197	32	SLQGIAGSNSISYTDEIEEEDYDQYYLDEYDE	79.71
DP01048	Q39532	Opaque 2	"Coix lacryma-jobi (Jobs tears)"	224	276	250	271	22	KAENSCLLRRLAALNQKYNEAN	81.86
DP01049	Q6QCC2	Factor H-binding protein (Lipoprotein) (Lipoprotein GNA1870)	Neisseria meningitidis	101	137	104	132	29	DGQLITLESGEFQVYKQSHSALTAFQTEQ	79.01
DP01050	P0A6X3	RNA-binding protein Hfq (HF-1) (Host factor-I protein) (HF-I)	Escherichia coli (strain K12)	75	102	88	94	7	SAQNTSA	81.41
DP01051	Q7LKB1	ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3)	"Saccharomyces cerevisiae (Bakers yeast)"	1	253	9	21	13	NQQNYQQYSQNGN	86.57
DP01051	Q7LKB1	ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3)	"Saccharomyces cerevisiae (Bakers yeast)"	1	253	25	39	15	GNNRYQGYQAYNAQA	78.35
DP01051	Q7LKB1	ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3)	"Saccharomyces cerevisiae (Bakers yeast)"	1	253	42	95	54	AGGYYQNYQGYSGYQQGGYQQYNPDAGYQQQYNPQGGYQQYNPQGGYQQQFNPQ	86.72
DP01051	Q7LKB1	ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3)	"Saccharomyces cerevisiae (Bakers yeast)"	1	253	97	118	22	GRGNYKNFNYNNNLQGYQAGFQ	80.92
DP01051	Q7LKB1	ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3)	"Saccharomyces cerevisiae (Bakers yeast)"	1	253	145	159	15	KLVSSSGIKLANATK	75.52
DP01051	Q7LKB1	ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3)	"Saccharomyces cerevisiae (Bakers yeast)"	1	253	216	246	31	EDLKISESTHNTNNANVTSADALIKEQEEEV	83.26
DP01052	Q8MWS6	DNA repair enzyme	Toxoplasma gondii	283	343	287	293	7	VLPSYID	85
DP01054	Q76LA1	CSTB protein (Cystatin B) (Cystatin B (Stefin B)) (Cystatin B (Stefin B); isoform CRA_a) (Epididymis secretory sperm binding protein) (cDNA; FLJ92415; Homo sapiens cystatin B (stefin B) (CSTB); mRNA)	Homo sapiens (Human)	1	67	15	32	18	ETQHIADQVRSQLEEKEN	85.95
DP01054	Q76LA1	CSTB protein (Cystatin B) (Cystatin B (Stefin B)) (Cystatin B (Stefin B); isoform CRA_a) (Epididymis secretory sperm binding protein) (cDNA; FLJ92415; Homo sapiens cystatin B (stefin B) (CSTB); mRNA)	Homo sapiens (Human)	1	67	39	57	19	KAVSFKSQVVAGTNYFIKV	85.44
DP01055	Q8GT36	Thylakoid soluble phosphoprotein	Spinacia oleracea (Spinach)	1	103	4	20	17	LPFVFGAAASSRVVTAA	77.2
DP01055	Q8GT36	Thylakoid soluble phosphoprotein	Spinacia oleracea (Spinach)	1	103	29	43	15	KQEKSFVDWLLGKIT	82.14
DP01055	Q8GT36	Thylakoid soluble phosphoprotein	Spinacia oleracea (Spinach)	1	103	45	52	8	EDQFYETD	82.32
DP01055	Q8GT36	Thylakoid soluble phosphoprotein	Spinacia oleracea (Spinach)	1	103	79	85	7	GTVSIPS	84.62
DP01055	Q8GT36	Thylakoid soluble phosphoprotein	Spinacia oleracea (Spinach)	1	103	91	98	8	NGGVFGGL	82.27
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	11	17	7	RVEVILD	86.96
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	51	59	9	PSFAISSEG	81.12
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	88	99	12	SESLSEKQVKEA	76.92
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	102	113	12	KCKSIALLLTAA	83.58
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	119	125	7	KGVLMFK	80.22
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	130	141	12	RARKYTLVSYGT	85.01
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	161	203	43	KENTFEVSLLATSESEIDEDFFSDIDNDKKIVTFDWDSGLLEV	82.47
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	234	244	11	MDQITAEQEEM	80.94
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	257	275	19	VTVSENFQKVSSSAYQTKE	85.14
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	290	306	17	ADVSQNDGKIVQQNGFG	79.82
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	310	320	11	DTSLSFQSSEA	79.54
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	336	346	11	GVQNRAAAPFS	75.8
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	385	395	11	KAAPILWSHTE	79.39
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	428	435	8	PMFSFKEA	73.91
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	443	451	9	ALLSLVHNA	79.93
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	458	464	7	GAGFESG	75.25
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	467	481	15	EDYLSLGAEACNFMQ	78.86
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	515	522	8	PAVASNKA	76.25
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	531	537	7	PQAAYPA	79.93
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	554	560	7	NTLNLSG	79.93
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	600	607	8	GAQLFARR	97.66
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	610	630	21	RMEKYVVDSETVQANMARASS	79.82
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	649	657	9	PPVAYNPIH	76.59
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	686	693	8	GLNALDIM	80.69
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	700	708	9	LDASLFTFQ	90.9
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	728	735	8	KQATSLRL	75.92
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	746	775	30	ASSVYSVPAYSSQPSFQSNASTPVNESYTP	78.54
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	788	794	7	TSSLFTA	77.35
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	803	813	11	KAGVIAQERSS	76.8
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	833	839	7	TSPLIFQ	82.51
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	882	894	13	MQESIAANVVSAA	84.26
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	919	926	8	ASLALLGG	76.25
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	936	947	12	KSSLSVSNATTQ	75.81
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	950	959	10	SQQQYAYCSQ	79.1
DP01056	A7UMX5	Synaptopodin 2 variant	Meleagris gallopavo (Wild turkey)	1	996	975	986	12	DYGLSTADSNYN	86.45
DP01057	Q42512	Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A)	Arabidopsis thaliana (Mouse-ear cress)	41	139	44	51	8	KKSLIYAA	77.88
DP01057	Q42512	Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A)	Arabidopsis thaliana (Mouse-ear cress)	41	139	53	75	23	GDGNILDDLNEATKKASDFVTDK	78
DP01057	Q42512	Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A)	Arabidopsis thaliana (Mouse-ear cress)	41	139	89	98	10	YVVEKNSETA	73.91
DP01057	Q42512	Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A)	Arabidopsis thaliana (Mouse-ear cress)	41	139	107	115	9	KAAAYVEEK	82.16
DP01057	Q42512	Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A)	Arabidopsis thaliana (Mouse-ear cress)	41	139	122	129	8	KAAEFAEG	81.69
DP01058	Q9SIN5	Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B)	Arabidopsis thaliana (Mouse-ear cress)	41	139	45	76	32	KKSLIYAVKSDGNILDDLNEATKKASDFVTDK	78.33
DP01058	Q9SIN5	Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B)	Arabidopsis thaliana (Mouse-ear cress)	41	139	87	104	18	TKDYIVEKTIEANETATE	79.45
DP01058	Q9SIN5	Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B)	Arabidopsis thaliana (Mouse-ear cress)	41	139	108	116	9	KALDYVTEK	75.66
DP01058	Q9SIN5	Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B)	Arabidopsis thaliana (Mouse-ear cress)	41	139	123	130	8	KAAEFVEG	78.76
DP01060	A8CDV5	Latent membrane protein 2A (Fragment)	Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)	1	118	1	7	7	MGSLEMV	75.25
DP01060	A8CDV5	Latent membrane protein 2A (Fragment)	Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)	1	118	25	32	8	GGNNSQYP	74.25
DP01060	A8CDV5	Latent membrane protein 2A (Fragment)	Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)	1	118	80	89	10	QDQSLYLGLQ	77.69
DP01060	A8CDV5	Latent membrane protein 2A (Fragment)	Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)	1	118	107	113	7	SSQHIYE	81.94
DP01065	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	236	13	22	10	HMSSYVPIFE	83.01
DP01065	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	236	30	37	8	NGDNFNRT	82.94
DP01065	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	236	61	69	9	SGRNFGNRD	75.92
DP01065	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	236	95	102	8	GFSNSRFE	79.26
DP01065	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	236	213	221	9	GLNEEVITG	80.53
DP01066	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	204	13	22	10	HMSSYVPIFE	83.01
DP01066	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	204	30	37	8	NGDNFNRT	82.94
DP01066	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	204	61	69	9	SGRNFGNRD	75.92
DP01066	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	204	95	102	8	GFSNSRFE	79.26
DP01066	Q9NQI0	Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog)	Homo sapiens (Human)	1	204	179	187	9	GLNEEVITG	80.53
DP01067	P19599	Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen)	Plasmodium falciparum (isolate FC27 / Papua New Guinea)	21	238	22	40	19	NESKYSNTFINNAYNMSIR	80.44
DP01067	P19599	Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen)	Plasmodium falciparum (isolate FC27 / Papua New Guinea)	21	238	46	53	8	EGSNTNSV	75.92
DP01067	P19599	Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen)	Plasmodium falciparum (isolate FC27 / Papua New Guinea)	21	238	59	65	7	NADTIAS	83.61
DP01067	P19599	Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen)	Plasmodium falciparum (isolate FC27 / Papua New Guinea)	21	238	91	97	7	AADTIAS	86.29
DP01067	P19599	Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen)	Plasmodium falciparum (isolate FC27 / Papua New Guinea)	21	238	129	135	7	ATESISP	85.62
DP01067	P19599	Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen)	Plasmodium falciparum (isolate FC27 / Papua New Guinea)	21	238	143	151	9	ESSKFWQCT	73.58
DP01067	P19599	Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen)	Plasmodium falciparum (isolate FC27 / Papua New Guinea)	21	238	163	173	11	KQNELNESTEE	79.93
DP01068	Q9UBB5	Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2)	Homo sapiens (Human)	238	356	238	253	16	DLNTTLPIRQTASIFK	82.17
DP01068	Q9UBB5	Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2)	Homo sapiens (Human)	238	356	278	303	26	PRQLFWEKRLQGLSASDVTEQIIKTM	81.53
DP01068	Q9UBB5	Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2)	Homo sapiens (Human)	238	356	317	333	17	NDETLLSAVASALHTSS	76.79
DP01068	Q9UBB5	Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2)	Homo sapiens (Human)	238	356	338	351	14	GQVSAAVEKNPAVW	76.64
DP01069	Q6MRH6	Hit locus orf4	Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)	1	101	4	28	25	LLVLSILLTLGFSFAGTASADENAN	82.81
DP01069	Q6MRH6	Hit locus orf4	Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)	1	101	46	54	9	FEATTSALG	74.25
DP01070	P42568	Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3)	Homo sapiens (Human)	490	568	499	511	13	CDKAYLDELVELH	77.26
DP01070	P42568	Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3)	Homo sapiens (Human)	490	568	518	555	38	RERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTV	79.21
DP01070	P42568	Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3)	Homo sapiens (Human)	490	568	557	563	7	KLQSYLE	79.84
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	56	64	9	NDEEINTSP	79.82
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	79	94	16	QGGEYGGLSERDVNIP	84.32
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	160	166	7	KGVNYGG	92.98
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	176	182	7	EHQTISD	76.68
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	218	224	7	PQDTITG	73.91
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	229	236	8	VPAVIIDR	89.97
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	242	249	8	NVVASKLG	79.93
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	254	260	7	QAQESAA	75.92
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	274	292	19	TAAEYKNLVAEKLTPVYEK	78.49
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	326	342	17	GGAASNKGVFTKDYLSE	75.53
DP01071	O23764	CDet11-24 protein	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	422	353	365	13	LSQAIMEKLQLSK	76.15
DP01073	Q61548	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) (Phosphoprotein F1-20)	Mus musculus (Mouse)	623	680	633	652	20	SSGVIDLFGDAFGSGASETQ	81.61
DP01073	Q61548	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) (Phosphoprotein F1-20)	Mus musculus (Mouse)	623	680	656	675	20	QAVSSSSASADLLAGFGGSF	77.22
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	325	341	17	DKESIVLPTVGFDFIKD	75.94
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	357	365	9	AGAVFKSSV	79.78
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	380	388	9	PTLSFNFSQ	80.82
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	395	410	16	AVDNTVPSTTLFNFGG	86.62
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	413	428	16	DTVTSASQPFKFGKTS	78.32
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	444	456	13	TAPIFSFGKQEEN	80.94
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	508	516	9	PSFVFGASD	76.81
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	521	528	8	GTPLFTFG	84.87
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	531	538	8	ADVTSNID	90.72
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	540	551	12	SAQFTFGKAATA	96.71
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	569	583	15	PTFTFGQSTSENKIS	80.94
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	589	597	9	PTFSFSKSE	78.15
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	634	641	8	PTFSFTEP	81.19
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	655	665	11	PSFTFASSKTS	80.12
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	669	677	9	PLFSFGKSD	80.27
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	686	693	8	NTSFSFTK	79.26
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	706	722	17	PSFTFGGSTTNNTTTTS	77.99
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	742	761	20	AAANTEKLSNGFSFTKFNHN	82.47
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	768	778	11	PTSFFDGSASS	79.93
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	790	825	36	ATGNTTSKSAFSFGTANTNGTNASANSTSFSFNAPA	76.93
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	832	848	17	TTSNTSGTNIAGTFNVG	83.55
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	850	860	11	PDQSIASGNTN	78.47
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	862	891	30	AGSAFGFSSSGTAATGAASNQSSFNFGNNG	80.28
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	894	915	22	GLNPFTSATSSTNANAGLFNKP	82.59
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	919	937	19	NAQNVNVPSAFNFTGNNST	79.62
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	940	962	23	GGSVFNMNGNTNANTVFAGSNNQ	79.56
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	969	979	11	PSFNTNSSFTP	78.47
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	981	1003	23	TVPNINFSGLNGGITNTATNALR	80.6
DP01075	P20676	Nucleoporin NUP1 (Nuclear pore protein NUP1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	300	1076	1014	1028	15	SGSNSNVTNPSSIFG	76.1
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	10	24	15	GGSNLSFGSNTSSFG	78.1
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	31	47	17	PNSLFGNSNNNNNSTSN	79.22
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	49	137	89	AQSGFGGFTSAAGSNSNSLFGNNNTQNNGAFGQSMGATQNSPFGSLNSSNASNGNTFGGSSSMGSFGGNTNNAFNNNSNSTNSPFGFNK	78.61
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	141	178	38	GGTLFGSQNNNSAGTSSLFGGQSTSTTGTFGNTGSSFG	79.94
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	184	245	62	NGSNIFGAGNNSQSNTTGSLFGNQQSSAFGTNNQQGSLFGQQSQNTNNAFGNQNQLGGSSFG	81.66
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	251	341	91	SGSLFGQSNNTLGNTTNNRNGLFGQMNSSNQGSSNSGLFGQNSMNSSTQGVFGQNNNQMQINGNNNNSLFGKANTFSNSASGGLFGQNNQQ	79.84
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	343	396	54	GSGLFGQNSQTSGSSGLFGQNNQKQPNTFTQSNTGIGLFGQNNNQQQQSTGLFG	79.72
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	403	423	21	TGSLFGGNSSTQPNSLFGTTN	83.95
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	432	445	14	QQGNSLFGATKLTN	78.43
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	472	485	14	TGSLFGNNTASTTV	81.27
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	488	509	22	TNGLFGNNANNSTSTTNTGLFG	82.02
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	521	536	16	GGGLFGNSNSNSSTIG	82.84
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	545	582	38	TTQNTGLFGATGTNSSAVGSTGKLFGQNNNTLNVGTQN	77.59
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	590	608	19	TQNALLGTTAVPSLQQAPV	77.17
DP01076	Q02629	Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	640	610	625	16	NEQLFSKISIPNSITN	82.46
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	1	78	78	MNFNTPQQNKTPFSFGTANNNSNTTNQNSSTGAGAFGTGQSTFGFNNSAPNNTNNANSSITPAFGSNNTGNTAFGNSN	80.14
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	80	108	29	TSNVFGSNNSTTNTFGSNSAGTSLFGSSS	81.33
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	118	139	22	AGGNTFGSSSLFNNSTNSNTTK	81.48
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	143	155	13	GGLNFGGGNNTTP	82.35
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	159	186	28	GNANTSNNLFGATANANKPAFSFGATTN	79.06
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	196	209	14	PAFSFNSSVGNKTD	77.09
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	214	221	8	TTGFSFGS	75.75
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	264	288	25	PALSFGTATSDNKTTNTTPSFSFGA	73.91
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	301	307	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	320	331	12	PAFSFGAKSNED	77.48
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	339	345	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	358	364	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	377	383	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	396	402	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	415	426	12	PAFSFGAKSNED	77.48
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	434	440	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	453	459	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	472	478	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	491	497	7	PAFSFGT	75.92
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	510	516	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	529	535	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	546	554	9	SKSAFSFGS	78.08
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	565	573	9	AKAAISFGA	78.11
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	603	586	596	11	PAFTFGAQKDN	85.28
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	498	607	510	516	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	498	607	529	535	7	PAFSFGA	77.64
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	498	607	546	554	9	SKSAFSFGS	78.08
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	498	607	565	573	9	AKAAISFGA	78.11
DP01077	P14907	Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	498	607	586	596	11	PAFTFGAQKDN	85.28
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	441	449	9	SGFTFLKTQ	78.71
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	451	478	28	AAANSLQSQSSSTFGAPSFGSSAFKIDL	81.28
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	486	493	8	TGVASSEQ	77.26
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	518	525	8	STSEYAFG	86.71
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	606	637	32	SFGTSAFGTASSNETNSGSIFGKAAFGSSSFA	80.57
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	639	652	14	ANNELFGSNFTISK	80.51
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	700	722	23	KTNAFDFGSSSFGSGFSKALESV	78.25
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	724	743	20	SDTTFKFGTQASPFSSQLGN	79.38
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	746	752	7	PFSSFTK	79.93
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	809	816	8	GEVVEEEA	75.25
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	824	848	25	LTETIKKSANIDMAGLKNPVFGNHV	82.17
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	855	865	11	PFSAFATNITK	81.7
DP01078	P40477	Nucleoporin NUP159 (Nuclear pore protein NUP159)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	441	881	869	876	8	TTPAFSFG	77.42
DP01079	P40517	Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	203	43	49	7	QAEETSD	74.25
DP01079	P40517	Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	203	84	92	9	VESGIVEDD	79.93
DP01079	P40517	Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	203	94	107	14	KEDKFVFGAASKFG	82.25
DP01079	P40517	Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	203	120	128	9	GDATTSTES	77.26
DP01079	P40517	Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	203	138	157	20	KPFAFGSGLSFGSGFNILKN	80.54
DP01079	P40517	Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	203	159	166	8	TENNSESE	75.25
DP01080	Q9C1S9	Exoglucanase-6A (EC 3.2.1.91) (1;4-beta-cellobiohydrolase 6A) (Avicelase 2) (Beta-glucancellobiohydrolase 6A) (Exocellobiohydrolase 6A)	Humicola insolens (Soft-rot fungus)	44	96	52	59	8	KQNDWYSQ	88.09
DP01080	Q9C1S9	Exoglucanase-6A (EC 3.2.1.91) (1;4-beta-cellobiohydrolase 6A) (Avicelase 2) (Beta-glucancellobiohydrolase 6A) (Exocellobiohydrolase 6A)	Humicola insolens (Soft-rot fungus)	44	96	64	81	18	SQVTTTSTTSTSSSSTTS	76.44
DP01082	Q7X2A1	Immunoglobulin-like B protein	Leptospira interrogans serovar Pomona	1119	1165	1129	1160	32	QSVVSLSPTTIQVVYSESINNKEALDLSNYKI	81.52
DP01083	Q7TP21	Replication protein A subunit	Rattus norvegicus (Rat)	91	167	95	106	12	VGVKIGNPVPYN	83.61
DP01083	Q7TP21	Replication protein A subunit	Rattus norvegicus (Rat)	91	167	142	150	9	VAKAYGASK	80.6
DP01084	Q1K7R9	Replication protein A subunit	Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)	111	173	138	147	10	STGFYGVKSE	76.49
DP01085	Q9SKI4	Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A)	Arabidopsis thaliana (Mouse-ear cress)	106	193	109	118	10	GNPTIFGETD	74.85
DP01085	Q9SKI4	Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A)	Arabidopsis thaliana (Mouse-ear cress)	106	193	120	130	11	EAQKTFSGTGN	83.46
DP01085	Q9SKI4	Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A)	Arabidopsis thaliana (Mouse-ear cress)	106	193	135	151	17	NRVVFNEPMVQHSVNRA	79.42
DP01085	Q9SKI4	Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A)	Arabidopsis thaliana (Mouse-ear cress)	106	193	154	166	13	RGVNIQNQANNTP	78.39
DP01086	Q10Q08	Replication protein A 70 kDa DNA-binding subunit B (OsRPA70b) (Replication factor A protein 1B) (Replication protein A 1B)	Oryza sativa subsp. japonica (Rice)	105	180	105	117	13	LEVVFKALDSEIK	86.54
DP01086	Q10Q08	Replication protein A 70 kDa DNA-binding subunit B (OsRPA70b) (Replication factor A protein 1B) (Replication protein A 1B)	Oryza sativa subsp. japonica (Rice)	105	180	158	170	13	QEVKSASQIVNEQ	81.68
DP01087	Q1PAB4	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus 1	1	101	34	49	16	CQVCFIRKALGISYGR	83.3
DP01088	Q9XES8	Seed maturation protein PM28	Glycine max (Soybean) (Glycine hispida)	1	89	6	19	14	EDITYATSQARLSE	77.64
DP01088	Q9XES8	Seed maturation protein PM28	Glycine max (Soybean) (Glycine hispida)	1	89	43	50	8	PVDLFSSA	76.63
DP01088	Q9XES8	Seed maturation protein PM28	Glycine max (Soybean) (Glycine hispida)	1	89	56	66	11	SGQTTMDSNTS	77.53
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	3546	3795	3651	3658	8	QQAASEEE	75.25
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	3546	3795	3667	3683	17	TVVQTNEDVKEAEVPEN	76.04
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	3546	3795	3695	3716	22	LQVAASEIAHLAIDEAVLETSN	83.19
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	3546	3795	3730	3738	9	SVVHENEHV	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	3546	3795	3750	3766	17	DSEQIVSDVIVAEVGYD	81.9
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	3546	3795	3769	3790	22	ECSTIADTITSLSSSPLYTAPV	78.73
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	4654	4661	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	4693	4700	8	QPAEIVEQ	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	4705	4748	44	CEEEIKELLTEVEVELFFSQAEVFSGLELDLLMECSEYVTTSIQ	79.21
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	4776	4783	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	4814	4822	9	VQQAEIVEQ	90.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	4854	4861	8	QPAEIVEQ	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	4866	4909	44	CEEEIKELLTEVEVELFFSQAEVFSGLELDLLMECSEYVTTSIQ	79.21
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	4936	4944	9	VQQAEIIEQ	82.65
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	4975	4983	9	VQQVEIIEQ	82.39
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5014	5022	9	VQQAEIIEQ	82.65
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5053	5061	9	VQQVEIIEQ	82.39
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5092	5100	9	VQQAEIIEQ	82.65
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5131	5139	9	VQQVEIIEQ	82.39
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5171	5178	8	QPAEIVEQ	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5210	5217	8	QPAEILEQ	79.26
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5222	5265	44	CEEEIKELLTEVEVELFFSKAEVFSGLELDLLMECSEYVTTSIQ	79.38
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5293	5300	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5331	5339	9	VQQAEIIEQ	82.65
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5371	5378	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5383	5426	44	CEEEIKELLTEVEVELLFSQAEVFSGLELDLLMECSEYVTTSIQ	78.95
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5454	5461	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5492	5500	9	VQQAEIIEQ	82.65
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5532	5539	8	QPAEIVEQ	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5571	5578	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5610	5617	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5630	5638	9	VEPTIEKLA	75.47
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5649	5656	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5669	5677	9	VEPTIEKLA	75.47
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5688	5695	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5727	5734	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5766	5774	9	QPAEIVEHK	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5805	5812	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5844	5851	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5883	5890	8	QPAEIVEQ	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5922	5929	8	QPAEIVEQ	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	5961	5969	9	QPAEIVEHK	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6000	6007	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6039	6047	9	QPAEIVEHK	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6059	6067	9	VEPTIEKLA	75.47
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6078	6085	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6098	6106	9	VEPTIEKLA	75.47
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6117	6125	9	QPAEIVEHK	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6156	6163	8	QPAEIVEQ	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6168	6211	44	CEEEIKELLTEVEVELFFSQAEVFSGLELDLLMECSEYVTTSIQ	79.21
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6239	6246	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6278	6285	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6317	6324	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6356	6363	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6395	6402	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6415	6423	9	VEPTIEKLA	75.47
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6434	6441	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6454	6462	9	VEPTIEKLA	75.47
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6473	6480	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6512	6519	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6551	6559	9	QPAEIVEHK	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6590	6597	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6629	6636	8	EPAEIVEQ	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6668	6676	9	QPAEIVEHK	79.93
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6683	6689	7	TTATTFE	79.46
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6707	6714	8	QTAEIVEQ	86.96
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6746	6754	9	QQAAIVEQK	78.74
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6780	6792	13	ETSEIQTAEIVEQ	84.38
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6824	6832	9	QQAAIVEQK	78.74
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6858	6871	14	ETSEIQQAAVVEQK	78.74
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6902	6910	9	QQAAIVEQK	78.74
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6918	6930	13	NAPTFEPTVEKLA	75.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	4627	7026	6941	6949	9	QQAAIVEQK	78.74
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	7013	8512	7601	7614	14	KDDNFKQEANAKLQ	76.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	7013	8512	7625	7638	14	KDDNFKQEANAKLQ	76.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	7013	8512	8057	8070	14	KDDNFKQEANAKLQ	76.59
DP01090	G4SLH0	Titin homolog (EC 2.7.11.1)	Caenorhabditis elegans	7013	8512	8492	8507	16	NQSRIFEETSIEVTSL	77.59
DP01092	O66683	Anti sigma factor FlgM	Aquifex aeolicus (strain VF5)	5	88	7	19	13	LSRLIGLLLETEK	77.51
DP01092	O66683	Anti sigma factor FlgM	Aquifex aeolicus (strain VF5)	5	88	38	54	17	TLSKIAQELSKNDVEEK	79.91
DP01092	O66683	Anti sigma factor FlgM	Aquifex aeolicus (strain VF5)	5	88	63	76	14	LKEKIEKGEYEVSD	74.96
DP01094	Q9BP37	Aragonite protein AP7	Haliotis rufescens (California red abalone)	23	52	24	47	24	DNGNYGNGMASVRTQGNTYDDLAS	82.61
DP01094	Q9BP37	Aragonite protein AP7	Haliotis rufescens (California red abalone)	56	88	62	72	11	HECALCYSITD	77.93
DP01095	Q9BP38	Aragonite protein AP24	Haliotis rufescens (California red abalone)	25	54	34	46	13	GLCNQYNQNVTTR	80.81
DP01097	P61244	Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X)	Homo sapiens (Human)	81	102	81	92	12	RQNALLEQQVRA	79.77
DP01097	P61244	Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X)	Homo sapiens (Human)	93	150	100	107	8	AQLQTNYP	85.2
DP01097	P61244	Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X)	Homo sapiens (Human)	93	150	110	126	17	DNSLYTNAKGSTISAFD	87.19
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	5	19	15	RQEFEVMEDHAGTYG	81.14
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	25	31	7	DQGGYTM	75.82
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	256	267	12	VKSKIGSTENLK	74.58
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	273	280	8	GKVQIINK	95.74
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	304	312	9	GSVQIVYKP	77.15
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	350	362	13	VQSKIGSLDNITH	82.04
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	374	381	8	HKLTFREN	74.58
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	388	396	9	HGAEIVYKS	78.97
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	413	419	7	STGSIDM	75.59
DP01100	P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	Homo sapiens (Human)	1	441	424	436	13	QLATLADEVSASL	76.69
DP01101	P04370	Myelin basic protein (MBP) (Myelin A1 protein)	Mus musculus (Mouse)	1	169	9	21	13	QRSKYLATASTMD	80.19
DP01101	P04370	Myelin basic protein (MBP) (Myelin A1 protein)	Mus musculus (Mouse)	1	169	36	46	11	ILDSIGRFFSG	75.19
DP01101	P04370	Myelin basic protein (MBP) (Myelin A1 protein)	Mus musculus (Mouse)	1	169	83	92	10	PVVHFFKNIV	86.76
DP01101	P04370	Myelin basic protein (MBP) (Myelin A1 protein)	Mus musculus (Mouse)	1	169	106	116	11	GLSLSRFSWGA	76.28
DP01101	P04370	Myelin basic protein (MBP) (Myelin A1 protein)	Mus musculus (Mouse)	1	169	139	156	18	FKGAYDAQGTLSKIFKLG	78.99
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	2	18	17	ASNDYTQQATQSYGAYP	79.22
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	22	70	49	GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS	79.75
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	87	98	12	SQSSYGQQSSYP	84.81
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	126	151	26	QSGSYSQQPSYGGQQQSYGQQQSYNP	83.39
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	156	165	10	GQQNQYNSSS	86.42
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	173	184	12	GGGNYGQDQSSM	80.6
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	228	236	9	GGGGYNRSS	75.25
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	260	266	7	GGFNKFG	86.24
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	282	314	33	SDNNTIFVQGLGENVTIESVADYFKQIGIIKTN	81.78
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	318	327	10	GQPMINLYTD	81.74
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	347	360	14	AKAAIDWFDGKEFS	89.18
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	364	371	8	IKVSFATR	80.94
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	526	432	446	15	TCENMNFSWRNECNQ	82.32
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	2	18	17	ASNDYTQQATQSYGAYP	79.22
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	22	70	49	GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS	79.75
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	87	98	12	SQSSYGQQSSYP	84.81
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	126	151	26	QSGSYSQQPSYGGQQQSYGQQQSYNP	83.39
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	156	165	10	GQQNQYNSSS	86.42
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	173	184	12	GGGNYGQDQSSM	80.6
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	228	236	9	GGGGYNRSS	75.25
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	260	266	7	GGFNKFG	86.24
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	282	314	33	SDNNTIFVQGLGENVTIESVADYFKQIGIIKTN	81.78
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	318	327	10	GQPMINLYTD	81.74
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	347	360	14	AKAAIDWFDGKEFS	89.18
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	364	371	8	IKVSFATR	80.94
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	507	432	446	15	TCENMNFSWRNECNQ	82.32
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	2	18	17	ASNDYTQQATQSYGAYP	79.22
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	22	70	49	GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS	79.75
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	87	98	12	SQSSYGQQSSYP	84.81
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	126	151	26	QSGSYSQQPSYGGQQQSYGQQQSYNP	83.39
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	156	165	10	GQQNQYNSSS	86.42
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	173	184	12	GGGNYGQDQSSM	80.6
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	228	236	9	GGGGYNRSS	75.25
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	260	266	7	GGFNKFG	86.24
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	282	314	33	SDNNTIFVQGLGENVTIESVADYFKQIGIIKTN	81.78
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	318	327	10	GQPMINLYTD	81.74
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	347	360	14	AKAAIDWFDGKEFS	89.18
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	422	364	371	8	IKVSFATR	80.94
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	214	2	18	17	ASNDYTQQATQSYGAYP	79.22
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	214	22	70	49	GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS	79.75
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	214	87	98	12	SQSSYGQQSSYP	84.81
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	214	126	151	26	QSGSYSQQPSYGGQQQSYGQQQSYNP	83.39
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	214	156	165	10	GQQNQYNSSS	86.42
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	214	173	184	12	GGGNYGQDQSSM	80.6
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	163	2	18	17	ASNDYTQQATQSYGAYP	79.22
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	163	22	70	49	GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS	79.75
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	163	87	98	12	SQSSYGQQSSYP	84.81
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	1	163	126	151	26	QSGSYSQQPSYGGQQQSYGQQQSYNP	83.39
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	2	36	2	18	17	ASNDYTQQATQSYGAYP	79.22
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	2	36	22	31	10	GQGYSQQSSQ	80.27
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	39	95	51	70	20	GQSSYSSYGQSQNTGYGTQS	78.56
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	98	214	126	151	26	QSGSYSQQPSYGGQQQSYGQQQSYNP	83.39
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	98	214	156	165	10	GQQNQYNSSS	86.42
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	98	214	173	184	12	GGGNYGQDQSSM	80.6
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	285	370	293	314	22	GENVTIESVADYFKQIGIIKTN	79.23
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	285	370	318	327	10	GQPMINLYTD	81.74
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	285	370	347	360	14	AKAAIDWFDGKEFS	89.18
DP01102	P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	Homo sapiens (Human)	421	455	432	446	15	TCENMNFSWRNECNQ	82.32
DP01103	Q13698	Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1)	Homo sapiens (Human)	665	785	667	673	7	AESLTSA	82.27
DP01103	Q13698	Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1)	Homo sapiens (Human)	665	785	718	732	15	AKLKIDEFESNVNEV	79.55
DP01103	Q13698	Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1)	Homo sapiens (Human)	665	785	769	780	12	KAVPIPEASSFF	81.22
DP01103	Q13698	Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1)	Homo sapiens (Human)	666	791	667	673	7	AESLTSA	82.27
DP01103	Q13698	Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1)	Homo sapiens (Human)	666	791	718	732	15	AKLKIDEFESNVNEV	79.55
DP01103	Q13698	Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1)	Homo sapiens (Human)	666	791	769	786	18	KAVPIPEASSFFIFSPTN	79.9
DP01104	P46531	Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD)	Homo sapiens (Human)	1758	1888	1764	1771	8	HGQLWFPE	95.53
DP01104	P46531	Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD)	Homo sapiens (Human)	1758	1888	1840	1849	10	HRQWTQQHLD	76.96
DP01105	P20444	Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13)	Mus musculus (Mouse)	606	672	622	633	12	GAENFDKFFTRG	80.82
DP01105	P20444	Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13)	Mus musculus (Mouse)	606	672	641	667	27	DQLVIANIDQSDFEGFSYVNPQFVHPI	83.22
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	236	268	33	TVWISVAVLSAVICLIIVWAVALKGYSMVTCIF	84.24
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	279	286	8	FDAHLLEK	73.91
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	289	302	14	SEELLSALGCQDFP	76.47
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	310	317	8	LLVEYLEV	82.48
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	321	331	11	EDQHLMSVHSK	75.25
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	370	382	13	NPSTFYDPEVIEK	80.6
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	394	407	14	PQCISMEGKIPYFH	75.78
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	429	441	13	SYHNITDVCELAV	78.03
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	477	487	11	REVESFHSETD	75.92
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	508	514	7	DYVEIHK	87.29
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	519	525	7	GALSLLP	79.26
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	553	559	7	MDNNILV	83.52
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	568	576	9	NVACFEESA	79.41
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	598	583	593	11	LEQNQAEKALA	77.47
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	396	236	268	33	TVWISVAVLSAVICLIIVWAVALKGYSMVTCIF	84.24
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	396	279	286	8	FDAHLLEK	73.91
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	396	289	302	14	SEELLSALGCQDFP	76.47
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	396	310	317	8	LLVEYLEV	82.48
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	396	321	331	11	EDQHLMSVHSK	75.25
DP01106	P16471	Prolactin receptor (PRL-R)	Homo sapiens (Human)	236	396	370	382	13	NPSTFYDPEVIEK	80.6
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	1	10	10	MSEYIRVTED	84.28
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	12	19	8	NDEPIEIP	74.58
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	24	36	13	GTVLLSTVTAQFP	79.93
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	56	62	7	LVEGILH	79.93
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	67	76	10	GWGNLVYVVN	87.56
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	99	116	18	AVQKTSDLIVLGLPWKTT	79.86
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	119	142	24	DLKEYFSTFGEVLMVQVKKDLKTG	85.93
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	145	162	18	KGFGFVRFTEYETQVKVM	78.35
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	206	223	18	ELREFFSQYGDVMDVFIP	87.22
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	225	261	37	PFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAE	83.11
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	285	293	9	NQGGFGNSR	74.58
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	309	320	12	GGMNFGAFSINP	92.06
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	326	336	11	AQAALQSSWGM	80.27
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	338	347	10	GMLASQQNQS	74.98
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	363	390	28	PNQAFGSGNNSYSGSNSGAAIGWGSASN	76.19
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	1	414	400	409	10	GFGSSMDSKS	74.25
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	263	414	285	293	9	NQGGFGNSR	74.58
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	263	414	309	320	12	GGMNFGAFSINP	92.06
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	263	414	326	336	11	AQAALQSSWGM	80.27
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	263	414	338	347	10	GMLASQQNQS	74.98
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	263	414	363	390	28	PNQAFGSGNNSYSGSNSGAAIGWGSASN	76.19
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	263	414	400	409	10	GFGSSMDSKS	74.25
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	266	414	285	293	9	NQGGFGNSR	74.58
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	266	414	309	320	12	GGMNFGAFSINP	92.06
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	266	414	326	336	11	AQAALQSSWGM	80.27
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	266	414	338	347	10	GMLASQQNQS	74.98
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	266	414	363	390	28	PNQAFGSGNNSYSGSNSGAAIGWGSASN	76.19
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	266	414	400	409	10	GFGSSMDSKS	74.25
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	267	414	285	293	9	NQGGFGNSR	74.58
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	267	414	309	320	12	GGMNFGAFSINP	92.06
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	267	414	326	336	11	AQAALQSSWGM	80.27
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	267	414	338	347	10	GMLASQQNQS	74.98
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	267	414	363	390	28	PNQAFGSGNNSYSGSNSGAAIGWGSASN	76.19
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	267	414	400	409	10	GFGSSMDSKS	74.25
DP01108	Q13148	TAR DNA-binding protein 43 (TDP-43)	Homo sapiens (Human)	321	343	326	336	11	AQAALQSSWGM	80.27
DP01109	P22626	Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1)	Homo sapiens (Human)	190	341	203	211	9	RGGNFGFGD	77.26
DP01109	P22626	Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1)	Homo sapiens (Human)	190	341	286	314	29	GYDNYGGGNYGSGNYNDFGNYNQQPSNYG	87.71
DP01110	Q9UHD9	Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2)	Homo sapiens (Human)	450	624	451	477	27	AMQALMQIQQGLQTLATEAPGLIPSFT	77.55
DP01110	Q9UHD9	Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2)	Homo sapiens (Human)	450	624	556	570	15	NQQFIQQMVQALAGA	81.98
DP01110	Q9UHD9	Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2)	Homo sapiens (Human)	450	624	578	619	42	PEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLL	79.06
DP01113	D0PV95	ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1)	Caenorhabditis elegans	1	168	12	23	12	GNAALNRGGRYV	76.25
DP01113	D0PV95	ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1)	Caenorhabditis elegans	1	168	91	101	11	RDRNYEDRGYN	80.6
DP01113	D0PV95	ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1)	Caenorhabditis elegans	1	168	119	126	8	GGGGYNRQ	75.25
DP01113	D0PV95	ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1)	Caenorhabditis elegans	1	168	132	145	14	GSSNFSRGGYNNRD	88.63
DP01113	D0PV95	ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1)	Caenorhabditis elegans	1	168	153	159	7	SGRSYNN	75.92
DP01116	Q03164	Histone-lysine N-methyltransferase 2A (Lysine N-methyltransferase 2A) (EC 2.1.1.354) (ALL-1) (CXXC-type zinc finger protein 7) (Cysteine methyltransferase KMT2A) (EC 2.1.1.-) (Myeloid/lymphoid or mixed-lineage leukemia) (Myeloid/lymphoid or mixed-lineage leukemia protein 1) (Trithorax-like protein) (Zinc finger protein HRX) Cleaved into: MLL cleavage product N320 (N-terminal cleavage product of 320 kDa) (p320); MLL cleavage product C180 (C-terminal cleavage product of 180 kDa) (p180)	Homo sapiens (Human)	140	160	144	152	9	EDEQFLGFG	79.12
DP01117	O60566	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta (EC 2.7.11.1) (MAD3/BUB1-related protein kinase) (hBUBR1) (Mitotic checkpoint kinase MAD3L) (Protein SSK1)	Homo sapiens (Human)	20	42	20	28	9	DEWELSKEN	79.26
DP01118	Q12834	Cell division cycle protein 20 homolog (p55CDC)	Homo sapiens (Human)	81	164	85	99	15	AAQMEVASFLLSKEN	77.75
DP01118	Q12834	Cell division cycle protein 20 homolog (p55CDC)	Homo sapiens (Human)	81	164	112	135	24	HQKAWALNLNGFDVEEAKILRLSG	81.56
DP01118	Q12834	Cell division cycle protein 20 homolog (p55CDC)	Homo sapiens (Human)	81	164	143	154	12	GYQNRLKVLYSQ	79.77
DP01119	P35222	Catenin beta-1 (Beta-catenin)	Homo sapiens (Human)	1	137	21	48	28	AVSHWQQQSYLDSGIHSGATTTAPSLSG	85.2
DP01119	P35222	Catenin beta-1 (Beta-catenin)	Homo sapiens (Human)	1	137	60	76	17	SQVLYEWEQGFSQSFTQ	80.54
DP01119	P35222	Catenin beta-1 (Beta-catenin)	Homo sapiens (Human)	1	137	78	89	12	QVADIDGQYAMT	76.37
DP01119	P35222	Catenin beta-1 (Beta-catenin)	Homo sapiens (Human)	19	44	21	39	19	AVSHWQQQSYLDSGIHSGA	85
DP01119	P35222	Catenin beta-1 (Beta-catenin)	Homo sapiens (Human)	683	781	688	694	7	MAWNETA	75.59
DP01119	P35222	Catenin beta-1 (Beta-catenin)	Homo sapiens (Human)	683	781	769	776	8	GDSNQLAW	79.89
DP01119	P35222	Catenin beta-1 (Beta-catenin)	Homo sapiens (Human)	687	781	688	694	7	MAWNETA	75.59
DP01119	P35222	Catenin beta-1 (Beta-catenin)	Homo sapiens (Human)	687	781	769	776	8	GDSNQLAW	79.89
DP01119	P35222	Catenin beta-1 (Beta-catenin)	Homo sapiens (Human)	692	781	769	776	8	GDSNQLAW	79.89
DP01126	O43561	Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38)	Homo sapiens (Human)	28	233	36	46	11	YDSTSSDSLYP	82.82
DP01126	O43561	Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38)	Homo sapiens (Human)	28	233	105	119	15	NSVASYENEGASGIR	76.19
DP01126	O43561	Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38)	Homo sapiens (Human)	28	233	161	167	7	YLVVLPD	77.26
DP01126	O43561	Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38)	Homo sapiens (Human)	28	233	188	204	17	RDSAFSMESIDDYVNVP	80.62
DP01126	O43561	Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38)	Homo sapiens (Human)	28	233	207	225	19	GESAEASLDGSREYVNVSQ	75.02
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	608	616	9	QKAEYSKYE	82.39
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	625	633	9	PQSLEMMAI	74.43
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	650	661	12	KMTTFQDSELSG	76.09
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	663	669	7	LQAALSG	76.21
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	726	733	8	RSQEYLLD	80.69
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	831	839	9	RGFAYVLPQ	79.6
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	883	891	9	SLNRYAASD	82.94
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	904	911	8	AAGPYATV	79.26
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	959	965	7	ASANLAD	77.26
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1001	1015	15	SVKSIAAMLELSSIG	78.22
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1039	1048	10	GRVATVLASV	79.67
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1071	1078	8	VTGLLATA	80.69
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1120	1126	7	EASATLK	75.25
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1137	1146	10	ENVKFILTES	80.9
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1167	1178	12	PLSVYQNGTATI	80.1
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1290	1296	7	GLQSSSA	75.25
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1309	1315	7	PAALIKP	79.93
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1370	1390	21	KLEETSACLAAALQAVEEKIR	76.33
DP01127	Q8VHK2	Caskin-1 (CASK-interacting protein 1)	Rattus norvegicus (Rat)	603	1430	1406	1419	14	STGSILEDIGSMFD	76.06
DP01128	O43806	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) (Fragment)	Homo sapiens (Human)	25	93	28	34	7	ACRNLFG	75.35
DP01128	O43806	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) (Fragment)	Homo sapiens (Human)	25	93	56	68	13	SQRKWNFDFQNHK	80.55
DP01128	O43806	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) (Fragment)	Homo sapiens (Human)	25	93	70	81	12	LEGKYEWQEVEK	75.42
DP01131	O14558	Heat shock protein beta-6 (HspB6) (Heat shock 20 kDa-like protein p20)	Homo sapiens (Human)	1	56	29	46	18	FDQRFGEGLLEAELAALC	75.75
DP01133	Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	Homo sapiens (Human)	216	302	239	276	38	GDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSD	78.81
DP01133	Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	Homo sapiens (Human)	216	302	278	297	20	DDEVYQVTVYQAGESDTDSF	79.41
DP01134	P10071	Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83)	Homo sapiens (Human)	106	236	106	112	7	GTVFAMD	77.07
DP01134	P10071	Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83)	Homo sapiens (Human)	106	236	158	166	9	MTSALSSSP	73.91
DP01134	P10071	Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83)	Homo sapiens (Human)	106	236	196	206	11	YINPYMDYIRS	78.66
DP01134	P10071	Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83)	Homo sapiens (Human)	106	236	212	220	9	SLSMISATR	77.93
DP01135	P40019	Histone H2A.Z-specific chaperone CHZ1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	153	91	104	14	DLAEIDTSNIITSG	81.87
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	164	18	28	11	NAENNNNSNAA	78.72
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	164	36	54	19	AEQTRNITVSIQYSYFTPE	87.1
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	164	56	73	18	LAHLSNISNNDNNENNSA	79.43
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	164	75	83	9	SGSTIANGT	86.62
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	164	98	106	9	GALVLSFRD	81.27
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	164	115	136	22	RLNSFISVAAQLAMERFNRLLN	82.12
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	164	151	157	7	VLQVSDL	75.59
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	300	316	17	VAANEAAFERIRRVLYD	83.93
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	318	329	12	TAVNSTNENSSA	76.98
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	331	347	17	SENTSNTTVPTIGNASS	75.23
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	354	361	8	RTGFFLVP	78.05
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	412	421	10	PLTLFQFHSP	77.46
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	441	447	7	NSNNTSS	76.92
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	460	469	10	VLDHIFNVAQ	82.78
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	501	518	18	QGSSFLENISRLTGHFTN	78.87
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	525	531	7	NDNNHSN	74.25
DP01136	P22470	Protein SAN1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	281	610	540	576	37	GENNRNNLFSSGVASYRNQNGDVTTVELRNNNSAAFP	77.88
DP01137	Q6FI81	Anamorsin (Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog)	Homo sapiens (Human)	173	266	174	180	7	LKLSITK	77.26
DP01137	Q6FI81	Anamorsin (Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog)	Homo sapiens (Human)	173	266	194	204	11	AAKLWTLSAND	84.92
DP01137	Q6FI81	Anamorsin (Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog)	Homo sapiens (Human)	173	266	209	220	12	SMDLIDSDELLD	78.6
DP01139	A0A0G2JXC5	Myocardin-related transcription factor A	Rattus norvegicus (Rat)	85	116	89	97	9	KNVLQLKLQ	76.14
DP01140	P38293	Proteasome maturation factor UMP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	148	19	25	7	KSVLSSA	79.93
DP01140	P38293	Proteasome maturation factor UMP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	148	56	64	9	TLKNWETTQ	76.48
DP01140	P38293	Proteasome maturation factor UMP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	148	71	80	10	QYRQIFGIAE	87.19
DP01140	P38293	Proteasome maturation factor UMP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	148	86	133	48	MEMEIVNRTDFNPLSTNGSIHRDILLNKECSIDWEDVYPGTGLQASTM	77.95
DP01140	P38293	Proteasome maturation factor UMP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	84	19	25	7	KSVLSSA	79.93
DP01140	P38293	Proteasome maturation factor UMP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	84	56	64	9	TLKNWETTQ	76.48
DP01140	P38293	Proteasome maturation factor UMP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	84	71	79	9	QYRQIFGIA	87.07
DP01141	P70604	Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2)	Rattus norvegicus (Rat)	396	424	406	412	7	HVHNFMM	87.96
DP01141	P70604	Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2)	Rattus norvegicus (Rat)	436	487	452	466	15	HQRKFLQAIHQLRSV	77.84
DP01141	P70604	Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2)	Rattus norvegicus (Rat)	436	487	475	482	8	DQANTLVD	79.93
DP01142	O92972	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (strain HC-J4) (HCV)	191	447	196	222	27	NVSGIYHVTNDCSNSSIVYEAADVIMH	81.52
DP01142	O92972	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (strain HC-J4) (HCV)	191	447	261	277	17	HVDLLVGTAAFCSAMYV	77
DP01142	O92972	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (strain HC-J4) (HCV)	191	447	280	292	13	LCGSIFLVSQLFT	86.75
DP01142	O92972	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (strain HC-J4) (HCV)	191	447	304	310	7	CNCSIYP	89.68
DP01142	O92972	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (strain HC-J4) (HCV)	191	447	322	328	7	MMMNWSP	74.49
DP01142	O92972	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (strain HC-J4) (HCV)	191	447	331	341	11	ALVVSQLLRIP	79.17
DP01142	O92972	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (strain HC-J4) (HCV)	191	447	349	381	33	AGAHWGVLAGLAYYSMVGNWAKVLIVALLFAGV	82.79
DP01142	O92972	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (strain HC-J4) (HCV)	191	447	397	442	46	SGFTSLFSSGASQKIQLVNTNGSWHINRTALNCNDSLQTGFFAALF	83.63
DP01144	P08008	Outer membrane virulence protein YopE	Yersinia pseudotuberculosis serotype I (strain IP32953)	1	100	2	11	10	KISSFISTSL	80.97
DP01144	P08008	Outer membrane virulence protein YopE	Yersinia pseudotuberculosis serotype I (strain IP32953)	1	100	32	44	13	SQQTSDQYANNLA	79.57
DP01144	P08008	Outer membrane virulence protein YopE	Yersinia pseudotuberculosis serotype I (strain IP32953)	1	100	55	82	28	LASRIIERLSSVAHSVIGFIQRMFSEGS	82.74
DP01146	O34800	Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB)	Bacillus subtilis (strain 168)	1	56	1	9	9	MERAFQNRC	79.93
DP01146	O34800	Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB)	Bacillus subtilis (strain 168)	1	56	26	51	26	TSVASYQVSPHTARIFKENERLIDEY	79.91
DP01146	O34800	Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB)	Bacillus subtilis (strain 168)	9	52	26	47	22	TSVASYQVSPHTARIFKENERL	79.9
DP01146	O34800	Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB)	Bacillus subtilis (strain 168)	13	53	26	48	23	TSVASYQVSPHTARIFKENERLI	79.9
DP01147	Q9I322	Type III secretion regulatory protein ExsE	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	81	2	8	7	KIESISP	87.29
DP01147	Q9I322	Type III secretion regulatory protein ExsE	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	81	43	49	7	GLARWLA	79.36
DP01147	Q9I322	Type III secretion regulatory protein ExsE	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	81	58	66	9	SEQALQRLA	74.36
DP01148	A0A068MVV3	Glutamine synthetase inactivating factor IF7	Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714))	1	65	4	12	9	QQQARALMM	73.91
DP01148	A0A068MVV3	Glutamine synthetase inactivating factor IF7	Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714))	1	65	14	20	7	HHQFIKN	84.09
DP01148	A0A068MVV3	Glutamine synthetase inactivating factor IF7	Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714))	1	65	22	45	24	QQSLLSRAAAEIGVQAEKDFWTTV	82.97
DP01149	Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa	Homo sapiens (Human)	1	150	11	18	8	TMQVSFVC	93.81
DP01149	Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa	Homo sapiens (Human)	1	150	29	50	22	TSFKILDRVTIQELTAPLLTTA	79.4
DP01149	Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa	Homo sapiens (Human)	1	150	66	72	7	EEPFIET	73.91
DP01149	Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa	Homo sapiens (Human)	1	150	93	105	13	SANSFTLIGEASD	86.26
DP01149	Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa	Homo sapiens (Human)	1	150	108	114	7	TMENLSR	76.92
DP01149	Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa	Homo sapiens (Human)	1	150	119	128	10	TGDLFDIMSG	84.01
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	139	1	30	30	MRHIICHGGVITEEMAASLLDQLIEEVLAD	80.52
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	139	43	53	11	LHELYDLDVTA	90.97
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	139	61	67	7	AVSQIFP	87
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	139	74	83	10	VQEGIDLLTF	81.24
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	139	116	127	12	VPEVIDLTCHEA	74.5
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	91	1	30	30	MRHIICHGGVITEEMAASLLDQLIEEVLAD	80.52
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	91	43	53	11	LHELYDLDVTA	90.97
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	91	61	67	7	AVSQIFP	87
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	91	74	83	10	VQEGIDLLTF	81.24
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	36	1	30	30	MRHIICHGGVITEEMAASLLDQLIEEVLAD	80.52
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	27	91	43	53	11	LHELYDLDVTA	90.97
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	27	91	61	67	7	AVSQIFP	87
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	27	91	74	83	10	VQEGIDLLTF	81.24
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	36	91	43	53	11	LHELYDLDVTA	90.97
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	36	91	61	67	7	AVSQIFP	87
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	36	91	74	83	10	VQEGIDLLTF	81.24
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	53	91	61	67	7	AVSQIFP	87
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	53	91	74	83	10	VQEGIDLLTF	81.24
DP01150	P03255	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	106	139	116	127	12	VPEVIDLTCHEA	74.5
DP01151	P03259	Early E1A protein (Early E1A 29.5 kDa protein)	Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12)	1	266	7	14	8	PLVLSYQE	76.46
DP01151	P03259	Early E1A protein (Early E1A 29.5 kDa protein)	Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12)	1	266	18	30	13	ILEHLVDNFFNEV	87.81
DP01151	P03259	Early E1A protein (Early E1A 29.5 kDa protein)	Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12)	1	266	33	52	20	DDDLYVPSLYELYDLDVESA	87.53
DP01151	P03259	Early E1A protein (Early E1A 29.5 kDa protein)	Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12)	1	266	54	79	26	EDNNEQAVNEFFPESLILAASEGLFL	78.6
DP01151	P03259	Early E1A protein (Early E1A 29.5 kDa protein)	Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12)	1	266	105	112	8	MDLLCYEM	81.73
DP01151	P03259	Early E1A protein (Early E1A 29.5 kDa protein)	Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12)	1	266	130	140	11	HVSASAAAAAA	76.59
DP01151	P03259	Early E1A protein (Early E1A 29.5 kDa protein)	Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12)	1	266	176	191	16	CSLCYLRAYNMFIYSP	82.04
DP01151	P03259	Early E1A protein (Early E1A 29.5 kDa protein)	Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12)	1	266	237	249	13	AVESILDLIQEEE	78.08
DP01152	Q9JK11	Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein)	Rattus norvegicus (Rat)	544	725	544	569	26	TGTKIAYETKVDLVQTSEAIQESLYP	81.23
DP01152	Q9JK11	Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein)	Rattus norvegicus (Rat)	544	725	590	602	13	DIVMEAPLNSLLP	75.92
DP01152	Q9JK11	Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein)	Rattus norvegicus (Rat)	544	725	641	649	9	MNVALKALG	74.58
DP01152	Q9JK11	Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein)	Rattus norvegicus (Rat)	544	725	662	682	21	AAVQETEAPYISIACDLIKET	78.34
DP01152	Q9JK11	Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein)	Rattus norvegicus (Rat)	544	725	691	705	15	DFSNYSEIAKFEKSV	81.2
DP01153	P9WI73	Serine/threonine-protein kinase PknG (EC 2.7.11.1)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	75	19	27	9	AQTATSATV	78.71
DP01153	P9WI73	Serine/threonine-protein kinase PknG (EC 2.7.11.1)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	75	32	38	7	TQAVFRP	81.61
DP01154	P19594	2S albumin (GM2S-1) (Napin-type 2S albumin 3) Cleaved into: 2S albumin small chain (Aspartic acid-rich peptide) (Lunasin); 2S albumin large chain (8 kDa methionine-rich protein) (8 kDa MRP)	Glycine max (Soybean) (Glycine hispida)	22	64	36	42	7	QGVNLTP	76.88
DP01155	O66858	RNA polymerase sigma factor RpoN	Aquifex aeolicus (strain VF5)	1	60	3	54	52	NQRLEVRQKLNLKLLLKQDLELLTYQTQELEKLIHEEVLVNPLIKGVFKKIP	77.91
DP01156	P07305	"Histone H1.0 (Histone H1) (Histone H1(0)) Cleaved into: Histone H1.0; N-terminally processed"	Homo sapiens (Human)	1	22	1	8	8	MTENSTSA	73.91
DP01157	P04908	Histone H2A type 1-B/E (Histone H2A.2) (Histone H2A/a) (Histone H2A/m)	Homo sapiens (Human)	98	130	106	118	13	GGVLPNIQAVLLP	79.52
DP01159	A6NF83	Nuclear protein 2 (Nuclear transcriptional regulator 1-like protein) (Nuclear transcriptional regulator protein 2)	Homo sapiens (Human)	1	97	24	39	16	YEEELYDCLDYYYLRD	82.36
DP01159	A6NF83	Nuclear protein 2 (Nuclear transcriptional regulator 1-like protein) (Nuclear transcriptional regulator protein 2)	Homo sapiens (Human)	1	97	72	80	9	VAQKLLNGQ	79.78
DP01160	P9WPI9	Tyrosine-protein kinase PtkA (EC 2.7.10.-) (Protein tyrosine kinase A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	81	37	54	18	GSGLSNRFVNDNGIVTDT	77.31
DP01161	Q9UMS4	Pre-mRNA-processing factor 19 (EC 2.3.2.27) (Nuclear matrix protein 200) (PRP19/PSO4 homolog) (hPso4) (RING-type E3 ubiquitin transferase PRP19) (Senescence evasion factor)	Homo sapiens (Human)	169	194	169	186	18	TPEIIQKLQDKATVLTTE	78.26
DP01162	Q96SD1	Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein)	Homo sapiens (Human)	480	575	486	508	23	VPQWEVFFKRNDEITDESLENFP	82.46
DP01162	Q96SD1	Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein)	Homo sapiens (Human)	480	575	539	546	8	QSTHITEQ	74.58
DP01162	Q96SD1	Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein)	Homo sapiens (Human)	480	575	556	563	8	DTVLLSSQ	80.31
DP01163	O14974	Protein phosphatase 1 regulatory subunit 12A (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (Protein phosphatase myosin-binding subunit)	Homo sapiens (Human)	1	40	14	23	10	LKRWIGSETD	79.93
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	346	356	11	AVGPYIQSSTM	77.17
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	374	382	9	GSLVIQASE	80.68
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	417	423	7	NADLFPS	79.93
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	488	497	10	AQVANKNVAK	75.25
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	507	518	12	KQINLPYFGQTN	76.03
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	530	540	11	SQQLSTVVPSM	80.02
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	603	615	13	TVAASSIYSMYTQ	84.64
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	625	633	9	QAVQSALTK	79
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	641	657	17	FSSVYGKPVIAAAQNQQ	78.73
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	331	692	659	668	10	HPENIYSNSQ	80.67
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	693	918	701	710	10	KLLPFLSNPY	79.26
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	693	918	734	740	7	KRSSITE	74.25
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	693	918	745	767	23	NGPNIQKLLYQRTTIAAMETISV	78.86
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	693	918	774	794	21	SASVTASSESPVEIQNPYLHV	77.75
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	693	918	798	804	7	KEVVSLV	77.78
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	693	918	815	822	8	NASTENSD	79.93
DP01164	Q13625	Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)	Homo sapiens (Human)	693	918	858	866	9	VLDVYLEEY	83.61
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	148	2	34	33	QIQSFYHSASLKTQEAFKSLQKTLYNGMQILSG	79.09
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	148	46	54	9	RPEIIVLRE	80.94
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	148	58	64	7	TWGNYLQ	80.46
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	148	72	93	22	SLHNLYNLQRDLLTVAATVLGK	82.58
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	148	95	110	16	DPVLTSMANQMELAKV	75.25
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	148	128	139	12	KKNLIELIAART	92.92
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	29	168	46	54	9	RPEIIVLRE	80.94
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	29	168	58	64	7	TWGNYLQ	80.46
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	29	168	72	93	22	SLHNLYNLQRDLLTVAATVLGK	82.58
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	29	168	95	110	16	DPVLTSMANQMELAKV	75.25
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	29	168	128	139	12	KKNLIELIAART	92.92
DP01166	O30916	Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	29	168	154	163	10	AAVAFRDAQV	88.26
DP01167	P02730	Band 3 anion transport protein (Anion exchange protein 1) (AE 1) (Anion exchanger 1) (Solute carrier family 4 member 1) (CD antigen CD233)	Homo sapiens (Human)	1	54	12	23	12	MEENLEQEEYED	76.42
DP01169	P24255	RNA polymerase sigma-54 factor	Escherichia coli (strain K12)	1	105	4	16	13	GLQLRLSQQLAMT	75.77
DP01169	P24255	RNA polymerase sigma-54 factor	Escherichia coli (strain K12)	1	105	19	57	39	LQQAIRLLQLSTLELQQELQQALESNPLLEQIDTHEEID	78.81
DP01169	P24255	RNA polymerase sigma-54 factor	Escherichia coli (strain K12)	1	105	70	78	9	ADALEQKEM	79.93
DP01169	P24255	RNA polymerase sigma-54 factor	Escherichia coli (strain K12)	1	105	84	95	12	LDASWDTIYTAG	79.88
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	442	453	12	NPTNIQNFQLPP	77.62
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	462	488	27	NGQLLMIPQQALAQMQAQAHAQPQTTM	75.82
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	501	507	7	VQISTVQ	79.93
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	549	571	23	QLVLGGAAQTASLGTATAVQTGT	75.25
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	595	607	13	KCKNFLSTLIKLA	77.77
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	618	657	40	ANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFL	79.49
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	670	679	10	DSAAFIQQSQ	82.41
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	687	718	32	SQATTALTAVVLSSSVQRTAGKTAATVTSALQ	77.07
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	739	745	7	TPLVIQQ	79.93
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	756	762	7	PQVTLTQ	74.25
DP01170	O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	Homo sapiens (Human)	408	838	774	788	15	RIMLTTPQQIQLNPL	74.94
DP01172	O43516	WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein)	Homo sapiens (Human)	2	101	14	22	9	TFALANTEK	79.6
DP01172	O43516	WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein)	Homo sapiens (Human)	2	65	14	22	9	TFALANTEK	79.6
DP01172	O43516	WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein)	Homo sapiens (Human)	407	503	447	460	14	EDEWESRFYFHPIS	78.17
DP01172	O43516	WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein)	Homo sapiens (Human)	407	503	468	476	9	YVQTTKSYP	75.25
DP01173	Q15726	Metastasis-suppressor KiSS-1 (Kisspeptin-1) Cleaved into: Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10	Homo sapiens (Human)	20	138	35	45	11	GQQLESLGLLA	79.72
DP01173	Q15726	Metastasis-suppressor KiSS-1 (Kisspeptin-1) Cleaved into: Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10	Homo sapiens (Human)	20	138	108	122	15	DLPNYNWNSFGLRFG	81.2
DP01174	O43474	Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor)	Homo sapiens (Human)	1	130	16	26	11	LLPSFSTFASG	77.74
DP01174	O43474	Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor)	Homo sapiens (Human)	1	130	65	77	13	LAAATVATDLESG	80.7
DP01174	O43474	Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor)	Homo sapiens (Human)	1	130	95	115	21	ETEEFNDLLDLDFILSNSLTH	82.39
DP01174	O43474	Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor)	Homo sapiens (Human)	1	130	119	125	7	SVAATVS	76.68
DP01175	P28235	Gap junction alpha-4 protein (Connexin-37) (Cx37)	Mus musculus (Mouse)	233	333	260	269	10	PEQVFFYLPM	81.64
DP01175	P28235	Gap junction alpha-4 protein (Connexin-37) (Cx37)	Mus musculus (Mouse)	233	333	287	301	15	TEQNWANLTTEERLT	76.9
DP01176	P08033	Gap junction beta-1 protein (Connexin-32) (Cx32) (GAP junction 28 kDa liver protein)	Rattus norvegicus (Rat)	217	283	244	255	12	KQNEINKLLSEQ	94.31
DP01177	P0AE98	Curli production assembly/transport component CsgF	Escherichia coli (strain K12)	19	49	20	32	13	GTMTFQFRNPNFG	80.09
DP01177	P0AE98	Curli production assembly/transport component CsgF	Escherichia coli (strain K12)	19	49	36	44	9	NNGAFLLNS	82.98
DP01178	Q14978	Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130)	Homo sapiens (Human)	1	699	17	35	19	LVLGFLRDNQLSEVANKFA	81.76
DP01178	Q14978	Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130)	Homo sapiens (Human)	1	699	46	61	16	NASSLLDIYSFWLKSA	81.21
DP01178	Q14978	Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130)	Homo sapiens (Human)	1	699	440	446	7	KMVATTK	79.93
DP01178	Q14978	Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130)	Homo sapiens (Human)	1	699	452	459	8	KAALSLPA	77.26
DP01178	Q14978	Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130)	Homo sapiens (Human)	1	699	548	556	9	GTSALTAQN	75.77
DP01178	Q14978	Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130)	Homo sapiens (Human)	1	699	574	581	8	AVVVSKSG	77.26
DP01178	Q14978	Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130)	Homo sapiens (Human)	1	699	629	635	7	REEEIEV	76.49
DP01178	Q14978	Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130)	Homo sapiens (Human)	1	699	659	666	8	NQVLKFTK	86.29
DP01178	Q14978	Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130)	Homo sapiens (Human)	1	699	684	694	11	GGSISVQVNSI	80.85
DP01180	Q8RY59	Inactive poly ADP-ribose polymerase RCD1 (Protein RADICAL-INDUCED CELL DEATH 1)	Arabidopsis thaliana (Mouse-ear cress)	468	509	491	501	11	GSANSVGSSTT	75.59
DP01181	P56621	Nickel and cobalt resistance protein CnrY	Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)	2	38	2	10	9	ADVEEWLTH	78.26
DP01181	P56621	Nickel and cobalt resistance protein CnrY	Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)	2	38	15	33	19	TQEASIGVDVTSIQECISA	79.18
DP01181	P56621	Nickel and cobalt resistance protein CnrY	Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)	2	30	2	10	9	ADVEEWLTH	78.26
DP01181	P56621	Nickel and cobalt resistance protein CnrY	Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)	2	30	15	25	11	TQEASIGVDVT	78.47
DP01182	P22216	Serine/threonine-protein kinase RAD53 (EC 2.7.12.1) (CHEK2 homolog) (Serine-protein kinase 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	165	190	166	174	9	NLKNTSKIA	82.61
DP01183	Q9R224	Protein BEX1 (Brain-expressed X-linked protein 1 homolog) (Reduced expression protein 3) (REX-3)	Mus musculus (Mouse)	1	55	7	15	9	GVKNLNMEN	75.03
DP01183	Q9R224	Protein BEX1 (Brain-expressed X-linked protein 1 homolog) (Reduced expression protein 3) (REX-3)	Mus musculus (Mouse)	1	55	35	42	8	PAVALTSE	76.09
DP01184	O96013	Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4)	Homo sapiens (Human)	9	68	13	24	12	APSNFEHRVHTG	82.61
DP01184	O96013	Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4)	Homo sapiens (Human)	9	68	28	34	7	HEQKFTG	86.29
DP01184	O96013	Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4)	Homo sapiens (Human)	9	68	37	46	10	RQWQSLIEES	82.41
DP01184	O96013	Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4)	Homo sapiens (Human)	9	68	57	63	7	ACITSIQ	74.2
DP01186	P03086	Agnoprotein (Agno)	JC polyomavirus (JCPyV) (JCV)	41	71	58	66	9	TEQTYSALP	77.15
DP01189	P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	359	11	31	21	VDRILSNPLQFNAAMISNKSN	78.4
DP01189	P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	359	40	76	37	ENSSYIVIGKQHNNNSNSTAIAATAESKQIKENNLID	81.19
DP01189	P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	359	90	100	11	MAEALLLYTSK	86.14
DP01189	P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	359	114	124	11	SAELSTELSTE	76.25
DP01189	P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	359	141	153	13	EEGEIFHEARDYV	80.01
DP01189	P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	359	220	232	13	LSTSISSDDEIED	74.76
DP01189	P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	359	267	286	20	KKSLYQDLMENSTVEVNRYE	79.68
DP01189	P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	359	320	339	20	PPVTISNLSNFYQFNENIND	87.59
DP01189	P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	359	341	354	14	GSLNSTRIVKNWGD	75.35
DP01191	O14140	26S proteasome complex subunit rpn15 (mRNA export factor dss1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	54	8	28	21	SLENLEDDDEFEDFATENWPM	77.77
DP01191	O14140	26S proteasome complex subunit rpn15 (mRNA export factor dss1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	54	37	49	13	DDTLWENNWDDED	84.1
DP01192	P55036	26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein)	Homo sapiens (Human)	305	377	330	343	14	QDPEFLQSVLENLP	76.11
DP01192	P55036	26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein)	Homo sapiens (Human)	305	377	348	363	16	NNEAIRNAMGSLASQA	74.94
DP01192	P55036	26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein)	Homo sapiens (Human)	328	361	330	343	14	QDPEFLQSVLENLP	76.11
DP01192	P55036	26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein)	Homo sapiens (Human)	328	361	348	356	9	NNEAIRNAM	75.21
DP01195	P39007	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 (Oligosaccharyl transferase subunit STT3) (EC 2.4.99.18) (Staurosporine and temperature sensitivity protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	299	351	299	346	48	MVSLFLILVLGVVGLSALTYMGLIAPWTGRFYSLWDTNYAKIHIPIIA	85.37
DP01196	P48439	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	23	215	43	52	10	KDSSFENILA	82.54
DP01196	P48439	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	23	215	55	92	38	HENAYIVALFTATAPEIGCSLCLELESEYDTIVASWFD	83.23
DP01196	P48439	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	23	215	102	115	14	SDTSIFFTKVNLED	78.95
DP01196	P48439	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	23	215	122	155	34	KAFQFFQLNNVPRLFIFKPNSPSILDHSVISIST	86.68
DP01196	P48439	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	23	215	162	182	21	MKQIIQAIKQFSQVNDFSLHL	78.72
DP01196	P48439	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	23	215	186	210	25	WTPIITSTIITFITVLLFKKQSKLM	85.54
DP01199	B9KDD4	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase (EC 2.4.99.19) (Protein glycosylation B)	Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)	281	327	284	322	39	DPVLYQLKFYVFKASDVQNLKDAAFMYFNVNETIMEVNT	84.57
DP01200	O29867	Dolichyl-phosphooligosaccharide-protein glycotransferase 3 (EC 2.4.99.21) (Archaeal glycosylation protein B) (AglB-L) (AglB-Long) (Oligosaccharyl transferase) (OST) (OTase)	Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)	336	373	339	348	10	ARNLLSVVRV	75.25
DP01200	O29867	Dolichyl-phosphooligosaccharide-protein glycotransferase 3 (EC 2.4.99.21) (Archaeal glycosylation protein B) (AglB-L) (AglB-Long) (Oligosaccharyl transferase) (OST) (OTase)	Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)	336	373	353	368	16	GGALTIAEVYPFFFTH	82.09
DP01201	Q47184	EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA)	Escherichia coli	1	30	7	23	17	ASVASANASTSTSMAYD	78.24
DP01201	Q47184	EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA)	Escherichia coli	60	147	60	70	11	SIAKFADMNEA	81.09
DP01201	Q47184	EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA)	Escherichia coli	60	147	72	96	25	KESTTAQKMANLVDAKIADVQSSSD	78.27
DP01201	Q47184	EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA)	Escherichia coli	60	147	104	112	9	PDEVISYIN	93.5
DP01201	Q47184	EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA)	Escherichia coli	60	147	116	142	27	NDITISGIDNINAQLGAGDLQTVKAAI	78.61
DP01202	O55000	Serine/threonine-protein phosphatase 1 regulatory subunit 10 (MHC class I region proline-rich protein CAT53) (Phosphatase 1 nuclear targeting subunit) (Protein PNUTS)	Rattus norvegicus (Rat)	309	433	406	417	12	KLREYFYFELDE	84.59
DP01203	O75807	Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog)	Homo sapiens (Human)	513	631	562	573	12	VTVHFLAVWAGP	80.07
DP01203	O75807	Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog)	Homo sapiens (Human)	513	631	598	605	8	QAQEELSP	79.18
DP01203	O75807	Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog)	Homo sapiens (Human)	513	631	612	621	10	RARAWARLRN	73.91
DP01228	Q9UMZ1	Prothymosin a14	Homo sapiens (Human)	1	101	8	15	8	TSSEITTE	74.79
DP01228	Q9UMZ1	Prothymosin a14	Homo sapiens (Human)	1	101	22	29	8	EVVEEAEN	75.92
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	195	208	14	EENTFEIALARLIP	80.55
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	213	220	8	SHAAYTYN	94.44
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	252	267	16	AGANSQATLHINITTA	78.6
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	295	303	9	KQSTIGKTA	89.97
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	309	326	18	NEEEFDPVVTASAMDSIN	84.17
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	332	342	11	AQETSYQNNRT	76.1
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	356	365	10	TLNDYYAALA	80.17
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	409	419	11	LEDEFEDVTDT	74.58
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	425	440	16	TESNTSNDVKQESIND	84.76
DP01237	P36100	Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	482	444	452	9	DAVNATATA	79.86
DP01239	P20591	Interferon-induced GTP-binding protein Mx1 (Interferon-induced protein p78) (IFI-78K) (Interferon-regulated resistance GTP-binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) Cleaved into: Interferon-induced GTP-binding protein Mx1; N-terminally processed	Homo sapiens (Human)	532	572	534	540	7	QDQVYRG	78.6
DP01239	P20591	Interferon-induced GTP-binding protein Mx1 (Interferon-induced protein p78) (IFI-78K) (Interferon-regulated resistance GTP-binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) Cleaved into: Interferon-induced GTP-binding protein Mx1; N-terminally processed	Homo sapiens (Human)	532	572	557	567	11	KSWDFGAFQSS	77.26
DP01240	Q9UJX2	Cell division cycle protein 23 homolog (Anaphase-promoting complex subunit 8) (APC8) (Cyclosome subunit 8)	Homo sapiens (Human)	1	25	10	20	11	VAVTAAVAPVL	75.89
DP01241	P19634	Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)	Homo sapiens (Human)	680	815	680	686	7	INNYLTV	81.13
DP01241	P19634	Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)	Homo sapiens (Human)	680	815	714	720	7	LPVITID	80.22
DP01241	P19634	Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)	Homo sapiens (Human)	680	815	731	737	7	DLVNEEL	79.93
DP01241	P19634	Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)	Homo sapiens (Human)	680	815	774	781	8	TDDVFTPA	77.26
DP01241	P19634	Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)	Homo sapiens (Human)	680	815	787	794	8	SSQRIQRC	74.58
DP01241	P19634	Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)	Homo sapiens (Human)	686	815	714	720	7	LPVITID	80.22
DP01241	P19634	Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)	Homo sapiens (Human)	686	815	731	737	7	DLVNEEL	79.93
DP01241	P19634	Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)	Homo sapiens (Human)	686	815	774	781	8	TDDVFTPA	77.26
DP01241	P19634	Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)	Homo sapiens (Human)	686	815	787	794	8	SSQRIQRC	74.58
DP01246	O13916	Anaphase-promoting complex subunit hcn1 (20S cyclosome/APC complex protein hcn1) (Chaperone-like protein hcn1) (High copy suppressor of cut9 protein 1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	25	80	34	43	10	TEEALQKNEE	74.25
DP01246	O13916	Anaphase-promoting complex subunit hcn1 (20S cyclosome/APC complex protein hcn1) (Chaperone-like protein hcn1) (High copy suppressor of cut9 protein 1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	25	80	59	69	11	RIGITQIFDSS	88.23
DP01248	O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	Homo sapiens (Human)	1	125	4	12	9	VEQVLSLEP	76.89
DP01248	O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	Homo sapiens (Human)	1	125	23	29	7	TDVVTTN	84.57
DP01248	O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	Homo sapiens (Human)	1	125	38	48	11	RNVCFKVKTTA	75.25
DP01248	O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	Homo sapiens (Human)	1	125	57	79	23	NSGIIDAGASINVSVMLQPFDYD	79.86
DP01248	O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	Homo sapiens (Human)	1	125	103	109	7	EAVWKEA	79.36
DP01249	P61073	C-X-C chemokine receptor type 4 (CXC-R4) (CXCR-4) (FB22) (Fusin) (HM89) (LCR1) (Leukocyte-derived seven transmembrane domain receptor) (LESTR) (Lipopolysaccharide-associated protein 3) (LAP-3) (LPS-associated protein 3) (NPYRL) (Stromal cell-derived factor 1 receptor) (SDF-1 receptor) (CD antigen CD184)	Homo sapiens (Human)	1	26	1	16	16	MEGISIYTSDNYTEEM	79.87
DP01252	P01137	Transforming growth factor beta-1 proprotein Cleaved into: Latency-associated peptide (LAP); Transforming growth factor beta-1 (TGF-beta-1)	Homo sapiens (Human)	240	261	245	251	7	GDLATIH	80.22
DP01254	P12956	"X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5-deoxyribose-5-phosphate lyase Ku70) (5-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6)"	Homo sapiens (Human)	533	609	555	563	9	PKVEYSEEE	76.37
DP01254	P12956	"X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5-deoxyribose-5-phosphate lyase Ku70) (5-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6)"	Homo sapiens (Human)	533	609	572	578	7	TLGKFTV	81.27
DP01254	P12956	"X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5-deoxyribose-5-phosphate lyase Ku70) (5-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6)"	Homo sapiens (Human)	533	609	584	592	9	ACRAYGLKS	82.94
DP01254	P12956	"X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5-deoxyribose-5-phosphate lyase Ku70) (5-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6)"	Homo sapiens (Human)	533	609	596	604	9	KQELLEALT	76.59
DP01256	Q32ZE1	Genome polyprotein Cleaved into: Capsid protein C (Capsid protein) (Core protein); Protein prM (Precursor membrane protein); Peptide pr (Peptide precursor); Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	Zika virus (ZIKV)	1417	1463	1417	1431	15	VDMYIERAGDITWEK	88.16
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	1	216	6	16	11	KLKLSNTVLPS	80.97
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	1	216	20	58	39	KVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFM	79.93
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	1	216	69	99	31	SDIDYALKLKNVEPLYGFHAQEFIPFRFASG	79.11
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	1	216	101	120	20	GRELYFYEEKEVDLSDIINT	84.23
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	1	216	132	140	9	KAHWLSIEG	79.67
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	1	216	182	188	7	GQGATTA	77.26
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	437	677	444	455	12	NQDAYRAEFGSL	76.92
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	437	677	468	486	19	AQAALQAQQVNRTTLTITQ	77.87
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	437	677	535	545	11	PTKFIVMSSSS	78.47
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	437	677	550	560	11	TQQVLSLSTSA	79.81
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	437	677	577	591	15	SVQPIVKLVSTATTA	79
DP01262	P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	Homo sapiens (Human)	437	677	602	611	10	SVQKYIVVSL	87.79
DP01268	Q9H816	"5 exonuclease Apollo (EC 3.1.-.-) (DNA cross-link repair 1B protein) (SNM1 homolog B) (SNMIB) (hSNM1B)"	Homo sapiens (Human)	314	335	322	330	9	SVQQYMSSS	76.29
DP01269	Q8NG31	Kinetochore scaffold 1 (ALL1-fused gene from chromosome 15q14 protein) (AF15q14) (Bub-linking kinetochore protein) (Blinkin) (Cancer susceptibility candidate gene 5 protein) (Cancer/testis antigen 29) (CT29) (Kinetochore-null protein 1) (Protein CASC5) (Protein D40/AF15q14)	Homo sapiens (Human)	150	175	150	159	10	KEFSIIEHTR	94.92
DP01280	P05067	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31	Homo sapiens (Human)	672	711	677	706	30	HDSGYEVHHQKLVFFAEDVGSNKGAIIGLM	80.52
DP01281	Q9JM54	Phorbol-12-myristate-13-acetate-induced protein 1 (Protein Noxa)	Mus musculus (Mouse)	16	42	26	37	12	QLRKIGDKVYCT	78.6
DP01284	P24928	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit) (RNA-directed RNA polymerase II subunit RPB1) (EC 2.7.7.48)	Homo sapiens (Human)	1773	1970	1953	1962	10	TYSLTSPAIS	84.62
DP01285	Q97W59	Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta)	Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus)	18	139	27	52	26	TQSLPNMIILNIGNTTIIRNFAEYCD	83.25
DP01285	Q97W59	Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta)	Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus)	18	139	60	70	11	ICMKYLLKELA	76.22
DP01285	Q97W59	Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta)	Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus)	18	139	79	109	31	GELVIQGKFSSQVINTLMERFLKAYVECSTC	80.91
DP01285	Q97W59	Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta)	Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus)	18	139	111	117	7	SLDTILK	80.27
DP01285	Q97W59	Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta)	Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus)	18	139	120	130	11	KKSWYIVCLAC	85.77
DP01287	Q9VZU1	ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p)	Drosophila melanogaster (Fruit fly)	241	388	241	251	11	MDVSYALEMSS	84.13
DP01287	Q9VZU1	ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p)	Drosophila melanogaster (Fruit fly)	241	388	263	275	13	DDLNEIRNEVLAP	79.88
DP01287	Q9VZU1	ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p)	Drosophila melanogaster (Fruit fly)	241	388	307	332	26	VGSHFHAYSETEPMFDLQTSAHMYTQ	77.84
DP01287	Q9VZU1	ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p)	Drosophila melanogaster (Fruit fly)	241	388	334	383	50	CDDLFEELGLSHIQTQTHWPDGLYNTQHTQTCDEIMDELFPDNFQSTCTQ	82.58
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	365	381	17	SLPLFKIANPIAGEPIS	79.3
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	396	433	38	LQELGNTCQKNSISSINVQTDLSYASQNFIPSAQWATA	85.94
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	455	465	11	ISVHTQTFLPS	84.46
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	468	487	20	VTSSIAAQTDAFMDTCFQSG	79.4
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	513	548	36	MCGDIFESVHSSYNVATGNIISNSLVAETVTHSLLP	80.22
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	562	575	14	SAPIINFSAQNSML	81.46
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	584	608	25	QTQTIDLLSDLENILSSNLPAQTLD	81.2
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	634	660	27	IDFDIEEFFSASNIQTQTEESELSTMT	78.83
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	668	688	21	LDIETQTDFLLADTSAQSYGC	81.68
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	690	701	12	GNSNFLGLEMFD	86.18
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	706	715	10	TDLNFFLDSS	83.41
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	719	734	16	PLGSILKHSSFSVSTD	75.23
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	758	765	8	VQLNSTET	83.95
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	770	786	17	SGFETLGSLFFTSNETQ	87.59
DP01288	O43313	ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822)	Homo sapiens (Human)	362	823	790	815	26	DDFLLADLAWNTMESQFSSVETQTSA	84.74
DP01289	Q9KMA5	Antitoxin HigA-2	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	1	36	3	18	16	NRDLFAELSSALVEAK	76.21
DP01289	Q9KMA5	Antitoxin HigA-2	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	3	36	3	18	16	NRDLFAELSSALVEAK	76.21
DP01289	Q9KMA5	Antitoxin HigA-2	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	3	33	3	18	16	NRDLFAELSSALVEAK	76.21
DP01291	P0AE72	Antitoxin MazE	Escherichia coli (strain K12)	48	82	50	63	14	EPVFTLAELVNDIT	76.3
DP01291	P0AE72	Antitoxin MazE	Escherichia coli (strain K12)	48	76	50	63	14	EPVFTLAELVNDIT	76.3
DP01291	P0AE72	Antitoxin MazE	Escherichia coli (strain K12)	50	82	50	63	14	EPVFTLAELVNDIT	76.3
DP01291	P0AE72	Antitoxin MazE	Escherichia coli (strain K12)	51	82	51	63	13	PVFTLAELVNDIT	76.49
DP01292	P49768	Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)	Homo sapiens (Human)	1	77	6	29	24	APLSYFQNAQMSEDNHLSNTVRSQ	80.35
DP01292	P49768	Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)	Homo sapiens (Human)	1	77	60	72	13	RQVVEQDEEEDEE	76.07
DP01292	P49768	Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)	Homo sapiens (Human)	262	378	270	299	30	MLVETAQERNETLFPALIYSSTMVWLVNMA	82.92
DP01292	P49768	Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)	Homo sapiens (Human)	262	378	311	322	12	KNSKYNAESTER	78.18
DP01292	P49768	Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)	Homo sapiens (Human)	262	378	326	342	17	DTVAENDDGGFSEEWEA	78.02
DP01292	P49768	Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)	Homo sapiens (Human)	262	378	359	370	12	AAVQELSSSILA	78.26
DP01293	Q13542	Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2)	Homo sapiens (Human)	1	120	20	26	7	RTVAISD	80.98
DP01293	Q13542	Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2)	Homo sapiens (Human)	1	120	39	47	9	GGTLFSTTP	77.15
DP01293	Q13542	Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2)	Homo sapiens (Human)	1	120	49	61	13	GTRIIYDRKFLLD	82.89
DP01293	Q13542	Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2)	Homo sapiens (Human)	1	120	93	105	13	VEVNNLNNLNNHD	78.72
DP01293	Q13542	Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2)	Homo sapiens (Human)	18	62	20	26	7	RTVAISD	80.98
DP01293	Q13542	Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2)	Homo sapiens (Human)	18	62	39	47	9	GGTLFSTTP	77.15
DP01293	Q13542	Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2)	Homo sapiens (Human)	18	62	49	57	9	GTRIIYDRK	84.21
DP01294	P41695	Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	29	230	34	54	21	SQLNQTKIAYEQRLLNDLEDM	77.8
DP01294	P41695	Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	29	230	57	137	81	PLDLFLDYMIWISTSYIEVDSESGQEVLRSTMERCLIYIQDMETYRNDPRFLKIWIWYINLFLSNNFHESENTFKYMFNKG	81.63
DP01294	P41695	Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	29	230	141	178	38	KLSLFYEEFSKLLENAQFFLEAKVLLELGAENNCRPYN	80.77
DP01294	P41695	Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	29	230	181	189	9	LRSLSNYED	76.14
DP01294	P41695	Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	29	230	192	203	12	REMNIVENQNSV	78.29
DP01294	P41695	Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	29	230	211	225	15	KGRLIYRTAPFFIRK	83.57
DP01295	Q98XH7	Protein Tat (Fragment)	Human immunodeficiency virus 1	1	72	21	27	7	ACNNCYC	75.25
DP01295	Q98XH7	Protein Tat (Fragment)	Human immunodeficiency virus 1	1	72	34	49	16	CQVCFMTKGLGIYYGR	89.17
DP01296	Q6BBK3	CP12	Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2)	1	52	14	22	9	EAHAISEEK	75.51
DP01296	Q6BBK3	CP12	Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2)	1	52	29	46	18	AAAAWDAVEELQAEAAHQ	75.99
DP01299	Q96273	Late embryogenesis abundant protein 18 (Late embryogenesis abundant protein 4-2) (AtLEA4-2)	Arabidopsis thaliana (Mouse-ear cress)	1	97	4	14	11	AKEKISDMAST	79.93
DP01299	Q96273	Late embryogenesis abundant protein 18 (Late embryogenesis abundant protein 4-2) (AtLEA4-2)	Arabidopsis thaliana (Mouse-ear cress)	1	97	17	23	7	EKLNIGG	79.93
DP01300	Q9SLJ2	Dehydrin HIRD11 (Histidine-rich dehydrin of 11 kDa) (AtHIRD11) (Protein SRC1 homolog)	Arabidopsis thaliana (Mouse-ear cress)	1	98	1	15	15	MAGLINKIGDALHIG	88.36
DP01303	O14519	Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Deleted in oral cancer 1) (DOC-1) (Putative oral cancer suppressor)	Homo sapiens (Human)	1	60	13	25	13	AAALNAAGSVHSP	75.82
DP01303	O14519	Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Deleted in oral cancer 1) (DOC-1) (Putative oral cancer suppressor)	Homo sapiens (Human)	1	60	35	43	9	YRQLLSDYG	78.08
DP01303	O14519	Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Deleted in oral cancer 1) (DOC-1) (Putative oral cancer suppressor)	Homo sapiens (Human)	1	60	46	55	10	SLGYTQGTGN	78.26
DP01304	Q99LJ8	Dehydrodolichyl diphosphate synthase complex subunit Nus1 (EC 2.5.1.87) (Nogo-B receptor) (NgBR) (Nuclear undecaprenyl pyrophosphate synthase 1 homolog)	Mus musculus (Mouse)	47	120	93	102	10	ADVRSLQKLP	75.25
DP01304	Q99LJ8	Dehydrodolichyl diphosphate synthase complex subunit Nus1 (EC 2.5.1.87) (Nogo-B receptor) (NgBR) (Nuclear undecaprenyl pyrophosphate synthase 1 homolog)	Mus musculus (Mouse)	47	120	104	113	10	HMGLLVTEEV	79.03
DP01306	Q03518	Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4)	Homo sapiens (Human)	61	172	78	111	34	ASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTA	81.19
DP01306	Q03518	Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4)	Homo sapiens (Human)	61	172	114	132	19	LLRVWAVGLSRWAVLWLGA	79.25
DP01306	Q03518	Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4)	Homo sapiens (Human)	61	172	148	157	10	GAQGWLAALK	76.52
DP01306	Q03518	Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4)	Homo sapiens (Human)	61	172	159	167	9	LAAALGLAL	74.25
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	1	265	24	34	11	PEEEIIAEDYD	81.73
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	1	265	49	57	9	PPSWYKVFD	78.26
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	1	265	61	69	9	GLPYYWNAD	82.09
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	1	265	71	77	7	DLVSWLS	78.93
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	1	265	249	260	12	GAVLRANAEASR	80.27
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	1	35	24	30	7	PEEEIIA	85.05
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	82	265	249	260	12	GAVLRANAEASR	80.27
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	95	265	249	260	12	GAVLRANAEASR	80.27
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	220	265	249	260	12	GAVLRANAEASR	80.27
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	223	265	249	260	12	GAVLRANAEASR	80.27
DP01308	O60828	Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)	Homo sapiens (Human)	238	260	249	255	7	GAVLRAN	80.27
DP01310	Q8WUP2	Filamin-binding LIM protein 1 (FBLP-1) (Migfilin) (Mitogen-inducible 2-interacting protein) (MIG2-interacting protein)	Homo sapiens (Human)	1	85	10	18	9	ASSVFITLA	85.88
DP01310	Q8WUP2	Filamin-binding LIM protein 1 (FBLP-1) (Migfilin) (Mitogen-inducible 2-interacting protein) (MIG2-interacting protein)	Homo sapiens (Human)	1	85	24	30	7	VAVAEEV	75.92
DP01311	Q6NUK1	Calcium-binding mitochondrial carrier protein SCaMC-1 (Mitochondrial ATP-Mg/Pi carrier protein 1) (Mitochondrial Ca(2+)-dependent solute carrier protein 1) (Small calcium-binding mitochondrial carrier protein 1) (Solute carrier family 25 member 24)	Homo sapiens (Human)	50	78	59	72	14	AEEKIFTTGDVNKD	79
DP01312	Q9UMX1	Suppressor of fused homolog (SUFUH)	Homo sapiens (Human)	279	360	314	321	8	RGLEINSK	75.92
DP01312	Q9UMX1	Suppressor of fused homolog (SUFUH)	Homo sapiens (Human)	279	360	344	355	12	KDSLESDSSTAI	78.43
DP01313	Q9N4U5	Smu-2 suppressor of mec-8 and unc-52 protein (RED homolog) (Suppressor of Mec and Unc defects 2)	Caenorhabditis elegans	163	223	194	208	15	EASLLAQELAQSHSE	77.08
DP01315	Q9QWH1	Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36)	Mus musculus (Mouse)	1	79	14	33	20	ASVTTNTSGTNSSSGCISSS	81.3
DP01315	Q9QWH1	Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36)	Mus musculus (Mouse)	1	79	45	55	11	APQISVYSGIP	77.47
DP01315	Q9QWH1	Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36)	Mus musculus (Mouse)	1	79	59	69	11	TVQVIQQALHR	78.5
DP01316	P25916	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4)	Mus musculus (Mouse)	106	240	121	140	20	EKRIITDDEIISLSIEFFDQ	83.43
DP01316	P25916	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4)	Mus musculus (Mouse)	106	240	183	196	14	IPNTFQIDVMYEEE	86.86
DP01316	P25916	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4)	Mus musculus (Mouse)	106	240	198	214	17	LKDYYTLMDIAYIYTWR	83.75
DP01317	O60741	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 (Brain cyclic nucleotide-gated channel 1) (BCNG-1)	Homo sapiens (Human)	1	93	15	23	9	DDGNSVFPA	76.81
DP01317	O60741	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 (Brain cyclic nucleotide-gated channel 1) (BCNG-1)	Homo sapiens (Human)	1	93	55	61	7	NSVCFKV	79.93
DP01319	Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	Homo sapiens (Human)	1	262	43	52	10	KAVKSLVKKL	77.26
DP01319	Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	Homo sapiens (Human)	1	262	61	78	18	LEKAITTQNCNTKCVTIP	79.47
DP01319	Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	Homo sapiens (Human)	1	262	80	108	29	TCSEIWGLSTPNTIDQWDTTGLYSFSEQT	81.21
DP01319	Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	Homo sapiens (Human)	1	262	124	135	12	PHVIYCRLWRWP	78.71
DP01319	Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	Homo sapiens (Human)	1	262	142	157	16	ELKAIENCEYAFNLKK	80.81
DP01319	Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	Homo sapiens (Human)	1	262	160	168	9	VCVNPYHYQ	78.15
DP01319	Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	Homo sapiens (Human)	1	262	183	190	8	HTEILTEL	76.09
DP01319	Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	Homo sapiens (Human)	1	262	235	241	7	QQLNQSM	75.92
DP01320	P36152	Fe-S cluster assembly protein DRE2 (Anamorsin homolog)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	234	348	243	252	10	GKSMITMITC	78.96
DP01320	P36152	Fe-S cluster assembly protein DRE2 (Anamorsin homolog)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	234	348	271	282	12	KEQEENEINDIR	83.89
DP01320	P36152	Fe-S cluster assembly protein DRE2 (Anamorsin homolog)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	234	348	287	304	18	KVVKFTEDELTEIDFTID	87.89
DP01322	Q01924	Fibronectin-binding protein	Streptococcus pyogenes	396	591	400	408	9	NQQNPVDID	75.25
DP01322	Q01924	Fibronectin-binding protein	Streptococcus pyogenes	396	591	420	426	7	NMVETED	77.26
DP01322	Q01924	Fibronectin-binding protein	Streptococcus pyogenes	396	591	436	446	11	GQSESVEFTKD	84.07
DP01322	Q01924	Fibronectin-binding protein	Streptococcus pyogenes	396	591	473	483	11	GQSESVEFTKD	84.07
DP01322	Q01924	Fibronectin-binding protein	Streptococcus pyogenes	396	591	494	500	7	SQVETED	80.27
DP01322	Q01924	Fibronectin-binding protein	Streptococcus pyogenes	396	591	510	520	11	GQSESVEFTKD	84.07
DP01322	Q01924	Fibronectin-binding protein	Streptococcus pyogenes	396	591	547	557	11	GQSESVEFTKD	84.07
DP01322	Q01924	Fibronectin-binding protein	Streptococcus pyogenes	396	591	561	575	15	GMSGFSETVTIVEDT	87.36
DP01322	Q01924	Fibronectin-binding protein	Streptococcus pyogenes	396	591	578	586	9	KLVFHFDNN	91.56
DP01323	Q8R316	HMG box-containing protein 1 (HMG box transcription factor 1) (High mobility group box transcription factor 1)	Mus musculus (Mouse)	358	380	364	374	11	SSAVYVLSSMA	77.5
DP01327	Q8IV16	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPI-HBP1) (GPI-anchored HDL-binding protein 1) (High density lipoprotein-binding protein 1)	Homo sapiens (Human)	21	54	22	28	7	TQQEEEE	74.25
DP01329	P28324	ETS domain-containing protein Elk-4 (Serum response factor accessory protein 1) (SAP-1) (SRF accessory protein 1)	Homo sapiens (Human)	94	136	97	116	20	TVGRIEGDCESLNFSEVSSS	75.22
DP01330	P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	112	12	38	27	KIREIYRYDEMSNKVLKVDKRFMNTSQ	79.49
DP01330	P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	112	42	48	7	RDAEISQ	77.21
DP01330	P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	112	62	70	9	GQGLCNNIN	90.64
DP01330	P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	112	88	103	16	SLKKIQQHNTILNSSS	79.68
DP01330	P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	193	257	205	213	9	QAVAILADD	87.81
DP01330	P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	193	257	219	238	20	EEVTEMSNNANVLGGEINDN	79.8
DP01330	P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	193	257	241	252	12	DDEEYDYNDVEV	78.73
DP01332	P17931	Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen)	Homo sapiens (Human)	1	115	1	13	13	MADNFSLHDALSG	77.51
DP01332	P17931	Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen)	Homo sapiens (Human)	1	112	1	13	13	MADNFSLHDALSG	77.51
DP01332	P17931	Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen)	Homo sapiens (Human)	1	40	1	13	13	MADNFSLHDALSG	77.51
DP01334	B7T1D9	Teg14	uncultured soil bacterium	215	240	215	224	10	QQGQWASMTG	87.69
DP01336	P03709	DNA-packaging protein FI	Escherichia phage lambda (Bacteriophage lambda)	42	80	57	70	14	ENVLTGHENEVGSA	76.33
DP01339	P0A903	Outer membrane protein assembly factor BamC	Escherichia coli (strain K12)	26	98	37	52	16	GDEAYLEAAPLAELHA	77.13
DP01339	P0A903	Outer membrane protein assembly factor BamC	Escherichia coli (strain K12)	26	98	63	71	9	GDYAIPVTN	87.63
DP01344	Q13469	Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1)	Homo sapiens (Human)	131	294	132	140	9	DAGLLVEQP	75.18
DP01344	Q13469	Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1)	Homo sapiens (Human)	131	294	174	187	14	SSASFISDTFSPYT	80.03
DP01344	Q13469	Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1)	Homo sapiens (Human)	131	294	204	213	10	QFQNIPAHYS	84.08
DP01347	Q9UNL4	Inhibitor of growth protein 4 (p29ING4)	Homo sapiens (Human)	119	188	163	172	10	KLVRTSPEYG	73.58
DP01347	Q9UNL4	Inhibitor of growth protein 4 (p29ING4)	Homo sapiens (Human)	119	188	174	181	8	PSVTFGSV	79.6
DP01356	Q49492	"Mycinamicin III 3-O-methyltransferase (EC 2.1.1.237) (Mycinamicin biosynthesis protein F)"	Micromonospora griseorubida	116	144	133	139	7	NLHQYNE	82.27
DP01361	P15927	Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34)	Homo sapiens (Human)	1	42	4	22	19	SGFESYGSSSYGGAGGYTQ	80.94
DP01361	P15927	Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34)	Homo sapiens (Human)	175	270	190	200	11	EAGNFGGNSFM	83.55
DP01361	P15927	Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34)	Homo sapiens (Human)	175	270	202	218	17	ANGLTVAQNQVLNLIKA	84.04
DP01361	P15927	Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34)	Homo sapiens (Human)	175	270	223	229	7	EGLNFQD	86.96
DP01361	P15927	Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34)	Homo sapiens (Human)	175	270	238	259	22	SVSSIKQAVDFLSNEGHIYSTV	81.07
DP01364	P62826	GTP-binding nuclear protein Ran (Androgen receptor-associated protein 24) (GTPase Ran) (Ras-like protein TC4) (Ras-related nuclear protein)	Homo sapiens (Human)	123	144	132	139	8	KAKSIVFH	77.26
DP01364	P62826	GTP-binding nuclear protein Ran (Androgen receptor-associated protein 24) (GTPase Ran) (Ras-like protein TC4) (Ras-related nuclear protein)	Homo sapiens (Human)	170	198	172	180	9	PNLEFVAMP	77.26
DP01368	Q8WXE9	Stonin-2 (Stoned B)	Homo sapiens (Human)	301	340	311	321	11	ATNPFLNETLQ	76.53
DP01368	Q8WXE9	Stonin-2 (Stoned B)	Homo sapiens (Human)	301	331	311	321	11	ATNPFLNETLQ	76.53
DP01377	J7M799	Cytosolic-abundant heat soluble protein 1 (CAHS1) (Tardigrade-specific intrinsically disordered protein CAHS1) (TDP CAHS1)	Ramazzottius varieornatus (Water bear) (Tardigrade)	90	190	113	126	14	EHEMINRQAEATLQ	78.02
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	4	14	11	YQQESSYQYSD	80.78
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	31	37	7	EHSSYTH	79.26
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	44	56	13	MPNLIAPFISSSA	78.83
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	58	75	18	LAQELVGEGFQASVSRIT	81.49
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	78	91	14	SGELTVIDTEAETE	74.53
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	103	109	7	EQELLSR	80.27
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	126	134	9	QEVETEKIR	77.26
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	152	160	9	MEQTIENQK	76.7
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	194	200	7	IQVNMEA	80.6
DP01378	P0CU43	Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	212	219	8	VAVSESEK	74.75
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	4	14	11	YQQESSYQYSD	80.78
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	31	37	7	EHSSYTH	79.26
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	44	56	13	MPNLIAPFISSSA	78.83
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	58	75	18	LAQELVGEGFQASVSRIT	81.49
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	78	91	14	SGELTVIDTEAETE	74.53
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	103	109	7	EQELLSR	80.27
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	126	134	9	QEVETEKIR	77.26
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	152	160	9	MEQTIENQK	76.7
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	194	200	7	IQVNMEA	80.6
DP01379	P0CU44	Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	224	212	219	8	VAVSESEK	74.75
DP01380	P0CU45	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	16	22	7	VVVNNSG	77.64
DP01380	P0CU45	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	31	41	11	QQVEHTEFTHT	75.25
DP01380	P0CU45	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	51	80	30	APPIISTGAAGLAEEIVGQGFTASAARISG	79
DP01380	P0CU45	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	122	138	17	KTEAYRKTAEAEAEKIR	77.51
DP01380	P0CU45	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	147	161	15	RDVEFRKDLIESTID	84.21
DP01380	P0CU45	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	212	220	9	GGTTISSSD	79.93
DP01381	P0CU46	Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	237	1	7	7	MSQQYEK	77.26
DP01381	P0CU46	Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	237	12	18	7	TEVVYGG	91.97
DP01381	P0CU46	Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	237	25	43	19	SASASAEKTTNYTHTEIRA	80.11
DP01381	P0CU46	Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	237	60	89	30	LAQEIVGEGFTASATRISGAAATTQVLESQ	76.38
DP01381	P0CU46	Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	237	92	103	12	REQAFKDQEKYS	83.95
DP01381	P0CU46	Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	237	105	112	8	EQAAIARA	91.97
DP01381	P0CU46	Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	237	127	136	10	TAEAEAEKIR	75.59
DP01381	P0CU46	Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	237	152	159	8	DLVESAID	86.71
DP01381	P0CU46	Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	237	183	201	19	AMNALEQSKMATNVQVQMD	75.25
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	18	28	11	ADGATLVKNIG	80.36
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	54	62	9	AGVIPNRIE	75.92
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	93	134	42	KSSSFVEPSLKYRGEIGPIGKNGEFVASSNRQNSSSNVSSSD	80.33
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	156	179	24	TQRTTVITESSVQGLGAQRTVPIQ	75.01
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	186	194	9	DHEVITHES	79.93
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	201	207	7	TTVVTIP	89.87
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	253	284	32	GTSATIHATTDLHLASEAQINDMGPEEYERYR	76.39
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	286	294	9	KVEALARIH	75.92
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	301	318	18	KAAAYRNAVEADAELIRQ	77.98
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	333	339	7	DLVESSV	79.26
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	342	355	14	QQQEIRLEAEYAMR	83.76
DP01382	P0CU47	Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	414	368	389	22	LDQAMASTNIDVNIDSAIGTTH	85.8
DP01383	P0CU51	Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	229	29	43	15	EKQEIQQTSYLQSQV	78.8
DP01383	P0CU51	Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	229	52	89	38	APFFSTSFSAQEILGEGFQASISRISAVSEELSSIEIP	79.39
DP01383	P0CU51	Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	229	106	117	12	QEMLSANYQKEV	79.18
DP01383	P0CU51	Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	229	127	133	7	QQEVEAD	74.58
DP01383	P0CU51	Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	229	152	162	11	DIVEMAIENQK	76.1
DP01383	P0CU51	Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	229	188	202	15	EQQKFHSDIQVNLDS	83.84
DP01383	P0CU51	Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	229	211	222	12	GQVVSESQKFTE	77.26
DP01384	P0CU50	Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	16	22	7	VVVNNSG	77.64
DP01384	P0CU50	Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	31	41	11	QQVEHTEFTHT	75.25
DP01384	P0CU50	Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	51	80	30	APPIISTGAAGLAEEIVGQGFTASAARISG	79
DP01384	P0CU50	Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	122	138	17	KTEAYRKTAEAEAEKIR	77.51
DP01384	P0CU50	Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	147	161	15	RDVEFRKDLIESTID	84.21
DP01384	P0CU50	Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	214	220	7	TTVSTSD	74.15
DP01385	P0CU48	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	16	22	7	VVVNNSG	77.64
DP01385	P0CU48	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	31	41	11	QQVEHTEFTHT	75.25
DP01385	P0CU48	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	51	80	30	APPIISTGAAGLAEEIVGQGFTASAARISG	79
DP01385	P0CU48	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	122	138	17	KTEAYRKTAEAEAEKIR	77.51
DP01385	P0CU48	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	147	161	15	RDVEFRKDLIESTID	84.21
DP01385	P0CU48	Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	227	214	220	7	TTVSTSD	74.15
DP01386	P0CU49	Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	238	28	43	16	AGVAAVYAVRFASSSG	79.12
DP01386	P0CU49	Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	238	48	54	7	ADNWAES	75.25
DP01386	P0CU49	Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	238	81	87	7	AAGGIEQ	75.25
DP01386	P0CU49	Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	238	103	111	9	GSRTFENAK	75.25
DP01386	P0CU49	Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	238	134	159	26	GVVENVKEAAENAWEKTKDVAENLKD	78.76
DP01386	P0CU49	Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	238	171	178	8	AANAWETV	86.25
DP01386	P0CU49	Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135)	Hypsibius dujardini (Water bear) (Macrobiotus dujardini)	1	238	200	210	11	AQQVIHDATTQ	78.5
DP01388	P0CU52	Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	227	4	15	12	MNMNIPRDAMFV	79.77
DP01388	P0CU52	Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	227	31	38	8	VQQTSYMQ	85.66
DP01388	P0CU52	Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	227	42	80	39	KVPHYNFPTPYFTTSFSAQELLGEGFQASISRISAVTED	78.36
DP01388	P0CU52	Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	227	85	93	9	EIPEFVEEA	78.93
DP01388	P0CU52	Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	227	107	115	9	LGQQYEKEL	80.23
DP01388	P0CU52	Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	227	125	131	7	HQEVEAD	74.58
DP01388	P0CU52	Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	227	143	160	18	RDIEFRKEIAELAIENQK	78.93
DP01388	P0CU52	Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	227	186	200	15	EQQKFHSDIQVNLDS	83.84
DP01388	P0CU52	Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094)	Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi)	1	227	209	219	11	GHVVSQSEKFT	77.44
DP01391	P03520	Phosphoprotein (P protein) (Protein M1)	Vesicular stomatitis Indiana virus (strain San Juan) (VSIV)	1	60	1	15	15	MDNLTKVREYLKSYS	78.93
DP01391	P03520	Phosphoprotein (P protein) (Protein M1)	Vesicular stomatitis Indiana virus (strain San Juan) (VSIV)	1	60	20	29	10	AVGEIDEIEA	81.74
DP01391	P03520	Phosphoprotein (P protein) (Protein M1)	Vesicular stomatitis Indiana virus (strain San Juan) (VSIV)	1	60	33	43	11	EKSNYELFQED	91.94
DP01392	P53330	Regulator of Ty1 transposition protein 102	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	91	157	117	123	7	GDEALSV	76.4
DP01392	P53330	Regulator of Ty1 transposition protein 102	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	91	157	129	137	9	AVGNSEAIP	78.6
DP01392	P53330	Regulator of Ty1 transposition protein 102	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	91	157	141	147	7	AGVNNDN	73.91
DP01393	P04880	Phosphoprotein (Protein P) (Protein M1)	Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)	1	60	1	15	15	MDNLTKVREYLKSYS	78.93
DP01393	P04880	Phosphoprotein (Protein P) (Protein M1)	Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)	1	60	20	29	10	AVGEIDEIEA	81.74
DP01393	P04880	Phosphoprotein (Protein P) (Protein M1)	Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)	1	60	33	43	11	EKSNYELFQED	91.94
DP01394	P04879	Phosphoprotein (Protein P) (Protein M1)	Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)	1	60	1	15	15	MDNLTKVREYLKSYS	78.93
DP01394	P04879	Phosphoprotein (Protein P) (Protein M1)	Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)	1	60	20	29	10	AVGEIDEIEA	81.74
DP01394	P04879	Phosphoprotein (Protein P) (Protein M1)	Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)	1	60	33	43	11	EKSNYELFQED	91.94
DP01395	Q8B0H3	Phosphoprotein (Protein P) (NS) (Protein M1)	Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV)	1	60	20	29	10	AVGEIDEIEA	81.74
DP01395	Q8B0H3	Phosphoprotein (Protein P) (NS) (Protein M1)	Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV)	1	60	33	43	11	EKSNYELFQED	91.94
DP01396	P01130	Low-density lipoprotein receptor (LDL receptor)	Homo sapiens (Human)	354	393	367	376	10	LCVNLEGGYK	85.28
DP01397	Q9Z0P7	Suppressor of fused homolog	Mus musculus (Mouse)	279	359	314	321	8	RGLEINSK	75.92
DP01398	G0SCY6	HYPK_UBA domain-containing protein	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	25	12	20	9	VEGATAGDV	75.25
DP01400	P45985	Dual specificity mitogen-activated protein kinase kinase 4 (MAP kinase kinase 4) (MAPKK 4) (EC 2.7.12.2) (JNK-activating kinase 1) (MAPK/ERK kinase 4) (MEK 4) (SAPK/ERK kinase 1) (SEK1) (Stress-activated protein kinase kinase 1) (SAPK kinase 1) (SAPKK-1) (SAPKK1) (c-Jun N-terminal kinase kinase 1) (JNKK)	Homo sapiens (Human)	1	86	42	50	9	KALKLNFAN	75.62
DP01400	P45985	Dual specificity mitogen-activated protein kinase kinase 4 (MAP kinase kinase 4) (MAPKK 4) (EC 2.7.12.2) (JNK-activating kinase 1) (MAPK/ERK kinase 4) (MEK 4) (SAPK/ERK kinase 1) (SEK1) (Stress-activated protein kinase kinase 1) (SAPK kinase 1) (SAPKK-1) (SAPKK1) (c-Jun N-terminal kinase kinase 1) (JNKK)	Homo sapiens (Human)	1	86	57	64	8	ARFTLNPN	80.27
DP01401	P47093	U6 snRNA-associated Sm-like protein LSm8	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	68	109	89	104	16	TKNKIENEHVIWEKVY	77.24
DP01405	Q5V913	Nucleoprotein (Nucleocapsid protein) (Protein N)	Influenza B virus (B/Memphis/13/2003)	1	70	17	24	8	APEEITSG	79.93
DP01405	Q5V913	Nucleoprotein (Nucleocapsid protein) (Protein N)	Influenza B virus (B/Memphis/13/2003)	1	70	53	59	7	RATTISE	79.93
DP01420	Q16543	Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) Cleaved into: Hsp90 co-chaperone Cdc37; N-terminally processed	Homo sapiens (Human)	1	26	1	14	14	MVDYSVWDHIEVSD	76.59
DP01424	Q2KIG3	Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI)	Bos taurus (Bovine)	1	117	3	33	31	LYSLGVLVATVLFCGEHAFAFQRGQVLSALP	90.51
DP01424	Q2KIG3	Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI)	Bos taurus (Bovine)	1	117	37	80	44	RQVQILQNVTTTYKIVLWQPVAAEYIVKGYEVHFFVNASDVSNV	86.04
DP01424	Q2KIG3	Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI)	Bos taurus (Bovine)	1	117	93	112	20	VLVENVEDLIRQQTSNDTIS	77.36
DP01425	Q15004	PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor)	Homo sapiens (Human)	1	111	29	40	12	STSATNSTSVSS	75.92
DP01425	Q15004	PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor)	Homo sapiens (Human)	1	111	64	73	10	GIGEFFRLSP	77.53
DP01425	Q15004	PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor)	Homo sapiens (Human)	50	77	64	72	9	GIGEFFRLS	77.78
DP01426	P06400	Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)	Homo sapiens (Human)	346	370	347	353	7	SIDSFET	75.63
DP01426	P06400	Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)	Homo sapiens (Human)	577	615	596	609	14	LQNNHTAADMYLSP	78.38
DP01426	P06400	Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)	Homo sapiens (Human)	590	635	596	609	14	LQNNHTAADMYLSP	78.38
DP01426	P06400	Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)	Homo sapiens (Human)	590	635	620	630	11	TRVNSTANAET	75.16
DP01426	P06400	Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)	Homo sapiens (Human)	786	928	800	808	9	PGGNIYISP	82.87
DP01426	P06400	Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)	Homo sapiens (Human)	786	928	831	856	26	ILVSIGESFGTSEKFQKINQMVCNSD	84.17
DP01426	P06400	Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)	Homo sapiens (Human)	786	928	893	907	15	GESKFQQKLAEMTST	81.36
DP01426	P06400	Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)	Homo sapiens (Human)	829	873	831	856	26	ILVSIGESFGTSEKFQKINQMVCNSD	84.17
DP01427	Q01094	Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1)	Homo sapiens (Human)	200	301	212	218	7	QLQESEQ	73.91
DP01427	Q01094	Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1)	Homo sapiens (Human)	200	301	222	236	15	HLMNICTTQLRLLSE	79.67
DP01427	Q01094	Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1)	Homo sapiens (Human)	200	301	241	255	15	QRLAYVTCQDLRSIA	79.55
DP01427	Q01094	Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1)	Homo sapiens (Human)	200	301	261	267	7	MVMVIKA	76.21
DP01427	Q01094	Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1)	Homo sapiens (Human)	200	301	278	288	11	SSENFQISLKS	87.75
DP01428	P03120	Regulatory protein E2	Human papillomavirus type 16	286	365	293	304	12	GDANTLKCLRYR	77.26
DP01428	P03120	Regulatory protein E2	Human papillomavirus type 16	286	365	308	323	16	HCTLYTAVSSTWHWTG	80.35
DP01428	P03120	Regulatory protein E2	Human papillomavirus type 16	286	365	328	360	33	HKSAIVTLTYDSEWQRDQFLSQVKIPKTITVST	85.6
DP01429	Q09427	ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)	Cricetus cricetus (Black-bellied hamster)	928	1000	935	941	7	QDQELEK	74.58
DP01429	Q09427	ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)	Cricetus cricetus (Black-bellied hamster)	928	1000	963	973	11	RDGLLLDEEEE	73.94
DP01429	Q09427	ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)	Cricetus cricetus (Black-bellied hamster)	928	1000	983	995	13	DDNLSSVLHQRAK	77.26
DP01429	Q09427	ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)	Cricetus cricetus (Black-bellied hamster)	1319	1343	1322	1336	15	EAESYEGLLAPSLIP	79.4
DP01430	Q03071	Elongin-C	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	77	99	78	84	7	PEFEIPT	77.26
DP01430	Q03071	Elongin-C	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	77	99	87	94	8	SLELLLAA	81.15
DP01431	C6ZFX3	Intrinsically disordered protein 1	Lotus japonicus (Lotus corniculatus var. japonicus)	1	94	1	24	24	MARSFTNIKAISALVAEEFSNSLA	82.64
DP01431	C6ZFX3	Intrinsically disordered protein 1	Lotus japonicus (Lotus corniculatus var. japonicus)	1	94	69	89	21	VTGYYKPENIKEIDVAELRSA	81.45
DP01432	E1UJ20	Parvalbumin beta-1	Oncorhynchus kisutch (Coho salmon) (Salmo kisutch)	2	109	13	19	7	KAALEAC	76.25
DP01432	E1UJ20	Parvalbumin beta-1	Oncorhynchus kisutch (Coho salmon) (Salmo kisutch)	2	109	21	41	21	AADTFNFKTFFHTIGFASKSA	81.14
DP01432	E1UJ20	Parvalbumin beta-1	Oncorhynchus kisutch (Coho salmon) (Salmo kisutch)	2	109	55	73	19	ASGFIEVEELKLFLQNFCP	85.87
DP01432	E1UJ20	Parvalbumin beta-1	Oncorhynchus kisutch (Coho salmon) (Salmo kisutch)	2	109	75	90	16	ARVLTDAETKAFLKAG	77.65
DP01432	E1UJ20	Parvalbumin beta-1	Oncorhynchus kisutch (Coho salmon) (Salmo kisutch)	2	109	94	104	11	GDGMIGIDEFA	78.47
DP01433	P04052	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit)	Drosophila melanogaster (Fruit fly)	1657	1739	1660	1680	21	SGSNIYSPGNAYSPSSSNYSP	87.21
DP01435	O60829	P antigen family member 4 (PAGE-4) (G antigen family C member 1) (PAGE-1)	Homo sapiens (Human)	1	102	20	28	9	DVVAFVAPG	81.61
DP01436	P54936	Protein lin-2 (Abnormal cell lineage protein 2)	Caenorhabditis elegans	423	487	435	444	10	TLNQIDGLLG	77.26
DP01436	P54936	Protein lin-2 (Abnormal cell lineage protein 2)	Caenorhabditis elegans	423	487	449	459	11	ALELRQLLNSP	75.62
DP01436	P54936	Protein lin-2 (Abnormal cell lineage protein 2)	Caenorhabditis elegans	423	487	465	477	13	VQALDVVVCEIRD	78.9
DP01437	P90976	LIN-7 (Fragment)	Caenorhabditis elegans	115	180	120	129	10	DVQRILELME	76.59
DP01437	P90976	LIN-7 (Fragment)	Caenorhabditis elegans	115	180	135	170	36	GEVNNAKLASLQQVLQSEFFGAVREVYETVYESIDA	81.28
DP01438	O14936	Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog)	Homo sapiens (Human)	335	401	348	362	15	SQVLDSLEEIHALTD	75.3
DP01438	O14936	Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog)	Homo sapiens (Human)	335	401	366	391	26	KDLDFLHSVFQDQHLHTLLDLYDKIN	81.55
DP01438	O14936	Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog)	Homo sapiens (Human)	394	460	410	420	11	KEVLEEISCYP	78.99
DP01438	O14936	Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog)	Homo sapiens (Human)	394	460	433	455	23	TQPHFMALLQTHDVVAHEVYSDE	80.05
DP01441	P14921	Protein C-ets-1 (p54)	Homo sapiens (Human)	276	318	282	288	7	SYDSFDS	73.91
DP01442	Q2Q4X9	Seed maturation protein	Medicago truncatula (Barrel medic) (Medicago tribuloides)	1	260	55	74	20	GGVASVMQSAATRNEQAGIV	80.17
DP01442	Q2Q4X9	Seed maturation protein	Medicago truncatula (Barrel medic) (Medicago tribuloides)	1	260	97	105	9	GRRIITETV	79.93
DP01442	Q2Q4X9	Seed maturation protein	Medicago truncatula (Barrel medic) (Medicago tribuloides)	1	260	119	145	27	VQVGLTGAVRESALTIGEALEATAHTV	78.24
DP01442	Q2Q4X9	Seed maturation protein	Medicago truncatula (Barrel medic) (Medicago tribuloides)	1	260	154	165	12	DASAIQAAEVRA	80.71
DP01442	Q2Q4X9	Seed maturation protein	Medicago truncatula (Barrel medic) (Medicago tribuloides)	1	260	167	190	24	GSNVITPGGLASMAQSAAAFNAEC	78.48
DP01442	Q2Q4X9	Seed maturation protein	Medicago truncatula (Barrel medic) (Medicago tribuloides)	1	260	200	208	9	GNVLTGATA	81.27
DP01442	Q2Q4X9	Seed maturation protein	Medicago truncatula (Barrel medic) (Medicago tribuloides)	1	260	222	229	8	AGVASAEM	77.84
DP01442	Q2Q4X9	Seed maturation protein	Medicago truncatula (Barrel medic) (Medicago tribuloides)	1	260	241	255	15	GVAASVAAAARLNEN	77.66
DP01443	Q9UJX4	Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5)	Homo sapiens (Human)	1	26	2	13	12	ASVHESLYFNPM	80.85
DP01443	Q9UJX4	Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5)	Homo sapiens (Human)	1	24	2	13	12	ASVHESLYFNPM	80.85
DP01443	Q9UJX4	Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5)	Homo sapiens (Human)	168	205	174	180	7	DMELTSR	75.25
DP01443	Q9UJX4	Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5)	Homo sapiens (Human)	170	205	174	180	7	DMELTSR	75.25
DP01443	Q9UJX4	Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5)	Homo sapiens (Human)	353	413	357	365	9	SYVLLEHSV	79.82
DP01443	Q9UJX4	Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5)	Homo sapiens (Human)	353	413	367	399	33	KAVHFGLPYLASLGIQSLVQQRAFAGKTANKLM	80.86
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	171	450	172	180	9	SLQNFSNCL	82.72
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	171	450	199	205	7	ETVLTET	75.35
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	171	450	214	242	29	RLNLESSNSKYSLNTDSSVSYIDSAVISP	80.94
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	171	450	249	256	8	TGTSILSK	79.56
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	171	450	293	305	13	GDGSYLQNYTNTP	87.96
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	171	450	329	337	9	TKSVFSQSG	77.26
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	171	450	378	389	12	SSRLFTSDSSTT	77.59
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	171	450	419	445	27	TQPNINDSLEITKLDSSIISEGKISTI	84.45
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	180	447	199	205	7	ETVLTET	75.35
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	180	447	214	242	29	RLNLESSNSKYSLNTDSSVSYIDSAVISP	80.94
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	180	447	249	256	8	TGTSILSK	79.56
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	180	447	293	305	13	GDGSYLQNYTNTP	87.96
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	180	447	329	337	9	TKSVFSQSG	77.26
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	180	447	378	389	12	SSRLFTSDSSTT	77.59
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	180	447	419	442	24	TQPNINDSLEITKLDSSIISEGKI	83.51
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	767	824	771	784	14	ANNQIKEAIDKRYL	78.74
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	767	824	793	799	7	QEEQIMG	80.6
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	769	824	771	784	14	ANNQIKEAIDKRYL	78.74
DP01445	P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	Homo sapiens (Human)	769	824	793	799	7	QEEQIMG	80.6
DP01448	P10923	Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1)	Mus musculus (Mouse)	17	294	38	45	8	PIATWLVP	79.56
DP01448	P10923	Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1)	Mus musculus (Mouse)	17	294	58	64	7	NAVSSEE	75.92
DP01448	P10923	Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1)	Mus musculus (Mouse)	17	294	127	135	9	QADTFTPIV	77.26
DP01448	P10923	Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1)	Mus musculus (Mouse)	17	294	145	154	10	GDSLAYGLRS	81.44
DP01448	P10923	Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1)	Mus musculus (Mouse)	17	294	158	167	10	SFQVSDEQYP	75.12
DP01448	P10923	Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1)	Mus musculus (Mouse)	17	294	187	198	12	LDVIPVAQLLSM	84.75
DP01448	P10923	Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1)	Mus musculus (Mouse)	17	294	238	247	10	SDVIDSQASS	75.25
DP01448	P10923	Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1)	Mus musculus (Mouse)	17	294	276	289	14	RYLKFRISHELESS	79.93
DP01449	Q15637	Splicing factor 1 (Mammalian branch point-binding protein) (BBP) (mBBP) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Zinc finger protein 162)	Homo sapiens (Human)	69	95	83	90	8	PEPIYNSE	77.26
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	49	62	14	CDFNCNHVHSGLKL	75.25
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	70	82	13	RLVSYTPAYLEGS	78.36
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	92	101	10	RLSCIGSPIV	77.26
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	105	112	8	IVQLETES	75.17
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	123	158	36	VQQTLNSTNEIEALETSRLYEDSGYSSFSLQSGLSE	77.08
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	163	182	20	SLLEENFGDSLQSCLLQIQS	79.1
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	193	206	14	PVLHFEKVVCSTLK	76.92
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	219	236	18	MLKEIIARGNFRLQNIIG	87.25
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	242	252	11	ECVDILSELFR	80.24
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	257	285	29	HVLATILAQLSDMDLINVSKVSTTWKKIL	77.65
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	1	318	290	310	21	GAFQLYSKAIQRVTENNNKFS	79.25
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	305	374	314	322	9	STREYVMFR	81.72
DP01450	Q9UKT4	F-box only protein 5 (Early mitotic inhibitor 1)	Homo sapiens (Human)	305	374	352	369	18	KGSTYSRHNEFSEVAKTL	80.79
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	94	126	95	108	14	MEEPINKRLFEKYL	83.42
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	96	126	100	108	9	NKRLFEKYL	86.85
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	96	123	100	108	9	NKRLFEKYL	86.85
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	528	620	529	536	8	DSEAYIGA	88.25
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	528	620	541	552	12	KLKCYDFDVHTM	78.26
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	528	620	554	561	8	TLKNIISP	87.5
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	528	620	564	570	7	DFREFEV	79.93
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	528	620	595	607	13	SLEETFEIEMNES	85.41
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	534	620	541	552	12	KLKCYDFDVHTM	78.26
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	534	620	554	561	8	TLKNIISP	87.5
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	534	620	564	570	7	DFREFEV	79.93
DP01452	Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	Homo sapiens (Human)	534	620	595	607	13	SLEETFEIEMNES	85.41
DP01453	Q8NHZ8	Anaphase-promoting complex subunit CDC26 (Anaphase-promoting complex subunit 12) (APC12) (Cell division cycle protein 26 homolog)	Homo sapiens (Human)	26	85	44	52	9	GEGAIGLSS	82.16
DP01455	Q96DE5	Anaphase-promoting complex subunit 16 (APC16) (Cyclosome subunit 16)	Homo sapiens (Human)	1	51	32	39	8	RKALFTYP	92.1
DP01456	Q01081	Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit)	Homo sapiens (Human)	38	152	42	59	18	FSQTIALLNIYRNPQNSS	79.56
DP01456	Q01081	Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit)	Homo sapiens (Human)	38	152	74	100	27	MQEHYDEFFEEVFTEMEEKYGEVEEMN	82.03
DP01456	Q01081	Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit)	Homo sapiens (Human)	38	152	110	118	9	VGNVYVKFR	88.29
DP01456	Q01081	Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit)	Homo sapiens (Human)	38	152	125	137	13	KAVIDLNNRWFNG	84.02
DP01457	Q92973	Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP)	Homo sapiens (Human)	319	371	319	337	19	SDIDIILLKGDVEEDETIP	79.35
DP01458	Q9Y3B4	Splicing factor 3B subunit 6 (Pre-mRNA branch site protein p14) (SF3b 14 kDa subunit) (SF3B14a) (Spliceosome-associated protein; 14-kDa) (Splicing factor 3b; subunit 6; 14kDa)	Homo sapiens (Human)	100	125	108	118	11	EQLKLLKEKYG	75.07
DP01461	Q13188	Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C)	Homo sapiens (Human)	314	427	321	334	14	LDSHTMVKTSVESV	76.54
DP01461	Q13188	Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C)	Homo sapiens (Human)	314	427	347	371	25	AQTMIEHNSTMLESDLGTMVINSED	79.69
DP01461	Q13188	Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C)	Homo sapiens (Human)	314	427	392	398	7	SFMDYFD	80.17
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	1	300	17	23	7	RNQEIQQ	76.83
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	1	300	31	44	14	SSPLFAEPYKVTSK	74.58
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	1	300	48	60	13	LSSRIQSMLGNYD	82.97
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	1	300	63	77	15	KDFIGDRSIPKLVAI	80.82
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	1	300	86	98	13	ADEKSNPNFFEQR	78.93
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	1	300	152	160	9	DRESYNNSG	76.59
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	1	300	185	193	9	QAVSSLNSS	79.04
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	1	300	216	222	7	PDANWDS	75.92
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	1	300	271	284	14	SSEHYSSQSHGNSM	80.6
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	2	33	17	23	7	RNQEIQQ	76.83
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	300	600	311	323	13	GDVSCVDEILKEM	75.97
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	300	600	473	482	10	QLDNWLNKVN	89.26
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	300	600	510	517	8	GTGNSYTD	79.39
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	300	600	580	588	9	GGLKIESET	80.94
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	600	900	640	647	8	SREIIETD	75.59
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	600	900	684	694	11	EDSFFRQRMFS	79.05
DP01463	Q9UHB7	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	Homo sapiens (Human)	600	900	711	724	14	RYPLIVKIDLNLLT	84.97
DP01464	P28229	Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein)	Mus musculus (Mouse)	265	332	271	283	13	DPGAYNYPFTWNT	80.86
DP01464	P28229	Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein)	Mus musculus (Mouse)	265	332	288	294	7	PGYNIAV	80.27
DP01464	P28229	Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein)	Mus musculus (Mouse)	265	332	297	326	30	DQIQYTELSNAKIAYKQNKANIAQEQQYGS	81.84
DP01464	P28229	Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein)	Mus musculus (Mouse)	362	396	379	385	7	NKSSISS	74.39
DP01465	Q8IW19	Aprataxin and PNK-like factor (EC 3.1.-.-) (Apurinic-apyrimidinic endonuclease APLF) (PNK and APTX-like FHA domain-containing protein) (XRCC1-interacting protein 1)	Homo sapiens (Human)	399	420	400	413	14	GDSDYGGVQIVGQD	83.92
DP01465	Q8IW19	Aprataxin and PNK-like factor (EC 3.1.-.-) (Apurinic-apyrimidinic endonuclease APLF) (PNK and APTX-like FHA domain-containing protein) (XRCC1-interacting protein 1)	Homo sapiens (Human)	450	511	458	470	13	QPNEYDLNDSFLD	79.73
DP01465	Q8IW19	Aprataxin and PNK-like factor (EC 3.1.-.-) (Apurinic-apyrimidinic endonuclease APLF) (PNK and APTX-like FHA domain-containing protein) (XRCC1-interacting protein 1)	Homo sapiens (Human)	450	511	495	506	12	EDVEELLKEAKR	74.69
DP01466	A4L7I2	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1664	1687	24	VQEVSTTTSLTHSQFDLSADGETL	75.38
DP01466	A4L7I2	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1707	1730	24	GAVHTLPTIIGNLAAVSDWVMSTV	78.02
DP01466	A4L7I2	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1740	1748	9	GRNLTVTCD	75.92
DP01466	A4L7I2	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1750	1756	7	REGNITP	85.28
DP01466	A4L7I2	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1758	1767	10	ASVRFFRAEL	78.23
DP01466	A4L7I2	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1770	1776	7	AVQETAE	80.27
DP01466	A4L7I2	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1778	1786	9	RDTAISLQA	78.6
DP01466	A4L7I2	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1806	1836	31	ETFPITFGDFDEGEIESLSSELLTFGDFLPG	77.79
DP01467	Q9SP32	Endoribonuclease Dicer homolog 1 (EC 3.1.26.-) (Dicer-like protein 1) (AtDCL1) (Protein ABNORMAL SUSPENSOR 1) (Protein CARPEL FACTORY) (Protein SHORT INTEGUMENTS 1) (Protein SUSPENSOR 1)	Arabidopsis thaliana (Mouse-ear cress)	1732	1811	1743	1753	11	QQQAEGLEYKA	75.19
DP01467	Q9SP32	Endoribonuclease Dicer homolog 1 (EC 3.1.26.-) (Dicer-like protein 1) (AtDCL1) (Protein ABNORMAL SUSPENSOR 1) (Protein CARPEL FACTORY) (Protein SHORT INTEGUMENTS 1) (Protein SUSPENSOR 1)	Arabidopsis thaliana (Mouse-ear cress)	1732	1811	1761	1778	18	TVEVFIDGVQVGVAQNPQ	86.81
DP01467	Q9SP32	Endoribonuclease Dicer homolog 1 (EC 3.1.26.-) (Dicer-like protein 1) (AtDCL1) (Protein ABNORMAL SUSPENSOR 1) (Protein CARPEL FACTORY) (Protein SHORT INTEGUMENTS 1) (Protein SUSPENSOR 1)	Arabidopsis thaliana (Mouse-ear cress)	1732	1811	1781	1806	26	MAQKLAARNALAALKEKEIAESKEKH	76.65
DP01468	A3RMR8	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1664	1687	24	VQEVSTTTSLTHSQFDLSADGETL	75.38
DP01468	A3RMR8	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1707	1730	24	GAVHTLPTIIGNLAAVSDWVMSTV	78.02
DP01468	A3RMR8	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1740	1748	9	GRNLTVTCD	75.92
DP01468	A3RMR8	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1750	1756	7	REGNITP	85.28
DP01468	A3RMR8	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1758	1767	10	ASVRFFRAEL	78.23
DP01468	A3RMR8	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1770	1776	7	AVQETAE	80.27
DP01468	A3RMR8	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1778	1786	9	RDTAISLQA	78.6
DP01468	A3RMR8	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1806	1836	31	ETFPITFGDFDEGEIESLSSELLTFGDFLPG	77.79
DP01469	A4L7I4	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1664	1687	24	VQEVSTTTSLTHSQFDLSADGETL	75.38
DP01469	A4L7I4	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1707	1730	24	GAVHTLPTIIGNLAAVSDWVMSTV	78.02
DP01469	A4L7I4	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1740	1748	9	GRNLTVTCD	75.92
DP01469	A4L7I4	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1750	1756	7	REGNITP	85.28
DP01469	A4L7I4	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1758	1767	10	ASVRFFRAEL	78.23
DP01469	A4L7I4	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1770	1776	7	AVQETAE	80.27
DP01469	A4L7I4	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1778	1786	9	RDTAISLQA	78.6
DP01469	A4L7I4	Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1)	Chikungunya virus (CHIKV)	1658	1856	1806	1836	31	ETFPITFGDFDEGEIESLSSELLTFGDFLPG	77.79
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	46	56	11	DICVLQPIKFK	74.79
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	61	84	24	RDITFDGEQAIKEDNSHYEDLYHS	83.74
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	96	105	10	DDLLILNMED	79.83
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	111	120	10	HHLLSDSSEA	74.58
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	125	139	15	EGEHISSIPTRGEIA	78.06
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	155	168	14	SDVTTERDYVKLLD	79.93
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	189	198	10	NEKEITNFSD	76.82
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	208	261	54	MLALTDNQIAIQKDSKRKIIEKAINEVPYRTNEEWETQLLSKGNINKSNEKIIT	82.74
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	273	291	19	SGNSIERINEMVSKICLQR	84.74
DP01471	P36118	Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	322	297	305	9	RLQALEKTK	75.1
DP01472	Q6GX35	Translocated actin-recruiting phosphoprotein (Tarp protein)	Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)	726	825	760	766	7	LDVVYPG	91.97
DP01472	Q6GX35	Translocated actin-recruiting phosphoprotein (Tarp protein)	Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)	726	825	776	786	11	LQANQTLGDIV	75.92
DP01472	Q6GX35	Translocated actin-recruiting phosphoprotein (Tarp protein)	Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)	726	825	794	800	7	TSQETVV	73.91
DP01473	Q96GU1	P antigen family member 5 (PAGE-5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate-associated gene 5 protein)	Homo sapiens (Human)	20	130	35	41	7	NDQESSQ	76.25
DP01473	Q96GU1	P antigen family member 5 (PAGE-5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate-associated gene 5 protein)	Homo sapiens (Human)	20	130	43	49	7	VGPVIVQ	73.91
DP01473	Q96GU1	P antigen family member 5 (PAGE-5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate-associated gene 5 protein)	Homo sapiens (Human)	20	130	86	101	16	DVEAFQQELALLKIED	84.74
DP01474	P06748	Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)	Homo sapiens (Human)	1	130	13	25	13	RPQNYLFGCELKA	87.27
DP01474	P06748	Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)	Homo sapiens (Human)	1	130	39	51	13	EHQLSLRTVSLGA	73.91
DP01474	P06748	Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)	Homo sapiens (Human)	1	130	55	69	15	DELHIVEAEAMNYEG	79.62
DP01474	P06748	Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)	Homo sapiens (Human)	1	130	72	82	11	IKVTLATLKMS	76.71
DP01474	P06748	Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)	Homo sapiens (Human)	1	130	90	96	7	GGFEITP	81.94
DP01474	P06748	Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)	Homo sapiens (Human)	1	130	107	122	16	GPVHISGQHLVAVEED	83.11
DP01474	P06748	Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)	Homo sapiens (Human)	159	294	251	257	7	MQASIEK	75.68
DP01474	P06748	Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)	Homo sapiens (Human)	159	294	264	275	12	VEAKFINYVKNC	93.87
DP01474	P06748	Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)	Homo sapiens (Human)	159	294	280	289	10	DQEAIQDLWQ	81.84
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	1	23	2	11	10	TNETIDQTRT	85.62
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	222	302	227	234	8	SDVKEAIN	83.36
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	222	302	244	251	8	DIATTTTD	75.25
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	222	302	265	275	11	ERGNFSKFTLG	87.72
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	222	302	284	297	14	GVADIDPNYKFNQL	78.33
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	510	536	510	518	9	NFKYTNASK	82.61
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	824	876	838	853	16	NSELYQSVKNSVNKTL	91.97
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	824	876	857	871	15	GLSGIEATALAKNFS	80.94
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	877	1186	877	889	13	LNEKFKNFNNNNN	80.52
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	877	1186	908	938	31	GQVASPEEPIYTQVAKKVNAKIDRLNQIASG	79.63
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	877	1186	961	976	16	KVGLSASPEPIYATID	81.19
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	877	1186	1001	1031	31	NQELAQKIDNLNQAVSEAKAGFFGNLEQTID	80.82
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	877	1186	1040	1049	10	NVMNLYVESA	85.45
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	877	1186	1059	1084	26	KLDNYAINSHTRINSNIQNGAINEKA	78.81
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	877	1186	1099	1107	9	VNDKIVAHN	78.82
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	877	1186	1109	1124	16	GSVSLSEYDKIGFNQK	85.58
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	877	1186	1131	1167	37	DSFKFSTKLNNAVKDIKSGFTHFLANAFSTGYYCLAR	81.2
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	893	1001	908	938	31	GQVASPEEPIYTQVAKKVNAKIDRLNQIASG	79.63
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	893	1001	961	976	16	KVGLSASPEPIYATID	81.19
DP01475	P55980	Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26)	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	998	1038	1001	1031	31	NQELAQKIDNLNQAVSEAKAGFFGNLEQTID	80.82
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	802	815	14	HFGTTTVISESTYP	79.19
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	832	844	13	YGNVTVTESYTTS	78.54
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	861	873	13	NVVVTERVVGPIS	74.86
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	889	900	12	GSNVIVTERVIA	80.04
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	919	939	21	NVVVTERVIQPTSGMIGSLSM	77.61
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	943	954	12	LANAHNVIVTER	78.09
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	978	984	7	GLVGTSM	74.15
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	1000	1013	14	GIGLSSLGGTASIG	80.12
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	1019	1029	11	SDHHFNQTIGS	84.65
DP01476	Q02413	Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen)	Homo sapiens (Human)	774	1049	1038	1044	7	RITKYST	80.7
DP01478	Q9UJX5	Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4)	Homo sapiens (Human)	480	521	494	505	12	GNQWYDFLQNSS	84.39
DP01478	Q9UJX5	Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4)	Homo sapiens (Human)	480	521	510	516	7	SPLLFPY	82.32
DP01478	Q9UJX5	Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4)	Homo sapiens (Human)	758	808	767	803	37	KPVKIKEEVLSESEAENQQAGAAALAPEIVIKVEKLD	79.28
DP01479	Q9UJX3	Anaphase-promoting complex subunit 7 (APC7) (Cyclosome subunit 7)	Homo sapiens (Human)	1	35	4	23	20	GDAAILESSLRILYRLFESV	80.17
DP01479	Q9UJX3	Anaphase-promoting complex subunit 7 (APC7) (Cyclosome subunit 7)	Homo sapiens (Human)	541	599	586	594	9	AAQWADQEQ	80.9
DP01481	Q5UPT2	Probable uracil-DNA glycosylase (UDG) (EC 3.2.2.-)	Acanthamoeba polyphaga mimivirus (APMV)	1	94	18	44	27	PPSIFSSDNEENSDVDNSVIINDKNTK	85.22
DP01482	O13828	mRNA decapping complex subunit 2 (EC 3.-.-.-)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	553	741	556	566	11	SAQLLQALLHP	77.74
DP01482	O13828	mRNA decapping complex subunit 2 (EC 3.-.-.-)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	553	741	580	592	13	SDSLSLLTLLKSG	79.73
DP01482	O13828	mRNA decapping complex subunit 2 (EC 3.-.-.-)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	553	741	600	609	10	LQNKSQNNER	74.58
DP01482	O13828	mRNA decapping complex subunit 2 (EC 3.-.-.-)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	553	741	613	627	15	SQVKELEVKNYSKST	77.39
DP01482	O13828	mRNA decapping complex subunit 2 (EC 3.-.-.-)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	553	741	645	654	10	AANQFDLLKV	75.72
DP01482	O13828	mRNA decapping complex subunit 2 (EC 3.-.-.-)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	553	741	695	701	7	GFVKILK	97.99
DP01482	O13828	mRNA decapping complex subunit 2 (EC 3.-.-.-)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	553	741	721	736	16	SDDHFLSYLQSVVSSN	80.27
DP01484	P04626	Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340)	Homo sapiens (Human)	988	1255	1000	1011	12	LDSTFYRSLLED	75.95
DP01484	P04626	Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340)	Homo sapiens (Human)	988	1255	1019	1031	13	DAEEYLVPQQGFF	87.96
DP01484	P04626	Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340)	Homo sapiens (Human)	988	1255	1057	1065	9	GDLTLGLEP	77.26
DP01484	P04626	Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340)	Homo sapiens (Human)	988	1255	1108	1114	7	PLQRYSE	75.35
DP01484	P04626	Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340)	Homo sapiens (Human)	988	1255	1126	1132	7	GYVAPLT	73.91
DP01484	P04626	Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340)	Homo sapiens (Human)	988	1255	1182	1198	17	KDVFAFGGAVENPEYLT	91.11
DP01484	P04626	Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340)	Homo sapiens (Human)	988	1255	1216	1225	10	AFDNLYYWDQ	81.67
DP01485	P40161	Histone chaperone RTT106 (Regulator of Ty1 transposition protein 106)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	43	67	55	62	8	IDVSSDLL	75.25
DP01486	P11912	B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a)	Homo sapiens (Human)	166	226	178	203	26	AGDEYEDENLYEGLNLDDCSMYEDIS	84.41
DP01486	P11912	B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a)	Homo sapiens (Human)	166	226	206	221	16	LQGTYQDVGSLNIGDV	87.44
DP01487	P40259	B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b)	Homo sapiens (Human)	181	229	192	214	23	EDHTYEGLDIDQTATYEDIVTLR	80.11
DP01487	P40259	B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b)	Homo sapiens (Human)	181	229	216	222	7	GEVKWSV	87.29
DP01488	P69346	Antitoxin YefM	Escherichia coli (strain K12)	1	83	2	17	16	RTISYSEARQNLSATM	80.25
DP01488	P69346	Antitoxin YefM	Escherichia coli (strain K12)	1	83	25	32	8	APILITRQ	87.63
DP01488	P69346	Antitoxin YefM	Escherichia coli (strain K12)	1	83	36	57	22	ACVLMSLEEYNSLEETAYLLRS	79.89
DP01488	P69346	Antitoxin YefM	Escherichia coli (strain K12)	1	55	2	17	16	RTISYSEARQNLSATM	80.25
DP01488	P69346	Antitoxin YefM	Escherichia coli (strain K12)	1	55	25	32	8	APILITRQ	87.63
DP01488	P69346	Antitoxin YefM	Escherichia coli (strain K12)	1	55	36	50	15	ACVLMSLEEYNSLEE	80.78
DP01489	Q9UBK2	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6)	Homo sapiens (Human)	2	220	8	26	19	QDSESVWSDIECAALVGED	76.62
DP01489	Q9UBK2	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6)	Homo sapiens (Human)	2	220	48	101	54	TDSFLGGLKWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPV	79.44
DP01489	Q9UBK2	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6)	Homo sapiens (Human)	2	220	109	120	12	FDALTDGDVTTD	82.27
DP01489	Q9UBK2	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6)	Homo sapiens (Human)	2	220	153	161	9	NTQLSYNEC	93.94
DP01489	Q9UBK2	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6)	Homo sapiens (Human)	2	220	163	173	11	GLSTQNHANHN	73.91
DP01489	Q9UBK2	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6)	Homo sapiens (Human)	2	220	178	197	20	TNPAIVKTENSWSNKAKSIC	78.08
DP01489	Q9UBK2	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6)	Homo sapiens (Human)	2	220	209	215	7	ELLKYLT	80.32
DP01490	Q9NR61	Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4)	Homo sapiens (Human)	553	685	567	589	23	AMNNLSDFQKDNLIPAAQLKNTN	79.69
DP01490	Q9NR61	Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4)	Homo sapiens (Human)	553	685	607	618	12	KQQNHTLDYNLA	82.22
DP01490	Q9NR61	Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4)	Homo sapiens (Human)	553	685	662	680	19	RDSMYQSVCLISEERNECV	82.27
DP01491	P22059	Oxysterol-binding protein 1	Homo sapiens (Human)	346	379	354	368	15	DDENEFFDAPEIITM	76.95
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1259	1265	7	SLQELDQ	75.25
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1270	1282	13	VAVSSNASTTKYP	80.27
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1300	1318	19	RQHSYDTFVDLQKEEAALA	75.66
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1336	1342	7	YAHMFEM	75.92
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1345	1358	14	GESSFANKSSVTTA	82.61
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1381	1390	10	TQNPFIPTFG	76.66
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1392	1406	15	DQCLLHGSKSYFFRQ	76.25
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1420	1433	14	RALVTNKPVVSALH	75.25
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1442	1453	12	KDICIGNQSNPC	74.72
DP01492	Q01097	Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B)	Mus musculus (Mouse)	1259	1482	1459	1477	19	NPRAFNGSSNGHVYEKLSS	76.13
DP01494	Q9VMA3	Protein cup (Oskar ribonucleoprotein complex 147 kDa subunit)	Drosophila melanogaster (Fruit fly)	340	361	347	353	7	SKESFVM	74.58
DP01495	P08510	Potassium voltage-gated channel protein Shaker (Protein minisleep)	Drosophila melanogaster (Fruit fly)	513	655	550	557	8	AVAPFLGA	77.26
DP01495	P08510	Potassium voltage-gated channel protein Shaker (Protein minisleep)	Drosophila melanogaster (Fruit fly)	513	655	566	574	9	ASSLSMSID	76.37
DP01495	P08510	Potassium voltage-gated channel protein Shaker (Protein minisleep)	Drosophila melanogaster (Fruit fly)	513	655	581	592	12	LQQLTQTQLYQQ	83.19
DP01495	P08510	Potassium voltage-gated channel protein Shaker (Protein minisleep)	Drosophila melanogaster (Fruit fly)	513	655	599	605	7	QQQNGFK	75.35
DP01495	P08510	Potassium voltage-gated channel protein Shaker (Protein minisleep)	Drosophila melanogaster (Fruit fly)	513	655	612	633	22	QQQLQQQQSHTINASAAAATSG	77.38
DP01495	P08510	Potassium voltage-gated channel protein Shaker (Protein minisleep)	Drosophila melanogaster (Fruit fly)	513	655	643	650	8	HNNALAVS	79.01
DP01496	P0AFG0	Transcription termination/antitermination protein NusG	Escherichia coli (strain K12)	45	65	48	54	7	EVVEIRG	86.96
DP01497	Q9NK80	Gliotactin	Drosophila melanogaster (Fruit fly)	750	956	756	773	18	SDRFYDEDVFINGEGLEP	79.28
DP01497	Q9NK80	Gliotactin	Drosophila melanogaster (Fruit fly)	750	956	794	803	10	SRDNIYEYRD	87.16
DP01497	Q9NK80	Gliotactin	Drosophila melanogaster (Fruit fly)	750	956	866	876	11	QNGSIAKVASP	79.93
DP01498	O70480	Vesicle-associated membrane protein 4 (VAMP-4)	Mus musculus (Mouse)	47	117	55	77	23	HVQNQVDEVIDVMQENITKVIER	76.92
DP01498	O70480	Vesicle-associated membrane protein 4 (VAMP-4)	Mus musculus (Mouse)	47	117	88	102	15	SESLSDNATAFSNRS	78.17
DP01499	Q9JI51	Vesicle transport through interaction with t-SNAREs homolog 1A (Vesicle transport v-SNARE protein Vti1-like 2) (Vti1-rp2)	Rattus norvegicus (Rat)	115	192	139	162	24	LEAGYQIAVETEQIGQEMLENLSH	77.76
DP01499	Q9JI51	Vesicle transport through interaction with t-SNAREs homolog 1A (Vesicle transport v-SNARE protein Vti1-like 2) (Vti1-rp2)	Rattus norvegicus (Rat)	115	192	177	187	11	TDANLGKSSRI	75.19
DP01500	Q5R6Q2	Syntaxin-6	Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)	169	232	170	216	47	DEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLD	75.61
DP01501	G3V7P1	Syntaxin-12 (Syntaxin-13)	Rattus norvegicus (Rat)	182	250	184	210	27	RETAIQQLEADILDVNQIFKDLAMMIH	83.1
DP01501	G3V7P1	Syntaxin-12 (Syntaxin-13)	Rattus norvegicus (Rat)	182	250	212	233	22	QGDLIDSIEANVESSEVHVERA	79.81
DP01501	G3V7P1	Syntaxin-12 (Syntaxin-13)	Rattus norvegicus (Rat)	182	250	238	245	8	QRAAYYQK	90.84
DP01502	P33328	Synaptobrevin homolog 2	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	91	24	50	27	SQNKTAALRQEIDDTVGIMRDNINKVA	78.74
DP01502	P33328	Synaptobrevin homolog 2	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	91	64	74	11	DNLAISAQGFK	83.31
DP01503	P32867	Protein SSO1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	192	265	197	233	37	HQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDK	80.73
DP01504	P39926	Protein SSO2	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	196	269	201	237	37	HQELLKLEKTMAELTQLFNDMEELVIEQQENVDVIDK	79.92
DP01504	P39926	Protein SSO2	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	196	269	249	260	12	GVGHTNKAVKSA	76.42
DP01505	P0AGB6	ECF RNA polymerase sigma-E factor (RNA polymerase sigma-E factor) (Sigma-24)	Escherichia coli (strain K12)	67	90	67	85	19	DSAFYTWLYRIAVNTAKNY	86.36
DP01508	Q15418	Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1)	Homo sapiens (Human)	683	735	697	709	13	AMAATYSALNSSK	80.96
DP01508	Q15418	Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1)	Homo sapiens (Human)	683	735	717	723	7	IESSILA	76.11
DP01508	Q15418	Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1)	Homo sapiens (Human)	696	735	697	709	13	AMAATYSALNSSK	80.96
DP01508	Q15418	Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1)	Homo sapiens (Human)	696	735	717	723	7	IESSILA	76.11
DP01509	P9WIP5	Protein MbtH	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	71	9	33	25	DNGAFFVLVNDEDQHSLWPVFADIP	78.1
DP01509	P9WIP5	Protein MbtH	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	71	46	59	14	AACLDYVEKNWTDL	79.62
DP01511	P32917	Protein STE5	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	147	238	171	185	15	SFLNASCTLCDEPIS	75.83
DP01511	P32917	Protein STE5	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	147	238	189	202	14	KGEKIIELACGHLS	79.38
DP01511	P32917	Protein STE5	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	147	238	204	215	12	QECLIISFGTTS	81.58
DP01511	P32917	Protein STE5	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	147	238	219	226	8	VRALFPFC	83.28
DP01512	P03050	Transcriptional repressor arc	Salmonella phage P22 (Bacteriophage P22)	1	53	8	14	7	PQFNLRW	74.58
DP01512	P03050	Transcriptional repressor arc	Salmonella phage P22 (Bacteriophage P22)	1	53	33	39	7	VNSEIYQ	91.3
DP01513	P53378	Tubulin gamma chain (Gamma-tubulin)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	439	473	441	463	23	EQDSYLDDVLVDDENMVGELEED	76.79
DP01516	Q06810	Protein OPY2 (Overproduction-induced pheromone-resistant protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	194	333	195	206	12	RASNILPIAYIP	83.97
DP01516	Q06810	Protein OPY2 (Overproduction-induced pheromone-resistant protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	194	333	234	246	13	IRSHITLGSSILD	77.08
DP01516	Q06810	Protein OPY2 (Overproduction-induced pheromone-resistant protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	194	333	255	262	8	HNQVLNKD	77.05
DP01516	Q06810	Protein OPY2 (Overproduction-induced pheromone-resistant protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	194	333	264	273	10	DDNLITAIRA	81.47
DP01516	Q06810	Protein OPY2 (Overproduction-induced pheromone-resistant protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	194	333	276	301	26	KLVQIAEEESDKEIQDLDVIEEQTEA	80.89
DP01517	Q06710	Paired box protein Pax-8	Homo sapiens (Human)	1	27	16	22	7	LGGAFVN	80.41
DP01517	Q06710	Paired box protein Pax-8	Homo sapiens (Human)	62	86	62	70	9	LGRYYETGS	84.62
DP01518	P26367	Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin)	Homo sapiens (Human)	1	130	11	19	9	LGGVFVNGR	75.55
DP01518	P26367	Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin)	Homo sapiens (Human)	1	130	25	35	11	TRQKIVELAHS	83.76
DP01518	P26367	Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin)	Homo sapiens (Human)	1	130	41	67	27	DISRILQVSNGCVSKILGRYYETGSIR	81.95
DP01518	P26367	Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin)	Homo sapiens (Human)	1	130	83	125	43	VVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINR	84.68
DP01519	A0A060ZAA1	HTH_Tnp_Tc3_2 domain-containing protein	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	50	106	83	96	14	TKVSISTVKRVLYR	83.11
DP01520	Q02297	Pro-neuregulin-1; membrane-bound isoform (Pro-NRG1) Cleaved into: Neuregulin-1 (Acetylcholine receptor-inducing activity) (ARIA) (Breast cancer cell differentiation factor p45) (Glial growth factor) (Heregulin) (HRG) (Neu differentiation factor) (Sensory and motor neuron-derived factor)	Homo sapiens (Human)	1	75	50	56	7	GLVGLAV	74.58
DP01521	Q5RJL0	Ermin (Juxtanodin) (JN)	Rattus norvegicus (Rat)	1	282	37	44	8	ETQTYYGV	91.56
DP01521	Q5RJL0	Ermin (Juxtanodin) (JN)	Rattus norvegicus (Rat)	1	282	73	111	39	EDEKILNENTEENLFVVHQAIQDLSLQETSAEDTVFQEG	78.52
DP01521	Q5RJL0	Ermin (Juxtanodin) (JN)	Rattus norvegicus (Rat)	1	282	147	170	24	AHQATEIEWLGFQKSSQVDILHSK	78.11
DP01521	Q5RJL0	Ermin (Juxtanodin) (JN)	Rattus norvegicus (Rat)	1	282	174	186	13	EEEVWNEEINEED	84.82
DP01521	Q5RJL0	Ermin (Juxtanodin) (JN)	Rattus norvegicus (Rat)	1	282	198	205	8	EVRVIEFK	79.35
DP01521	Q5RJL0	Ermin (Juxtanodin) (JN)	Rattus norvegicus (Rat)	1	282	249	265	17	ARNSYSRYNTISYRKIR	82.33
DP01524	Q9UM11	Fizzy-related protein homolog (Fzr) (CDC20-like protein 1) (Cdh1/Hct1 homolog) (hCDH1)	Homo sapiens (Human)	1	41	9	21	13	LLRQIVIQNENTM	81.53
DP01526	Q9UJX6	Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2)	Homo sapiens (Human)	731	822	748	784	37	EEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTG	81.34
DP01526	Q9UJX6	Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2)	Homo sapiens (Human)	731	822	786	803	18	ALAEIDLQELQGYLQKKV	82.55
DP01526	Q9UJX6	Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2)	Homo sapiens (Human)	731	822	805	817	13	DQQLVYSAGVYRL	83.66
DP01527	Q57904	Uncharacterized protein MJ0480	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	46	101	60	69	10	EIQEFQVKFK	86.19
DP01527	Q57904	Uncharacterized protein MJ0480	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	46	101	84	96	13	EQQRIMQLNAELM	80.24
DP01528	P15273	Tyrosine-protein phosphatase YopH (EC 3.1.3.48) (Virulence protein)	Yersinia enterocolitica	20	50	29	45	17	GNVAANKETTFQGLTIA	80.88
DP01531	O75554	WW domain-binding protein 4 (WBP-4) (Formin-binding protein 21) (WW domain-containing-binding protein 4)	Homo sapiens (Human)	276	376	296	309	14	EWQEIKQEVESHEE	76.92
DP01531	O75554	WW domain-binding protein 4 (WBP-4) (Formin-binding protein 21) (WW domain-containing-binding protein 4)	Homo sapiens (Human)	276	376	317	326	10	TENEYVSTSE	79.67
DP01531	O75554	WW domain-binding protein 4 (WBP-4) (Formin-binding protein 21) (WW domain-containing-binding protein 4)	Homo sapiens (Human)	276	376	340	347	8	KTVTSLGV	77.26
DP01533	Q9NS23	Ras association domain-containing protein 1	Homo sapiens (Human)	1	50	9	22	14	FEMTWSSTTSSGYC	74.39
DP01533	Q9NS23	Ras association domain-containing protein 1	Homo sapiens (Human)	1	50	30	41	12	ELEQYFTARTSL	83.47
DP01534	Q07889	Son of sevenless homolog 1 (SOS-1)	Homo sapiens (Human)	1141	1300	1223	1230	8	PDVFSSSP	74.46
DP01534	Q07889	Son of sevenless homolog 1 (SOS-1)	Homo sapiens (Human)	1141	1300	1244	1251	8	HGNAFFPN	79.01
DP01535	B6KJB6	Putative transmembrane protein	Toxoplasma gondii (strain ATCC 50861 / VEG)	337	542	360	368	9	GSTAFSTRP	79.93
DP01535	B6KJB6	Putative transmembrane protein	Toxoplasma gondii (strain ATCC 50861 / VEG)	337	542	375	388	14	LEGLTQETVEMLLD	75.18
DP01535	B6KJB6	Putative transmembrane protein	Toxoplasma gondii (strain ATCC 50861 / VEG)	337	542	412	420	9	SQHLEARLS	73.91
DP01535	B6KJB6	Putative transmembrane protein	Toxoplasma gondii (strain ATCC 50861 / VEG)	337	542	459	465	7	LASGYRN	73.91
DP01535	B6KJB6	Putative transmembrane protein	Toxoplasma gondii (strain ATCC 50861 / VEG)	337	542	491	499	9	SQHLEARLS	73.91
DP01537	O00429	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	Homo sapiens (Human)	514	613	559	570	12	TTGNWRGMLKTS	74.58
DP01537	O00429	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	Homo sapiens (Human)	514	613	572	579	8	AEELLAEE	82.61
DP01537	O00429	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	Homo sapiens (Human)	514	613	595	602	8	HAVNLLDV	83.53
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	9	19	11	AEQLENLNIQD	80.15
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	22	43	22	KQAATGSESQSVENSSASLYVG	82.56
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	51	69	19	EAHLYDIFSPIGSVSSIRV	78.65
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	77	88	12	TSLGYAYVNFND	91.14
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	95	103	9	AIEQLNYTP	79.82
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	107	115	9	RLCRIMWSQ	77.26
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	124	133	10	GSGNIFIKNL	86.76
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	139	158	20	NKALYDTFSVFGDILSSKIA	82.66
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	166	199	34	KGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA	87.98
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	214	252	39	TKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEK	84.93
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	259	268	10	KGFGFVNYEK	78.09
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	275	291	17	AVEALNDSELNGEKLYV	84.38
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	307	330	24	QYEAYRLEKMAKYQGVNLFVKNLD	82.68
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	338	351	14	LEEEFAPYGTITSA	78.36
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	362	372	11	KGFGFVCFSTP	80.18
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	375	397	23	ATKAITEKNQQIVAGKPLYVAIA	84.5
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	407	438	32	LAQQIQARNQMRYQQATAAAAAAAAGMPGQFM	83.42
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	495	503	9	NDNNQFYQQ	84.17
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	526	537	12	AAGKITGMILDL	81.05
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	548	557	10	SDELFEQHYK	87.56
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	577	559	567	9	ASAAYESFK	82.76
DP01538	P04147	Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	419	502	419	438	20	YQQATAAAAAAAAGMPGQFM	85.95
DP01539	O57173	Protein F1	Vaccinia virus (strain Ankara) (VACV)	1	50	1	37	37	MLSMFMCNNIVDYVDGIVQDIEDEASNNVDHDYVYPL	82.63
DP01540	O00429	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	Homo sapiens (Human)	503	610	504	515	12	ACGLMNNNIEEQ	76.25
DP01540	O00429	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	Homo sapiens (Human)	503	610	550	561	12	AASAEADGKLIQ	78.26
DP01540	O00429	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	Homo sapiens (Human)	503	610	585	596	12	TTGNWRGMLKTS	74.58
DP01540	O00429	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	Homo sapiens (Human)	503	610	598	605	8	AEELLAEE	82.61
DP01541	Q9DBZ9	Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1)	Mus musculus (Mouse)	1	267	68	78	11	TRGAYLQSLEP	76.04
DP01541	Q9DBZ9	Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1)	Mus musculus (Mouse)	1	267	107	115	9	AGEIWYNPI	78.26
DP01541	Q9DBZ9	Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1)	Mus musculus (Mouse)	1	267	130	136	7	SQLASSE	79.93
DP01541	Q9DBZ9	Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1)	Mus musculus (Mouse)	1	267	197	205	9	AGSVISRYR	79.93
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	47	60	14	EVSAIPISLDGLLF	77.64
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	76	88	13	DQQSLSDVEGAYS	83.35
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	111	120	10	LDSVLDTLLA	75.32
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	133	144	12	ACEVTSSWCLFG	80.27
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	192	199	8	ARQLLLPA	75.5
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	216	224	9	AAAVEVEEE	75.25
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	300	309	10	VMDFIHVPIL	78.7
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	312	330	19	NHALLAARTRQLLEDESYD	77.01
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	370	381	12	KDDAYPLYSDFQ	80.52
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	446	453	8	ASVSSASS	75.25
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	457	465	9	TLECILYKA	86.55
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	521	546	26	PQLGYQAAVLKEGLPQVYPPYLNYLR	77.08
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	1	566	555	561	7	PQYSFES	76.45
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	545	192	199	8	ARQLLLPA	75.5
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	545	216	224	9	AAAVEVEEE	75.25
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	545	300	309	10	VMDFIHVPIL	78.7
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	545	312	330	19	NHALLAARTRQLLEDESYD	77.01
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	545	370	381	12	KDDAYPLYSDFQ	80.52
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	545	446	453	8	ASVSSASS	75.25
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	545	457	465	9	TLECILYKA	86.55
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	545	521	540	20	PQLGYQAAVLKEGLPQVYPP	76.22
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	535	192	199	8	ARQLLLPA	75.5
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	535	216	224	9	AAAVEVEEE	75.25
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	535	300	309	10	VMDFIHVPIL	78.7
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	535	312	330	19	NHALLAARTRQLLEDESYD	77.01
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	535	370	381	12	KDDAYPLYSDFQ	80.52
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	535	446	453	8	ASVSSASS	75.25
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	535	457	465	9	TLECILYKA	86.55
DP01542	P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	Homo sapiens (Human)	165	535	521	530	10	PQLGYQAAVL	75.25
DP01544	Q8WV28	B-cell linker protein (B-cell adapter containing a SH2 domain protein) (B-cell adapter containing a Src homology 2 domain protein) (Cytoplasmic adapter protein) (Src homology 2 domain-containing leukocyte protein of 65 kDa) (SLP-65)	Homo sapiens (Human)	5	50	28	37	10	NEGGIMNKIK	77.93
DP01546	P84051	Histone H2A	Drosophila melanogaster (Fruit fly)	94	124	105	117	13	GGVLPNIQAVLLP	79.52
DP01547	P29274	Adenosine receptor A2a	Homo sapiens (Human)	291	311	295	304	10	FRQTFRKIIR	79.43
DP01547	P29274	Adenosine receptor A2a	Homo sapiens (Human)	293	412	295	304	10	FRQTFRKIIR	79.43
DP01547	P29274	Adenosine receptor A2a	Homo sapiens (Human)	293	412	316	326	11	AAGTSARVLAA	75.59
DP01547	P29274	Adenosine receptor A2a	Homo sapiens (Human)	293	412	331	338	8	GEQVSLRL	75.25
DP01547	P29274	Adenosine receptor A2a	Homo sapiens (Human)	293	412	382	390	9	DVELLSHEL	75.03
DP01547	P29274	Adenosine receptor A2a	Homo sapiens (Human)	293	320	295	304	10	FRQTFRKIIR	79.43
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1020	1029	10	HLSTSSVFHE	77.63
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1046	1069	24	GTVLTRSTFISNVLSKIGEVWASH	81.74
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1073	1081	9	NGVSLFNSP	83.65
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1098	1116	19	LPEAFVGTPISNTSQRISR	78.1
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1129	1137	9	SQCLEFIQQ	81.57
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1144	1151	8	LCLLSSSL	80.27
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1168	1182	15	SELLLLETPLIVKKA	78.82
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1184	1199	16	SLALSATSSGFAEFTP	85.2
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1232	1238	7	TRISFME	77.93
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1242	1251	10	NTHWTDRATD	74.58
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1254	1263	10	NTKAFVSTSF	78.83
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1279	1287	9	DKNTYFPLD	76.44
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1295	1303	9	KVVAESLAT	79.93
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1324	1333	10	SDQTSLEYHD	78.26
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1354	1367	14	STELTTNSTLQTER	79.91
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1392	1401	10	AAVEAFSELS	79.93
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1409	1418	10	AEASFAVSSV	81.47
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1442	1449	8	RTSILTAD	76.88
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1453	1469	17	SVANTVADVESSGSTSS	81.45
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1480	1496	17	GQKLTLNLKEDEIEAHV	75.72
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1519	1547	29	EIHLIGCENLEVQNSEEEAKNLSFDELYP	81.39
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1551	1566	16	EKLEYNLSTIEQQFCD	83.05
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1581	1598	18	VDGELFVAQSNFTLILEG	81.42
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1660	1674	15	VKVAIAENLLDVIKD	79.75
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1692	1710	19	DGAVIVSKAAHSSRLTNST	79.97
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1720	1726	7	ETVNTSQ	75.97
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1740	1750	11	QHALSLNVTSE	76.35
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1868	1875	8	GQSTEILD	75.5
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1887	1915	29	GTVTELRNANLEDTQNMEYKQDEHSDQQL	77.51
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	1927	1935	9	VSVSSVTEE	74.58
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	2000	2008	9	NVSTLEKSV	74.58
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	2013	2022	10	KEAALVVTSK	77.59
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	2057	2068	12	RDGLLAAAALTP	76.14
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	2080	2087	8	TMLLTDIS	79.93
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	2116	2133	18	AQLKELVSDLSSQFVVSP	77.7
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	2139	2153	15	RQKSISNTSKLLGEL	79.4
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	2158	2165	8	KPLEIIEQ	79.81
DP01548	Q8CJF7	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Mus musculus (Mouse)	1018	2243	2214	2223	10	KTAEIAGKTL	82.94
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1020	1029	10	HLSTSSVFRL	75.22
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1041	1069	29	KQVVTGTVLTRSVFINNVLSKIGEVWASK	79.78
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1076	1084	9	TPFNSSKIE	78.37
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1087	1095	9	SPIVYSLPA	80.45
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1098	1106	9	LPEAFFGTP	77.63
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1110	1118	9	ASQKISRLL	86.96
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1130	1150	21	QCSEFIQQSSMKSPLYLVSRS	76.03
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1170	1176	7	LHLLETP	74.58
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1186	1204	19	AMSVTTSGFSEFTPQSILR	81.17
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1229	1237	9	TRISFVEED	79.93
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1251	1258	8	KLEVFTTP	77.17
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1265	1272	8	VETEWLKS	75.59
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1276	1284	9	TTSFFLNSP	81.42
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1295	1302	8	SQSLEKLD	73.91
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1308	1323	16	SSVSITSDETTLEYQD	82.73
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1329	1339	11	DLEETVFTASK	79.08
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1344	1355	12	STALTTNVTEQT	77.09
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1361	1368	8	KDVFASEV	75.5
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1389	1402	14	LVAAEAFSELNHLS	83.76
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1404	1425	22	VQGTEASLCAPSVYEGKIFTQK	77.29
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1436	1446	11	TSVETYTPAIR	88.2
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1448	1473	26	NDNKSMADVLGDGGNSSLTISEGPIV	80.94
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1480	1488	9	QEVALNLKE	79.41
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1516	1530	15	DTQEIHVIEQEKLEA	79.69
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1537	1548	12	ARNLSFNELYPS	83.53
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1551	1568	18	LKLQYNFDTIDQQFCDLA	84.26
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1574	1598	25	AECDIAEVDGELFVAQSNFTLILEG	81
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1606	1612	7	GDFASSD	84.62
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1616	1630	15	KAANTATEEKLVCSG	79.93
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1634	1652	19	NHGQIANLPSAVTSDQKSQ	77.82
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1664	1678	15	IKVAIAENLLDVIKD	79.4
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1689	1698	10	MEQSIHETIP	78.33
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1700	1706	7	VSQNIMC	79.22
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1709	1723	15	KLVKSAFKTAQETST	79.22
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1732	1738	7	DDVVSSK	76.92
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1743	1764	22	GQRIQNVNVKSAQQEASADVAT	77.06
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1778	1793	16	KAKEISEASENIYSDV	87.33
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1799	1807	9	NQQIPQNSV	73.91
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1816	1838	23	KEVNQDILENTSSVEQELQITTG	77.55
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1846	1859	14	SSQLLEPAVEETTK	75.2
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1883	1899	17	ESVEIINDLKVSTVTSP	96.38
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	1950	1970	21	EDSNLESSQLTVQAEFDMSAI	80.57
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	2035	2044	10	NEELSMVMSS	80.27
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	2083	2093	11	RLLATASFTKS	76.31
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	2101	2109	9	SSKAILLPD	74.47
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	2138	2155	18	AQLKELVSDLSSQFVISP	81.74
DP01549	Q8WYP5	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	Homo sapiens (Human)	1018	2266	2179	2186	8	AQSVETLG	75.96
DP01554	P23443	Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (p70 S6K-alpha) (p70 S6KA)	Homo sapiens (Human)	422	525	422	430	9	VKEKFSFEP	75.85
DP01554	P23443	Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (p70 S6K-alpha) (p70 S6KA)	Homo sapiens (Human)	422	525	454	467	14	GDFWGRGASASTAN	75.82
DP01554	P23443	Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (p70 S6K-alpha) (p70 S6KA)	Homo sapiens (Human)	422	525	484	494	11	MDVTMSGEASA	77.26
DP01554	P23443	Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (p70 S6K-alpha) (p70 S6KA)	Homo sapiens (Human)	422	525	507	515	9	KKQAFPMIS	77.93
DP01555	Q9EPU7	Zinc finger protein 354C (Protein AJ18)	Rattus norvegicus (Rat)	4	91	12	31	20	EPVTFRDVAVSFSQDEWLHL	77.91
DP01555	Q9EPU7	Zinc finger protein 354C (Protein AJ18)	Rattus norvegicus (Rat)	4	91	34	60	27	AQRTLYREVMLENYSNLASLGFQASIP	79.76
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	246	12	32	21	EPVTFEDVTLGFTPEEWGLLD	76.56
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	246	35	57	23	QKSLYREVMLENYRNLVSVEHQL	80.17
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	246	64	75	12	SQLEEAEDFWPV	75.75
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	246	104	120	17	PLMNIEVVEVLTLNQEV	79.97
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	246	125	140	16	NAQIQALYAEDGSLSA	82
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	246	186	192	7	CHQWLQP	76.78
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	246	197	214	18	KEQILELLVLEQFLGALP	80.43
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	246	216	224	9	KLRTWVESQ	75.92
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	246	231	241	11	EVVALVEGVTW	82.24
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	77	12	32	21	EPVTFEDVTLGFTPEEWGLLD	76.56
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	77	35	57	23	QKSLYREVMLENYRNLVSVEHQL	80.17
DP01556	Q96GC6	Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)	Homo sapiens (Human)	4	77	64	72	9	SQLEEAEDF	75.59
DP01557	P27682	Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide	Rattus norvegicus (Rat)	25	210	60	74	15	AHQAMNLVGPQSIEG	76.54
DP01557	P27682	Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide	Rattus norvegicus (Rat)	25	210	79	102	24	GLQHLGPFGNIPNIVAELTGDNIP	80.49
DP01557	P27682	Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide	Rattus norvegicus (Rat)	25	210	134	150	17	DTAEFSREFQLDQHLFD	82.41
DP01557	P27682	Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide	Rattus norvegicus (Rat)	25	210	157	170	14	GLGKWNKKLLYEKM	78.4
DP01558	Q9XTY3	C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2)	Caenorhabditis elegans	17	211	19	41	23	GLDLENAGDFVLPSGDFIDLISR	76.24
DP01558	Q9XTY3	C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2)	Caenorhabditis elegans	17	211	48	58	11	DLSSFGVKHIS	80.27
DP01558	Q9XTY3	C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2)	Caenorhabditis elegans	17	211	64	78	15	GEQKLLEEDNFQERQ	76.45
DP01558	Q9XTY3	C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2)	Caenorhabditis elegans	17	211	105	128	24	GCLEEFENSAEFSRNYQADQHCIC	78.92
DP01558	Q9XTY3	C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2)	Caenorhabditis elegans	17	211	130	137	8	QEHMFNCA	77.17
DP01558	Q9XTY3	C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2)	Caenorhabditis elegans	17	211	142	167	26	QDVSESLQKILEENNMHANTIAKKFH	82.75
DP01559	Q04964	Ribonucleotide reductase inhibitor protein SML1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	104	3	14	12	NSQDYFYAQNRC	81.86
DP01559	Q04964	Ribonucleotide reductase inhibitor protein SML1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	104	27	34	8	TMAEFRRV	76.25
DP01559	Q04964	Ribonucleotide reductase inhibitor protein SML1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	104	54	67	14	SASASASSLEMWEK	75.32
DP01559	Q04964	Ribonucleotide reductase inhibitor protein SML1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	104	88	99	12	GELKSMFNQGKV	78.37
DP01560	Q9UMR2	ATP-dependent RNA helicase DDX19B (EC 3.6.4.13) (DEAD box RNA helicase DEAD5) (DEAD box protein 19B)	Homo sapiens (Human)	55	91	57	82	26	AAQSLLNKLIRSNLVDNTNQVEVLQR	77.49
DP01561	P08235	Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)	Homo sapiens (Human)	1	169	20	30	11	GQVSQAVERSS	75.25
DP01561	P08235	Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)	Homo sapiens (Human)	1	169	38	60	23	DENNYMEIVNVSCVSGAIPNNST	80.06
DP01561	P08235	Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)	Homo sapiens (Human)	1	169	82	110	29	GILTSDIKTELESKELSATVAESMGLYMD	81.59
DP01561	P08235	Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)	Homo sapiens (Human)	1	169	115	147	33	ADYSYEQQNQQGSMSPAKIYQNVEQLVKFYKGN	79.18
DP01561	P08235	Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)	Homo sapiens (Human)	1	169	155	164	10	SCVNTPLRSF	77.26
DP01561	P08235	Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)	Homo sapiens (Human)	247	385	268	274	7	MKSSISS	74.2
DP01561	P08235	Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)	Homo sapiens (Human)	247	385	299	307	9	SPANINNSR	79.82
DP01561	P08235	Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)	Homo sapiens (Human)	247	385	329	335	7	TVGSICS	80.27
DP01561	P08235	Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)	Homo sapiens (Human)	247	385	337	355	19	VNNAFSYTASGTSAGSSTL	91.04
DP01562	Q9Z1X4	Interleukin enhancer-binding factor 3	Mus musculus (Mouse)	468	518	499	506	8	VEAVSNPS	73.91
DP01565	Q9GSG7	AAEL000395-PB (Ultraspiracle isoform-B)	Aedes aegypti (Yellowfever mosquito) (Culex aegypti)	1	112	8	16	9	FDAALVGHM	79.93
DP01565	Q9GSG7	AAEL000395-PB (Ultraspiracle isoform-B)	Aedes aegypti (Yellowfever mosquito) (Culex aegypti)	1	112	31	43	13	DISLLNGSVGPFS	86.29
DP01565	Q9GSG7	AAEL000395-PB (Ultraspiracle isoform-B)	Aedes aegypti (Yellowfever mosquito) (Culex aegypti)	1	112	52	77	26	SPGAFNQQVAAALQQQQQNVNSLNSQ	77.18
DP01567	B9UCQ5	Ultraspiracle isoform 1	Helicoverpa armigera (Cotton bollworm) (Heliothis armigera)	1	58	9	17	9	GLNLEGGFM	75.7
DP01569	P34021	Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1)	Drosophila melanogaster (Fruit fly)	2	226	17	31	15	LPSHILLQQQLAASA	76.63
DP01569	P34021	Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1)	Drosophila melanogaster (Fruit fly)	2	226	44	54	11	SAALTLHVASA	77.74
DP01569	P34021	Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1)	Drosophila melanogaster (Fruit fly)	2	226	96	111	16	SSVATVVAPAATTTSN	79.93
DP01569	P34021	Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1)	Drosophila melanogaster (Fruit fly)	2	226	140	149	10	LDVTEDWMST	76.32
DP01569	P34021	Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1)	Drosophila melanogaster (Fruit fly)	2	226	168	180	13	SQNHSYNMSNGYA	76.07
DP01569	P34021	Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1)	Drosophila melanogaster (Fruit fly)	2	226	184	192	9	SAGSYDPYS	80.27
DP01569	P34021	Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1)	Drosophila melanogaster (Fruit fly)	2	226	207	217	11	SLNGYSANESC	75.68
DP01570	P12931	Proto-oncogene tyrosine-protein kinase Src (EC 2.7.10.2) (Proto-oncogene c-Src) (pp60c-src) (p60-Src)	Homo sapiens (Human)	1	84	28	36	9	GGGAFPASQ	75.92
DP01570	P12931	Proto-oncogene tyrosine-protein kinase Src (EC 2.7.10.2) (Proto-oncogene c-Src) (pp60c-src) (p60-Src)	Homo sapiens (Human)	1	84	50	57	8	PSAAFAPA	74.16
DP01570	P12931	Proto-oncogene tyrosine-protein kinase Src (EC 2.7.10.2) (Proto-oncogene c-Src) (pp60c-src) (p60-Src)	Homo sapiens (Human)	1	84	63	76	14	LFGGFNSSDTVTSP	76.42
DP01571	Q88QP8	Elongation factor Tu-A (EF-Tu-A)	Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)	40	62	40	51	12	FGSAIVEFDKID	84.7
DP01574	C6KSX0	Merozoite surface protein P12 Cleaved into: Merozoite surface protein P12; processed form	Plasmodium falciparum (isolate 3D7)	84	116	96	108	13	KIKEFVIGSSMFM	80.91
DP01576	O14777	Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC)	Homo sapiens (Human)	1	79	16	32	17	MQELRSQDVNKQGLYTP	82.47
DP01576	O14777	Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC)	Homo sapiens (Human)	1	79	39	46	8	TFGKLSIN	79.1
DP01578	P41969	ETS domain-containing protein Elk-1	Mus musculus (Mouse)	320	429	376	387	12	SIHFWSTLSPIA	82.41
DP01578	P41969	ETS domain-containing protein Elk-1	Mus musculus (Mouse)	320	429	392	401	10	AKLSFQFPSS	76.59
DP01578	P41969	ETS domain-containing protein Elk-1	Mus musculus (Mouse)	320	429	404	421	18	AQVHIPSISVDGLSTPVV	79.04
DP01578	P41969	ETS domain-containing protein Elk-1	Mus musculus (Mouse)	320	428	376	387	12	SIHFWSTLSPIA	82.41
DP01578	P41969	ETS domain-containing protein Elk-1	Mus musculus (Mouse)	320	428	392	401	10	AKLSFQFPSS	76.59
DP01578	P41969	ETS domain-containing protein Elk-1	Mus musculus (Mouse)	320	428	404	421	18	AQVHIPSISVDGLSTPVV	79.04
DP01579	P34233	Transcriptional regulatory protein ASH1 (Daughter cells HO repressor protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	420	500	457	465	9	NYHRFALDS	77.26
DP01579	P34233	Transcriptional regulatory protein ASH1 (Daughter cells HO repressor protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	420	500	474	480	7	SNSSITK	79.93
DP01581	Q8NQJ3	Oxoglutarate dehydrogenase inhibitor	Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025)	1	40	10	31	22	PQVETTSVFRADLLKEMESSTG	76.95
DP01582	Q868N5	Vitellogenin	Apis mellifera (Honeybee)	336	385	340	357	18	TAMNSNQIVSDNSLSSSE	76.87
DP01582	Q868N5	Vitellogenin	Apis mellifera (Honeybee)	336	385	361	380	20	KQDILNLRTDISSSSSSISS	77.46
DP01582	Q868N5	Vitellogenin	Apis mellifera (Honeybee)	358	392	361	387	27	KQDILNLRTDISSSSSSISSSEENDFW	77.7
DP01584	P19880	AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	565	650	571	579	9	NADKINNGN	76.37
DP01584	P19880	AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	565	650	597	615	19	RCSEIWDRITTHPKYSDID	75.81
DP01584	P19880	AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	565	650	632	645	14	RGVVINAEDVQLAL	82.11
DP01588	P52799	Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L)	Homo sapiens (Human)	253	300	266	273	8	TLSLSTLA	78.01
DP01588	P52799	Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L)	Homo sapiens (Human)	253	300	287	293	7	SDIIIPL	88.29
DP01590	Q92945	Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75)	Homo sapiens (Human)	130	218	145	151	7	MTEEYRV	79.93
DP01590	Q92945	Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75)	Homo sapiens (Human)	130	218	155	171	17	MVGLIIGRGGEQINKIQ	88.94
DP01592	Q8VHC5	Calcium-binding protein 4 (CaBP4)	Mus musculus (Mouse)	100	120	104	115	12	AQRTYGPLLNRM	87.29
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	96	235	113	144	32	SHVLMNSGKLINGKRYFGRALELPEVKEWLKQ	77.86
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	96	235	150	157	8	DGGSINTK	77.93
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	96	235	163	170	8	RNDFYYHG	78.14
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	96	235	173	192	20	TAALTEFEANWTSILKAHYN	78.58
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	96	235	205	211	7	QTQEIHV	79.93
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	96	235	216	223	8	DMEHWLVQ	79.35
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	97	235	113	144	32	SHVLMNSGKLINGKRYFGRALELPEVKEWLKQ	77.86
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	97	235	150	157	8	DGGSINTK	77.93
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	97	235	163	170	8	RNDFYYHG	78.14
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	97	235	173	192	20	TAALTEFEANWTSILKAHYN	78.58
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	97	235	205	211	7	QTQEIHV	79.93
DP01593	P21374	Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	97	235	216	223	8	DMEHWLVQ	79.35
DP01594	Q80ZV0	Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B)	Mus musculus (Mouse)	103	145	118	132	15	VDDTFPDCTLLLRFP	75.01
DP01594	Q80ZV0	Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B)	Mus musculus (Mouse)	182	266	187	218	32	QSSAYFSGGQVSRDKEEDYVRYAHGLISDYIP	79.08
DP01594	Q80ZV0	Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B)	Mus musculus (Mouse)	182	266	224	231	8	DLSKFLKL	85.28
DP01594	Q80ZV0	Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B)	Mus musculus (Mouse)	182	202	187	197	11	QSSAYFSGGQV	77.87
DP01594	Q80ZV0	Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B)	Mus musculus (Mouse)	283	308	293	302	10	SIDAFFGAKN	76.32
DP01600	Q93KQ4	Regulatory protein YscM2 (YscM2)	Yersinia enterocolitica	51	81	51	71	21	YAVLEHAKNTILNRQDVAKLL	77.69
DP01601	P26599	Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I)	Homo sapiens (Human)	143	184	147	157	11	AQAALQAVNSV	83.67
DP01601	P26599	Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I)	Homo sapiens (Human)	143	184	160	170	11	GNLALAASAAA	79.2
DP01601	P26599	Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I)	Homo sapiens (Human)	411	458	442	451	10	GSKNFQNIFP	89.03
DP01601	P26599	Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I)	Homo sapiens (Human)	431	454	442	449	8	GSKNFQNI	88.29
DP01602	Q86WV6	Stimulator of interferon genes protein (hSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (hMITA) (Transmembrane protein 173)	Homo sapiens (Human)	344	379	361	367	7	PELLISG	78.64
DP01602	Q86WV6	Stimulator of interferon genes protein (hSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (hMITA) (Transmembrane protein 173)	Homo sapiens (Human)	359	379	361	367	7	PELLISG	78.64
DP01604	Q12483	Vacuolar-sorting protein SNF8 (ESCRT-II complex subunit VPS22) (Vacuolar protein-sorting-associated protein 22)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	22	5	17	13	GLAAFDELKDGKY	89.55
DP01606	Q06208	Protein RIF2 (RAP1-interacting factor 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	152	186	160	180	21	KECIESMGQASYSGQLDFEAS	77.69
DP01607	P29539	Telomere length regulator protein RIF1 (RAP1-interacting factor 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1773	1856	1799	1812	14	MTENTNINAQNGLD	78.21
DP01607	P29539	Telomere length regulator protein RIF1 (RAP1-interacting factor 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1773	1856	1823	1836	14	KHHEIQLGQAHTEA	74.75
DP01607	P29539	Telomere length regulator protein RIF1 (RAP1-interacting factor 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1773	1856	1844	1851	8	GDGNEDAT	73.58
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	1	11	11	MEYWHYVETTS	83.31
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	22	40	19	KDIFIDQSVGLYHGKSKIL	80.88
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	44	59	16	RGRIFLTSQRIIYIDD	87.96
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	66	96	31	SLGLELDDLAYVNYSSGFLTRSPRLILFFKD	79.72
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	112	136	25	ADVVSTWVCPICMVSNETQGEFTKD	81.61
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	140	147	8	TPICINCG	76.25
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	150	166	17	ADYELTKSSINCSNAID	77.89
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	175	192	18	FGVNSENICPACTFANHP	82
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	195	201	7	GNCEICG	84.95
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	215	236	22	NRLNFHDSRVHIELEKNSLARN	77.42
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	251	261	11	SSTEFVQLSFR	81.12
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	264	298	35	DGVLFSQATERALENILTEKNKHIFNQNVVSVNGV	80.11
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	305	329	25	SSHEYNNEVPFIETKLSRIGISSLE	76.55
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	333	371	39	ENQLLNNDILFNNALTDLNKLMSLATSIERLYKNSNITM	78.47
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	395	374	386	13	KTLNLQDESTVNE	74.68
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	177	205	178	192	15	NSENICPACTFANHP	83.21
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	203	395	215	236	22	NRLNFHDSRVHIELEKNSLARN	77.42
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	203	395	251	261	11	SSTEFVQLSFR	81.12
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	203	395	264	298	35	DGVLFSQATERALENILTEKNKHIFNQNVVSVNGV	80.11
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	203	395	305	329	25	SSHEYNNEVPFIETKLSRIGISSLE	76.55
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	203	395	333	371	39	ENQLLNNDILFNNALTDLNKLMSLATSIERLYKNSNITM	78.47
DP01611	Q06696	Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	203	395	374	386	13	KTLNLQDESTVNE	74.68
DP01613	Q96AC1	Fermitin family homolog 2 (Kindlin-2) (Mitogen-inducible gene 2 protein) (MIG-2) (Pleckstrin homology domain-containing family C member 1) (PH domain-containing family C member 1)	Homo sapiens (Human)	328	367	332	340	9	SENHLNNSD	78.15
DP01613	Q96AC1	Fermitin family homolog 2 (Kindlin-2) (Mitogen-inducible gene 2 protein) (MIG-2) (Pleckstrin homology domain-containing family C member 1) (PH domain-containing family C member 1)	Homo sapiens (Human)	328	367	346	359	14	VDAALSDLEITLEG	76.02
DP01616	P10104	Fibritin (Collar protein) (Whisker antigen control protein)	Enterobacteria phage T4 (Bacteriophage T4)	372	484	374	391	18	GLNNAVQNLQVEIGNNSA	77.37
DP01616	P10104	Fibritin (Collar protein) (Whisker antigen control protein)	Enterobacteria phage T4 (Bacteriophage T4)	372	484	395	408	14	GQVVALNTLVNGTN	80.22
DP01616	P10104	Fibritin (Collar protein) (Whisker antigen control protein)	Enterobacteria phage T4 (Bacteriophage T4)	372	484	419	448	30	LTNSIKANETNIASVTQEVNTAKGNISSLQ	79.02
DP01616	P10104	Fibritin (Collar protein) (Whisker antigen control protein)	Enterobacteria phage T4 (Bacteriophage T4)	372	484	450	461	12	DVQALQEAGYIP	79.38
DP01616	P10104	Fibritin (Collar protein) (Whisker antigen control protein)	Enterobacteria phage T4 (Bacteriophage T4)	372	484	466	479	14	DGQAYVRKDGEWVF	87.48
DP01618	P03070	Large T antigen (LT) (LT-AG) (EC 3.6.4.-)	Simian virus 40 (SV40)	82	130	82	109	28	EIPTYGTDEWEQWWNAFNEENLFCSEEM	79.61
DP01621	E5LC01	LANA	"Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)"	1065	1117	1073	1080	8	ARLAWEAS	79.31
DP01621	E5LC01	LANA	"Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)"	1065	1117	1083	1095	13	LAGNLQSSIVKFK	85.34
DP01622	Q06609	DNA repair protein RAD51 homolog 1 (HsRAD51) (hRAD51) (RAD51 homolog A)	Homo sapiens (Human)	86	114	95	105	11	RRSEIIQITTG	79.75
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	10	21	12	KTAHFENGSTSS	74.41
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	26	38	13	KQSSLLSFFSKQV	77.72
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	54	65	12	TLENTATDKITK	77.76
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	72	79	8	TGKLFVDV	80.94
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	83	100	18	NDLTIAEETVSTVRSDIM	79.34
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	109	117	9	TMLNSNTTE	77.15
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	150	156	7	SDTTFTA	80.27
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	169	175	7	DEDEYLP	75.92
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	204	215	12	DDDLISLAETTS	78.79
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	217	227	11	KKFSYNTSHSS	77.14
DP01623	Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	304	265	282	18	KSSKFNKQNEERYQWLVD	80.92
DP01624	Q06433	Galactose/lactose metabolism regulatory protein GAL80	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	328	362	339	345	7	GAAAIKD	86.96
DP01626	Q01831	DNA repair protein complementing XP-C cells (Xeroderma pigmentosum group C-complementing protein) (p125)	Homo sapiens (Human)	815	940	818	834	17	KDVLLTAWENEQAVIER	80.68
DP01626	Q01831	DNA repair protein complementing XP-C cells (Xeroderma pigmentosum group C-complementing protein) (p125)	Homo sapiens (Human)	815	940	844	859	16	ALGNWKLLAKGLLIRE	78.43
DP01626	Q01831	DNA repair protein complementing XP-C cells (Xeroderma pigmentosum group C-complementing protein) (p125)	Homo sapiens (Human)	815	940	895	906	12	EAARILAASWPQ	79.65
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	100	7	20	14	KEYFELIRKALNEK	91.38
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	100	49	55	7	TGLNELP	74.58
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	100	57	66	10	ESVVTVNLDS	80.5
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	100	69	75	7	DGVVTVP	75.92
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	100	79	95	17	SVEEIQSSEEDYDSEEF	82.77
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	633	754	645	657	13	ALESWNTLLLKLR	78.21
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	633	754	661	673	13	KLNSTYGKIAEEE	85.95
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	633	754	678	706	29	KEQNIADNHDNTETFMGGGFLPGIANHEA	90.37
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	633	754	717	724	8	DSLDYVSV	76.42
DP01628	P14736	DNA repair protein RAD4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	633	754	736	749	14	VGEDYSDFMKELEM	76.54
DP01629	P32628	UV excision repair protein RAD23	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	265	219	234	16	EDDLFAQAAQGGNASS	75.96
DP01629	P32628	UV excision repair protein RAD23	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	265	236	245	10	ALGTTGGATD	74.58
DP01629	P32628	UV excision repair protein RAD23	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	265	254	260	7	SIGLTVE	80.51
DP01629	P32628	UV excision repair protein RAD23	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	230	254	236	245	10	ALGTTGGATD	74.58
DP01631	P07276	DNA repair protein RAD2 (EC 3.1.-.-)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	642	760	662	673	12	LEVLSEELFEDV	84.56
DP01631	P07276	DNA repair protein RAD2 (EC 3.1.-.-)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	642	760	700	739	40	KPLIFDYDFSEDEEDNIVENMIKEQEEFDTFKNTTLSTSA	78.78
DP01631	P07276	DNA repair protein RAD2 (EC 3.1.-.-)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	642	760	741	755	15	RNVAENAFVEDELFE	83.03
DP01631	P07276	DNA repair protein RAD2 (EC 3.1.-.-)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	642	690	662	673	12	LEVLSEELFEDV	84.56
DP01637	Q8NI22	Multiple coagulation factor deficiency protein 2 (Neural stem cell-derived neuronal survival protein)	Homo sapiens (Human)	27	66	29	35	7	PAASFSQ	79.41
DP01637	Q8NI22	Multiple coagulation factor deficiency protein 2 (Neural stem cell-derived neuronal survival protein)	Homo sapiens (Human)	27	66	48	61	14	DQEHIMEHLEGVIN	88.82
DP01639	P17778	Outer membrane protein YopM	Yersinia pestis	1	33	7	15	9	NVSNTFLQE	78.97
DP01639	P17778	Outer membrane protein YopM	Yersinia pestis	1	33	19	26	8	HSSNLTEM	73.91
DP01640	Q13351	Krueppel-like factor 1 (Erythroid krueppel-like transcription factor) (EKLF)	Homo sapiens (Human)	51	90	69	84	16	ADATWDLDLLLTNFSG	81.02
DP01642	P06492	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)	350	394	369	382	14	TKNNYGSTIEGLLD	80.27
DP01642	P06492	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)	403	490	416	427	12	TDVSLGDELHLD	74.94
DP01642	P06492	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)	403	490	471	485	15	ADFEFEQMFTDALGI	77.86
DP01642	P06492	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)	412	490	416	427	12	TDVSLGDELHLD	74.94
DP01642	P06492	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)	412	490	471	485	15	ADFEFEQMFTDALGI	77.86
DP01642	P06492	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)	452	490	471	485	15	ADFEFEQMFTDALGI	77.86
DP01642	P06492	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)	456	490	471	485	15	ADFEFEQMFTDALGI	77.86
DP01645	P20239	Zona pellucida sperm-binding protein 2 (Zona pellucida glycoprotein 2) (Zp-2) (Zona pellucida protein A) Cleaved into: Processed zona pellucida sperm-binding protein 2	Mus musculus (Mouse)	563	584	563	570	8	LDNYRTTF	74.41
DP01647	P51449	Nuclear receptor ROR-gamma (Nuclear receptor RZR-gamma) (Nuclear receptor subfamily 1 group F member 3) (RAR-related orphan receptor C) (Retinoid-related orphan receptor-gamma)	Homo sapiens (Human)	479	518	482	512	31	RLQIFQHLHPIVVQAAFPPLYKELFSTETES	86.63
DP01654	P36578	60S ribosomal protein L4 (60S ribosomal protein L1) (Large ribosomal subunit protein uL4)	Homo sapiens (Human)	80	114	88	96	9	GQGAFGNMC	80.16
DP01657	Q5XJY5	Coatomer subunit delta (Archain) (Delta-coat protein) (Delta-COP)	Mus musculus (Mouse)	166	232	182	190	9	GFGGFGSSA	75.92
DP01657	Q5XJY5	Coatomer subunit delta (Archain) (Delta-coat protein) (Delta-COP)	Mus musculus (Mouse)	166	232	196	208	13	TAAMITETIIETD	80.29
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	99	1	13	13	MALLSEELSSILP	81.22
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	99	20	28	9	EEEDYVERE	75.25
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	99	37	43	7	IGVKFHI	79.93
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	99	65	77	13	AFPEIHVAQYPLD	75.25
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	99	86	94	9	SAGNTLALQ	78.78
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	100	315	102	109	8	DYNAIARQ	91.97
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	100	315	116	126	11	LVQASFRDLIP	80.27
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	100	315	132	138	7	GVGEISL	77.78
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	100	315	156	168	13	ALQKILSKQIAQS	78.47
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	100	315	180	188	9	DPVYIRYTP	85.95
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	100	315	192	205	14	MGQALSKQRIIKMV	82.04
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	100	315	254	260	7	SISNWKN	84.62
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	100	315	280	301	22	NDVEINDGFAKFSEALYTVERQ	90.57
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	100	315	304	310	7	EEVRYRA	80.32
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	316	557	325	333	9	EQRLFMLAQ	78.52
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	316	557	368	376	9	RAGSFSHHS	77.26
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	316	557	443	457	15	SDTMIDSRLFNQASG	76.45
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	316	557	464	473	10	DEDSYNVYDK	85.52
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	316	557	499	514	16	ELERITSESRYDVLGN	77.34
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	316	557	531	540	10	GPVTFEKDIA	85.62
DP01658	Q09882	Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	316	557	544	552	9	GVDTFLNNV	79.19
DP01661	P70444	BH3-interacting domain death agonist (p22 BID) (BID) Cleaved into: BH3-interacting domain death agonist p15 (p15 BID); BH3-interacting domain death agonist p13 (p13 BID); BH3-interacting domain death agonist p11 (p11 BID)	Mus musculus (Mouse)	41	81	43	51	9	PVQAYWEAD	79.26
DP01661	P70444	BH3-interacting domain death agonist (p22 BID) (BID) Cleaved into: BH3-interacting domain death agonist p15 (p15 BID); BH3-interacting domain death agonist p13 (p13 BID); BH3-interacting domain death agonist p11 (p11 BID)	Mus musculus (Mouse)	41	81	63	73	11	ASRSFNQGRIE	78.72
DP01664	Q9I9C0	Prion protein	Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta)	25	142	112	118	7	GGTNFKN	77.26
DP01665	Q5S1W7	Prion protein (Fragment)	Xenopus laevis (African clawed frog)	1	69	11	24	14	GGWNTGSNRNPNYP	80.94
DP01665	Q5S1W7	Prion protein (Fragment)	Xenopus laevis (African clawed frog)	1	69	36	46	11	GQQPYNPSGYN	87.29
DP01667	Q548Y4	Nuclear transcription factor RelA (V-rel reticuloendotheliosis viral oncogene homolog A (Avian))	Mus musculus (Mouse)	426	490	437	445	9	ALLHLQFDA	77.07
DP01667	Q548Y4	Nuclear transcription factor RelA (V-rel reticuloendotheliosis viral oncogene homolog A (Avian))	Mus musculus (Mouse)	426	490	450	457	8	GALLGNST	76.17
DP01667	Q548Y4	Nuclear transcription factor RelA (V-rel reticuloendotheliosis viral oncogene homolog A (Avian))	Mus musculus (Mouse)	426	490	463	484	22	TDLASVDNSEFQQLLNQGVSMS	78.09
DP01671	P71590	FHA domain-containing protein FhaA	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	32	19	27	9	VGDAFARIF	82.65
DP01675	O75928	E3 SUMO-protein ligase PIAS2 (EC 2.3.2.-) (Androgen receptor-interacting protein 3) (ARIP3) (DAB2-interacting protein) (DIP) (E3 SUMO-protein transferase PIAS2) (Msx-interacting zinc finger protein) (Miz1) (PIAS-NY protein) (Protein inhibitor of activated STAT x) (Protein inhibitor of activated STAT2)	Homo sapiens (Human)	427	488	456	462	7	VTVASEA	77.26
DP01675	O75928	E3 SUMO-protein ligase PIAS2 (EC 2.3.2.-) (Androgen receptor-interacting protein 3) (ARIP3) (DAB2-interacting protein) (DIP) (E3 SUMO-protein transferase PIAS2) (Msx-interacting zinc finger protein) (Miz1) (PIAS-NY protein) (Protein inhibitor of activated STAT x) (Protein inhibitor of activated STAT2)	Homo sapiens (Human)	427	488	466	481	16	KVDVIDLTIESSSDEE	87.1
DP01677	P06454	Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1	Homo sapiens (Human)	1	111	8	15	8	TSSEITTK	74.79
DP01677	P06454	Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1	Homo sapiens (Human)	1	111	22	29	8	EVVEEAEN	75.92
DP01677	P06454	Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1	Homo sapiens (Human)	1	111	36	44	9	NGNAENEEN	75.51
DP01705	Q07666	KH domain-containing; RNA-binding; signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68)	Homo sapiens (Human)	135	156	141	151	11	DEENYLDLFSH	84.98
DP01705	Q07666	KH domain-containing; RNA-binding; signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68)	Homo sapiens (Human)	390	419	392	400	9	GDSEYYDYG	80.3
DP01705	Q07666	KH domain-containing; RNA-binding; signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68)	Homo sapiens (Human)	390	419	404	414	11	VQDSYEAYGQD	85.8
DP01716	P0AD49	Ribosome-associated inhibitor A	Escherichia coli (strain K12)	91	113	102	108	7	KDANFVE	86.77
DP01724	O95644	Nuclear factor of activated T-cells; cytoplasmic 1 (NF-ATc1) (NFATc1) (NFAT transcription complex cytosolic component) (NF-ATc) (NFATc)	Homo sapiens (Human)	435	458	438	446	9	HRAHYETEG	75.92
DP01731	O75143	Autophagy-related protein 13	Homo sapiens (Human)	384	517	384	398	15	QVTLTSLDIPFAMFA	77.39
DP01731	O75143	Autophagy-related protein 13	Homo sapiens (Human)	384	517	443	450	8	DFVMIDFK	91.97
DP01731	O75143	Autophagy-related protein 13	Homo sapiens (Human)	384	517	462	471	10	DLGTFYREFQ	79.77
DP01731	O75143	Autophagy-related protein 13	Homo sapiens (Human)	384	517	476	489	14	LSSLSIDIGAQSMA	79.5
DP01731	O75143	Autophagy-related protein 13	Homo sapiens (Human)	384	517	505	512	8	NVREFDAF	81.1
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	270	276	7	NDELFSA	78.93
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	329	340	12	HQVQTQQQRQIP	77.26
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	352	358	7	RANSFEP	79.93
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	390	398	9	SNSSFFNQP	79.08
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	405	420	16	MSSNYGPQMNIEGTSV	79.14
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	422	434	13	STSKYSSSFGNIR	83.53
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	467	474	8	DFVKLLEE	80.6
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	487	504	18	NPPNINISDSLIRYQNLK	80.01
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	507	518	12	NDLLSEDLSVSL	79.63
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	545	552	8	HYGSLNSR	73.91
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	558	564	7	NASHLIA	85.52
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	571	578	8	STSALNSR	75.59
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	607	622	16	HDNKIQKYNQLGVEED	93.48
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	627	646	20	NDRLLNQMGNSATKFKSSIS	78.73
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	649	661	13	SIDSISSSFIKSR	79.29
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	696	706	11	NRSNSNNNNHN	74.25
DP01732	Q06628	Autophagy-related protein 13	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	268	738	723	733	11	DDLVFFMSDMN	80.3
DP01737	P9WKX3	Bacterial proteasome activator	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	35	2	9	8	VIGLSTGS	79.93
DP01737	P9WKX3	Bacterial proteasome activator	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	35	13	19	7	DVEVIGG	74.87
DP01737	P9WKX3	Bacterial proteasome activator	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	35	21	30	10	DPRLIAVQEN	74.85
DP01737	P9WKX3	Bacterial proteasome activator	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	14	35	21	30	10	DPRLIAVQEN	74.85
DP01742	Q8NM20	Uncharacterized protein	Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025)	52	89	60	70	11	AAVSEAEQIRQ	77.38
DP01744	Q07528	Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	5	17	13	NDVQENAKLNSET	76.25
DP01744	Q07528	Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	28	40	13	GTTEYVAEAEISK	85.21
DP01744	Q07528	Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	66	80	15	ELVHTALLEKDNPFM	76.23
DP01744	Q07528	Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	90	96	7	SALLEIP	86.1
DP01744	Q07528	Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	133	146	14	LSGSINSMNGETSA	77.69
DP01748	P05556	Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)	Homo sapiens (Human)	752	798	752	767	16	KLLMIIHDRREFAKFE	85.31
DP01748	P05556	Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)	Homo sapiens (Human)	752	798	778	793	16	GENPIYKSAVTTVVNP	82.15
DP01748	P05556	Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)	Homo sapiens (Human)	752	795	752	767	16	KLLMIIHDRREFAKFE	85.31
DP01748	P05556	Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)	Homo sapiens (Human)	752	795	778	790	13	GENPIYKSAVTTV	81.27
DP01750	P62877	E3 ubiquitin-protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin-protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING-box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) Cleaved into: E3 ubiquitin-protein ligase RBX1; N-terminally processed (E3 ubiquitin-protein transferase RBX1; N-terminally processed)	Homo sapiens (Human)	12	39	28	34	7	NAVALWA	88.01
DP01751	O43172	U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4)	Homo sapiens (Human)	1	169	27	37	11	KPHIYYGSLEE	76.47
DP01751	O43172	U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4)	Homo sapiens (Human)	1	169	57	80	24	KAGIEAGNINITSGEVFEIEEHIS	84.28
DP01751	O43172	U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4)	Homo sapiens (Human)	1	169	83	91	9	QAEVLAEFE	83.09
DP01751	O43172	U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4)	Homo sapiens (Human)	1	169	95	104	10	RARQINVSTD	74.98
DP01751	O43172	U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4)	Homo sapiens (Human)	1	169	132	143	12	RLRNILSVVGTD	75.45
DP01751	O43172	U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4)	Homo sapiens (Human)	1	169	158	164	7	SKEEYQQ	80.22
DP01752	Q60598	Src substrate cortactin	Mus musculus (Mouse)	83	324	84	92	9	YGGKFGVEQ	75.25
DP01752	Q60598	Src substrate cortactin	Mus musculus (Mouse)	83	324	100	109	10	VGHEYQSKLS	78.19
DP01752	Q60598	Src substrate cortactin	Mus musculus (Mouse)	83	324	135	146	12	SAVGFEYQGKTE	77.7
DP01752	Q60598	Src substrate cortactin	Mus musculus (Mouse)	83	324	172	183	12	SAVGFDYQGKTE	80.27
DP01752	Q60598	Src substrate cortactin	Mus musculus (Mouse)	83	324	195	202	8	FGGKYGID	76.59
DP01752	Q60598	Src substrate cortactin	Mus musculus (Mouse)	83	324	209	220	12	SAVGFEYQGKTE	77.7
DP01752	Q60598	Src substrate cortactin	Mus musculus (Mouse)	83	324	232	241	10	FGGKFGVQTD	74.25
DP01752	Q60598	Src substrate cortactin	Mus musculus (Mouse)	83	324	252	261	10	HQEKLQLHES	75.12
DP01752	Q60598	Src substrate cortactin	Mus musculus (Mouse)	83	324	283	290	8	SAVGFDYK	77.01
DP01754	Q8BHZ5	Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog)	Mus musculus (Mouse)	1	157	36	43	8	QTAAWAQR	80.27
DP01754	Q8BHZ5	Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog)	Mus musculus (Mouse)	1	157	53	75	23	TETVYCMNEAEMVDVALGILIEG	78.86
DP01754	Q8BHZ5	Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog)	Mus musculus (Mouse)	1	157	86	97	12	SLEATDKLQLSP	75.25
DP01754	Q8BHZ5	Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog)	Mus musculus (Mouse)	1	157	110	118	9	EDSRISSLA	77.26
DP01754	Q8BHZ5	Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog)	Mus musculus (Mouse)	1	157	146	152	7	DALKYVR	88.63
DP01757	Q13029	PR domain zinc finger protein 2 (EC 2.1.1.355) (GATA-3-binding protein G3B) (Lysine N-methyltransferase 8) (MTB-ZF) (MTE-binding protein) (PR domain-containing protein 2) (Retinoblastoma protein-interacting zinc finger protein) (Zinc finger protein RIZ)	Homo sapiens (Human)	197	341	228	235	8	QEVASQEV	79.93
DP01757	Q13029	PR domain zinc finger protein 2 (EC 2.1.1.355) (GATA-3-binding protein G3B) (Lysine N-methyltransferase 8) (MTB-ZF) (MTE-binding protein) (PR domain-containing protein 2) (Retinoblastoma protein-interacting zinc finger protein) (Zinc finger protein RIZ)	Homo sapiens (Human)	197	269	228	235	8	QEVASQEV	79.93
DP01759	Q0GBY3	Phosphoprotein (Protein P) (Protein M1)	Rabies virus (strain China/MRV) (RABV)	1	68	1	12	12	MSKIFVNPSAIR	77.17
DP01759	Q0GBY3	Phosphoprotein (Protein P) (Protein M1)	Rabies virus (strain China/MRV) (RABV)	1	68	16	46	31	ADLEMAEETVDLINRNIEDNQAHLQGEPIEV	78.47
DP01762	P03714	Head-tail connector protein FII (Head-tail joining protein) (Minor capsid protein FII)	Escherichia phage lambda (Bacteriophage lambda)	1	24	3	19	17	DFDNLFDAAIARADETI	88.59
DP01763	E6Y5X0	Urease (EC 3.5.1.5) (Urea amidohydrolase)	Canavalia ensiformis (Jack bean) (Dolichos ensiformis)	232	321	239	245	7	AAMEIVC	88.63
DP01763	E6Y5X0	Urease (EC 3.5.1.5) (Urea amidohydrolase)	Canavalia ensiformis (Jack bean) (Dolichos ensiformis)	232	321	279	288	10	YANKYGPTIG	87.29
DP01763	E6Y5X0	Urease (EC 3.5.1.5) (Urea amidohydrolase)	Canavalia ensiformis (Jack bean) (Dolichos ensiformis)	232	321	295	316	22	DTDLIAEIEKDFALYGDESVFG	86.42
DP01765	Q9NQA5	Transient receptor potential cation channel subfamily V member 5 (TrpV5) (Calcium transport protein 2) (CaT2) (Epithelial calcium channel 1) (ECaC) (ECaC1) (Osm-9-like TRP channel 3) (OTRPC3)	Homo sapiens (Human)	587	725	589	605	17	RDELWRAQVVATTVMLE	78.99
DP01765	Q9NQA5	Transient receptor potential cation channel subfamily V member 5 (TrpV5) (Calcium transport protein 2) (CaT2) (Epithelial calcium channel 1) (ECaC) (ECaC1) (Osm-9-like TRP channel 3) (OTRPC3)	Homo sapiens (Human)	587	725	626	655	30	GDRWFLRVENHNDQNPLRVLRYVEVFKNSD	86.16
DP01765	Q9NQA5	Transient receptor potential cation channel subfamily V member 5 (TrpV5) (Calcium transport protein 2) (CaT2) (Epithelial calcium channel 1) (ECaC) (ECaC1) (Osm-9-like TRP channel 3) (OTRPC3)	Homo sapiens (Human)	587	725	699	720	22	RGWEILRQNTLGHLNLGLNLSE	79.52
DP01767	Q9H1D0	Transient receptor potential cation channel subfamily V member 6 (TrpV6) (CaT-like) (CaT-L) (Calcium transport protein 1) (CaT1) (Epithelial calcium channel 2) (ECaC2)	Homo sapiens (Human)	655	725	666	673	8	GDRWFLRV	91.97
DP01767	Q9H1D0	Transient receptor potential cation channel subfamily V member 6 (TrpV6) (CaT-like) (CaT-L) (Calcium transport protein 1) (CaT1) (Epithelial calcium channel 2) (ECaC2)	Homo sapiens (Human)	655	725	680	694	15	NRQRIQRYAQAFHTR	78.48
DP01768	P58753	Toll/interleukin-1 receptor domain-containing adapter protein (TIR domain-containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter-like protein) (MyD88-2)	Homo sapiens (Human)	15	35	21	29	9	MADWFRQTL	80.27
DP01769	Q8WUG5	Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR)	Homo sapiens (Human)	1	105	3	10	8	SDPIFTLA	79.43
DP01769	Q8WUG5	Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR)	Homo sapiens (Human)	1	105	13	21	9	LHCHYGAFP	80.71
DP01769	Q8WUG5	Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR)	Homo sapiens (Human)	1	105	36	55	20	VSVASAALAASAASRVATST	79.08
DP01769	Q8WUG5	Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR)	Homo sapiens (Human)	1	105	72	93	22	KDWDYNGLPVLTTNAIGQWDLV	82.47
DP01770	P50402	Emerin	Homo sapiens (Human)	1	187	9	22	14	DTELTTLLRRYNIP	76.68
DP01770	P50402	Emerin	Homo sapiens (Human)	1	187	30	44	15	TRRLYEKKIFEYETQ	77.97
DP01770	P50402	Emerin	Homo sapiens (Human)	1	187	55	67	13	AASSYSFSDLNST	79.55
DP01770	P50402	Emerin	Homo sapiens (Human)	1	187	80	106	27	EDALLYQSKGYNDDYYEESYFTTRTYG	81.01
DP01770	P50402	Emerin	Homo sapiens (Human)	1	187	118	125	8	RQSVTSFP	78.55
DP01770	P50402	Emerin	Homo sapiens (Human)	1	187	137	144	8	DDLLSSSE	79.93
DP01770	P50402	Emerin	Homo sapiens (Human)	1	187	157	168	12	RDSAYQSITHYR	81.52
DP01770	P50402	Emerin	Homo sapiens (Human)	67	170	80	106	27	EDALLYQSKGYNDDYYEESYFTTRTYG	81.01
DP01770	P50402	Emerin	Homo sapiens (Human)	67	170	118	125	8	RQSVTSFP	78.55
DP01770	P50402	Emerin	Homo sapiens (Human)	67	170	137	144	8	DDLLSSSE	79.93
DP01770	P50402	Emerin	Homo sapiens (Human)	67	170	157	165	9	RDSAYQSIT	82.94
DP01771	P78560	Death domain-containing protein CRADD (Caspase and RIP adapter with death domain) (RIP-associated protein with a death domain)	Homo sapiens (Human)	95	136	106	114	9	IPSHILNSS	81.05
DP01771	P78560	Death domain-containing protein CRADD (Caspase and RIP adapter with death domain) (RIP-associated protein with a death domain)	Homo sapiens (Human)	95	136	116	126	11	SDRQINQLAQR	75.92
DP01772	Q07912	Activated CDC42 kinase 1 (ACK-1) (EC 2.7.10.2) (EC 2.7.11.1) (Tyrosine kinase non-receptor protein 2)	Homo sapiens (Human)	448	489	450	466	17	SAQDISQPLQNSFIHTG	76.73
DP01774	O54928	Suppressor of cytokine signaling 5 (SOCS-5) (Cytokine-inducible SH2-containing protein 5)	Mus musculus (Mouse)	175	244	209	215	7	HLSELML	77.26
DP01774	O54928	Suppressor of cytokine signaling 5 (SOCS-5) (Cytokine-inducible SH2-containing protein 5)	Mus musculus (Mouse)	175	244	226	234	9	LAQKWHLIK	75.92
DP01775	P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	41	50	10	NDENEVEILP	91.04
DP01775	P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	67	75	9	ADGILVLEH	79.78
DP01775	P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	82	91	10	GFDVYDGHFD	80.87
DP01775	P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	120	130	11	NDDFISLSASS	79.02
DP01775	P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	160	143	149	7	KQELEIK	81.84
DP01775	P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	128	160	143	149	7	KQELEIK	81.84
DP01775	P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	482	584	493	508	16	GLVLNKAIIENENYHK	79.47
DP01775	P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	482	584	515	539	25	HDEDFAEDTVTSTATATTTDDDYEI	77.42
DP01775	P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	482	584	562	573	12	SGETYITVSSED	80.96
DP01776	Q8GYN5	RPM1-interacting protein 4	Arabidopsis thaliana (Mouse-ear cress)	1	211	8	25	18	KFGNWEAEENVPYTAYFD	83.26
DP01776	Q8GYN5	RPM1-interacting protein 4	Arabidopsis thaliana (Mouse-ear cress)	1	211	41	48	8	NDPEYNSD	80.6
DP01776	Q8GYN5	RPM1-interacting protein 4	Arabidopsis thaliana (Mouse-ear cress)	1	211	107	114	8	SQNNSYDN	80.94
DP01776	Q8GYN5	RPM1-interacting protein 4	Arabidopsis thaliana (Mouse-ear cress)	1	211	162	172	11	ADGYTHIFNKV	81.76
DP01777	Q3LS93	Uncharacterized protein	Strongylocentrotus purpuratus (Purple sea urchin)	22	329	125	131	7	AAQQIGD	78.4
DP01777	Q3LS93	Uncharacterized protein	Strongylocentrotus purpuratus (Purple sea urchin)	22	329	264	272	9	RPFRFNPFG	75.25
DP01779	Q05917	Homeobox protein engrailed-2 (Gg-En-2) (Homeobox protein en-2)	Gallus gallus (Chicken)	146	199	170	179	10	PAWVYCTRYS	77.26
DP01780	P21736	Protein E7	Human papillomavirus 45	1	54	7	16	10	TLQEIVLHLE	80.43
DP01780	P21736	Protein E7	Human papillomavirus 45	1	54	24	36	13	VDLLCYEQLSESE	79.78
DP01781	O75112	LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein)	Homo sapiens (Human)	85	283	108	123	16	VVVNSPANADYQERFN	81.52
DP01781	O75112	LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein)	Homo sapiens (Human)	85	283	128	134	7	KDSALST	75.92
DP01781	O75112	LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein)	Homo sapiens (Human)	85	283	145	182	38	GKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFS	79.19
DP01781	O75112	LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein)	Homo sapiens (Human)	85	283	199	206	8	YQAVIKSQ	75.96
DP01781	O75112	LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein)	Homo sapiens (Human)	85	283	226	241	16	RSFRILAQMTGTEFMQ	78.7
DP01781	O75112	LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein)	Homo sapiens (Human)	229	283	235	241	7	TGTEFMQ	77.26
DP01782	Q53GG5	PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein)	Homo sapiens (Human)	107	273	110	122	13	QDGNYFEHKHNIR	87.52
DP01782	Q53GG5	PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein)	Homo sapiens (Human)	107	273	151	160	10	SSVSTVSTIC	83.55
DP01782	Q53GG5	PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein)	Homo sapiens (Human)	107	273	170	178	9	LAPNIPLEM	75.59
DP01782	Q53GG5	PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein)	Homo sapiens (Human)	107	273	181	218	38	PGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETP	82.78
DP01783	Q2JIZ5	Sensor histidine kinase	"Synechococcus sp. (strain JA-2-3Ba(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime)"	1	30	2	9	8	DTETWAAA	79.26
DP01783	Q2JIZ5	Sensor histidine kinase	"Synechococcus sp. (strain JA-2-3Ba(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime)"	1	30	14	25	12	RDALINRITHQI	85.67
DP01784	Q86UX7	Fermitin family homolog 3 (Kindlin-3) (MIG2-like protein) (Unc-112-related protein 2)	Homo sapiens (Human)	142	224	158	178	21	EEELYDLSKVVLAGGVAPALF	81.59
DP01784	Q86UX7	Fermitin family homolog 3 (Kindlin-3) (MIG2-like protein) (Unc-112-related protein 2)	Homo sapiens (Human)	142	224	180	186	7	GMPAHFS	75.92
DP01784	Q86UX7	Fermitin family homolog 3 (Kindlin-3) (MIG2-like protein) (Unc-112-related protein 2)	Homo sapiens (Human)	142	224	188	198	11	SAQTEACYHML	74.28
DP01785	Q87P35	Uncharacterized protein	Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)	1	125	2	25	24	VNINTSHMQSLSQLTSHLATQNQA	78.4
DP01785	Q87P35	Uncharacterized protein	Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)	1	125	35	43	9	GKDIFVKEG	78.15
DP01785	Q87P35	Uncharacterized protein	Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)	1	125	50	58	9	VSARISHQN	74.58
DP01785	Q87P35	Uncharacterized protein	Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)	1	125	63	71	9	IVVNLLTKQ	76.7
DP01785	Q87P35	Uncharacterized protein	Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)	1	125	82	105	24	LQNVLNGENKLTLGNLKNLERLSS	80.94
DP01786	D2JX42	Abscisic stress ripening	Musa AAB Group	1	143	20	57	38	AEEVIYSETAYSGGGDYASGYTETVVAESASDEYEKYK	78.37
DP01786	D2JX42	Abscisic stress ripening	Musa AAB Group	1	143	76	85	10	AAGAFALYEK	82.41
DP01786	D2JX42	Abscisic stress ripening	Musa AAB Group	1	143	100	120	21	IEEEIAAAVAVGSGGYAFHEH	84.62
DP01787	A0A1Z3GD05	Abcissic acid stress ripening	Hordeum vulgare (Barley)	1	138	7	14	8	HHHLFHHK	74.58
DP01787	A0A1Z3GD05	Abcissic acid stress ripening	Hordeum vulgare (Barley)	1	138	27	53	27	GADVYGYSTETVVTGTGNEGEYERITK	78.43
DP01787	A0A1Z3GD05	Abcissic acid stress ripening	Hordeum vulgare (Barley)	1	138	71	80	10	AAGAFALYEK	82.41
DP01787	A0A1Z3GD05	Abcissic acid stress ripening	Hordeum vulgare (Barley)	1	138	106	115	10	GAGGFVFHEH	80.1
DP01789	A0A1Z3GD08	Abcissic acid stress ripening	Triticum turgidum subsp. durum (Durum wheat) (Triticum durum)	1	136	6	13	8	HHHLFHHK	74.58
DP01789	A0A1Z3GD08	Abcissic acid stress ripening	Triticum turgidum subsp. durum (Durum wheat) (Triticum durum)	1	136	25	51	27	GVDTYGYSTETVVTATGNDGEYERITK	78.55
DP01789	A0A1Z3GD08	Abcissic acid stress ripening	Triticum turgidum subsp. durum (Durum wheat) (Triticum durum)	1	136	69	78	10	AAGAFALYEK	82.41
DP01789	A0A1Z3GD08	Abcissic acid stress ripening	Triticum turgidum subsp. durum (Durum wheat) (Triticum durum)	1	136	92	113	22	KIEEEVAAAAAVGAGGFVFHEH	77.09
DP01791	A0ZWU1	Ell1-associated factor 1	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	158	251	165	171	7	RYPAISS	75.92
DP01791	A0ZWU1	Ell1-associated factor 1	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	158	251	197	209	13	LELGFDQEFNSID	84.08
DP01791	A0ZWU1	Ell1-associated factor 1	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	158	251	239	245	7	QAEGISS	79.26
DP01794	Q99ML1	Bcl-2-binding component 3 (p53 up-regulated modulator of apoptosis)	Mus musculus (Mouse)	128	161	129	143	15	EEEEWAREIGAQLRR	79.22
DP01794	Q99ML1	Bcl-2-binding component 3 (p53 up-regulated modulator of apoptosis)	Mus musculus (Mouse)	128	161	148	154	7	LNAQYER	76.25
DP01796	Q9NS91	E3 ubiquitin-protein ligase RAD18 (EC 2.3.2.27) (Postreplication repair protein RAD18) (hHR18) (hRAD18) (RING finger protein 73) (RING-type E3 ubiquitin transferase RAD18)	Homo sapiens (Human)	339	366	346	355	10	HKSEFQLLVD	75.95
DP01797	O96017	Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2)	Homo sapiens (Human)	1	70	34	42	9	QSQGISSSS	75.73
DP01797	O96017	Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2)	Homo sapiens (Human)	64	90	68	76	9	TQELYSIPE	81.94
DP01797	O96017	Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2)	Homo sapiens (Human)	70	91	70	76	7	ELYSIPE	79.93
DP01799	P49790	Nuclear pore complex protein Nup153 (153 kDa nucleoporin) (Nucleoporin Nup153)	Homo sapiens (Human)	1313	1390	1340	1354	15	GFGSISSSTALFPTG	79.04
DP01799	P49790	Nuclear pore complex protein Nup153 (153 kDa nucleoporin) (Nucleoporin Nup153)	Homo sapiens (Human)	1313	1390	1363	1369	7	GTVSSSS	75.25
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	11	22	12	PEVLLLLLCILQ	82.66
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	39	45	7	GGVFFPG	89.97
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	100	107	8	AAAAYKAA	75.54
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	193	201	9	GAGAFAGIP	81.16
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	412	423	12	GAVGIGGIPTFG	80.43
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	493	500	8	KAAQFGLG	74.12
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	532	539	8	GGVIGAGV	75.25
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	649	657	9	KAAQFGLGG	74.1
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	695	707	13	GGVLGAGQPFPIG	73.91
DP01801	P04985	Elastin (Tropoelastin)	Bos taurus (Bovine)	1	747	726	733	8	ALGALGFP	75.25
DP01804	P53999	Activated RNA polymerase II transcriptional coactivator p15 (Positive cofactor 4) (PC4) (SUB1 homolog) (p14)	Homo sapiens (Human)	1	60	6	12	7	ELVSSSS	75.25
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	1	165	18	30	13	LEELLESALDDFD	75.1
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	1	165	60	90	31	KDALFASQEKFFQELFDSELASQATAEFEKA	83.66
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	1	165	100	110	11	HLVEQFQKLSE	79.66
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	1	165	121	128	8	SQQEFTSC	81.61
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	1	165	142	148	7	DLQNSSM	76.78
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	4	182	18	30	13	LEELLESALDDFD	75.1
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	4	182	60	90	31	KDALFASQEKFFQELFDSELASQATAEFEKA	83.66
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	4	182	100	110	11	HLVEQFQKLSE	79.66
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	4	182	121	128	8	SQQEFTSC	81.61
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	4	182	142	148	7	DLQNSSM	76.78
DP01805	P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	Homo sapiens (Human)	4	182	167	177	11	GEGNILPIMQS	85.56
DP01806	Q67953	Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen)	Hepatitis B virus (HBV)	1	108	1	25	25	MQLIITSKLGIIYILCGRLAFYIRE	84.55
DP01806	Q67953	Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen)	Hepatitis B virus (HBV)	1	108	29	50	22	AVPHFVGHHILGNKSYSMGGWS	76.56
DP01806	Q67953	Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen)	Hepatitis B virus (HBV)	1	108	66	72	7	PLGFFPD	74.58
DP01806	Q67953	Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen)	Hepatitis B virus (HBV)	1	108	75	91	17	LDPAFGANSNNPDWDFN	76.47
DP01807	P49005	DNA polymerase delta subunit 2 (DNA polymerase delta subunit p50)	Homo sapiens (Human)	102	122	103	111	9	LQPSILREV	77.26
DP01817	Q15910	Histone-lysine N-methyltransferase EZH2 (EC 2.1.1.356) (ENX-1) (Enhancer of zeste homolog 2) (Lysine N-methyltransferase 6)	Homo sapiens (Human)	346	424	366	376	11	STPTINVLESK	78.44
DP01817	Q15910	Histone-lysine N-methyltransferase EZH2 (EC 2.1.1.356) (ENX-1) (Enhancer of zeste homolog 2) (Lysine N-methyltransferase 6)	Homo sapiens (Human)	480	514	495	509	15	KHRLWAAHCRKIQLK	75.61
DP01825	P25644	DNA topoisomerase 2-associated protein PAT1 (Decapping activator and translational repressor PAT1) (Topoisomerase II-associated protein PAT1) (mRNA turnover protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	422	469	425	436	12	TDSLTNVDLASS	82.94
DP01825	P25644	DNA topoisomerase 2-associated protein PAT1 (Decapping activator and translational repressor PAT1) (Topoisomerase II-associated protein PAT1) (mRNA turnover protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	422	469	454	464	11	RRSSYAFNNGN	79.08
DP01832	Q7Q3R9	AGAP008004-PA	Anopheles gambiae (African malaria mosquito)	22	103	29	43	15	DVPTYDEEDFDEESL	75.25
DP01832	Q7Q3R9	AGAP008004-PA	Anopheles gambiae (African malaria mosquito)	22	103	81	93	13	FLRNSNTDEQASA	75.15
DP01833	P85800	Variegin	Amblyomma variegatum (Tropical bont tick)	1	32	19	27	9	DFEAIPEEY	82.91
DP01833	P85800	Variegin	Amblyomma variegatum (Tropical bont tick)	8	32	19	27	9	DFEAIPEEY	82.91
DP01833	P85800	Variegin	Amblyomma variegatum (Tropical bont tick)	11	32	19	27	9	DFEAIPEEY	82.91
DP01835	O43715	TP53-regulated inhibitor of apoptosis 1 (Protein 15E1.1) (WF-1) (p53-inducible cell-survival factor) (p53CSV)	Homo sapiens (Human)	54	76	59	66	8	IEGLEFMG	80.43
DP01840	P38968	Protein transport protein SEC31 (Protein WEB1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	770	1100	789	796	8	MQAPFYGM	79.77
DP01840	P38968	Protein transport protein SEC31 (Protein WEB1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	770	1100	834	843	10	MASPFVNKTN	77.26
DP01840	P38968	Protein transport protein SEC31 (Protein WEB1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	770	1100	858	882	25	YATATVPATNVSTTSIPQNTFAPIQ	78.35
DP01840	P38968	Protein transport protein SEC31 (Protein WEB1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	770	1100	887	899	13	IMGDYNAQSSSIP	75.15
DP01840	P38968	Protein transport protein SEC31 (Protein WEB1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	770	1100	942	950	9	APPNILSTP	73.91
DP01840	P38968	Protein transport protein SEC31 (Protein WEB1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	770	1100	992	998	7	SLVATSE	84.62
DP01840	P38968	Protein transport protein SEC31 (Protein WEB1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	770	1100	1001	1009	9	RASISNPYA	80.27
DP01840	P38968	Protein transport protein SEC31 (Protein WEB1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	770	1100	1015	1041	27	QQFPIGTISTANQTSNTAQVASSNPYA	83.41
DP01841	P08514	Integrin alpha-IIb (GPalpha IIb) (GPIIb) (Platelet membrane glycoprotein IIb) (CD antigen CD41) Cleaved into: Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; form 1; Integrin alpha-IIb light chain; form 2	Homo sapiens (Human)	989	1039	994	1027	34	AIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRN	79.85
DP01842	P05106	Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)	Homo sapiens (Human)	741	788	741	749	9	WKLLITIHD	86.47
DP01842	P05106	Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)	Homo sapiens (Human)	741	788	752	759	8	EFAKFEEE	82.61
DP01842	P05106	Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)	Homo sapiens (Human)	741	788	769	783	15	NNPLYKEATSTFTNI	80.6
DP01842	P05106	Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)	Homo sapiens (Human)	742	788	742	749	8	KLLITIHD	86.37
DP01842	P05106	Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)	Homo sapiens (Human)	742	788	752	759	8	EFAKFEEE	82.61
DP01842	P05106	Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)	Homo sapiens (Human)	742	788	769	783	15	NNPLYKEATSTFTNI	80.6
DP01842	P05106	Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)	Homo sapiens (Human)	762	788	769	783	15	NNPLYKEATSTFTNI	80.6
DP01842	P05106	Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)	Homo sapiens (Human)	763	788	769	783	15	NNPLYKEATSTFTNI	80.6
DP01843	P03404	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1)	1	25	7	15	9	KSSVIGWPA	79.6
DP01844	Q92540	Protein SMG7 (EST1-like protein C) (SMG-7 homolog) (hSMG-7)	Homo sapiens (Human)	111	143	111	117	7	TVFNVDL	75.25
DP01844	Q92540	Protein SMG7 (EST1-like protein C) (SMG-7 homolog) (hSMG-7)	Homo sapiens (Human)	111	143	124	138	15	SQLGIISNKQTHTSA	84.04
DP01848	P05107	Integrin beta-2 (Cell surface adhesion glycoproteins LFA-1/CR3/p150;95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18)	Homo sapiens (Human)	735	769	745	761	17	SQWNNDNPLFKSATTTV	79.93
DP01849	O60260	E3 ubiquitin-protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2)	Homo sapiens (Human)	109	142	118	126	9	GLAVILHTD	80.9
DP01850	Q9JK66	E3 ubiquitin-protein ligase parkin (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase)	Rattus norvegicus (Rat)	76	141	93	99	7	EGSIWEP	79.93
DP01850	Q9JK66	E3 ubiquitin-protein ligase parkin (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase)	Rattus norvegicus (Rat)	76	141	118	130	13	GLAVILDTDSKSD	88.5
DP01852	P04480	Colicin-A	Citrobacter freundii	1	172	2	8	7	PGFNYGG	76.3
DP01852	P04480	Colicin-A	Citrobacter freundii	1	172	12	18	7	GTGWSSE	77.26
DP01852	P04480	Colicin-A	Citrobacter freundii	1	172	43	51	9	NVGNESVTV	76.14
DP01852	P04480	Colicin-A	Citrobacter freundii	1	172	62	70	9	WGKVIINAA	80.45
DP01852	P04480	Colicin-A	Citrobacter freundii	1	172	77	91	15	GTVMTADNSSMVPYG	76.32
DP01852	P04480	Colicin-A	Citrobacter freundii	1	172	96	106	11	RVLNSLVNNPV	77.17
DP01852	P04480	Colicin-A	Citrobacter freundii	1	172	121	131	11	AVENYLMVQSG	86.38
DP01852	P04480	Colicin-A	Citrobacter freundii	21	107	43	51	9	NVGNESVTV	76.14
DP01852	P04480	Colicin-A	Citrobacter freundii	21	107	62	70	9	WGKVIINAA	80.45
DP01852	P04480	Colicin-A	Citrobacter freundii	21	107	77	91	15	GTVMTADNSSMVPYG	76.32
DP01852	P04480	Colicin-A	Citrobacter freundii	21	107	96	102	7	RVLNSLV	77.11
DP01854	Q9M605	Dehydrin 1 (Dehydrin-like protein)	Vitis riparia (Frost grape) (Vitis vulpina)	83	130	102	108	7	QTSATST	73.91
DP01854	Q9M605	Dehydrin 1 (Dehydrin-like protein)	Vitis riparia (Frost grape) (Vitis vulpina)	93	113	102	108	7	QTSATST	73.91
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	1	200	21	31	11	PAFKYQFVREP	76.1
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	1	200	49	55	7	LEELEVL	78.4
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	1	200	185	194	10	VDETLFALPA	80.74
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	32	200	49	55	7	LEELEVL	78.4
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	32	200	185	194	10	VDETLFALPA	80.74
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	408	213	237	25	PGNTISAGQEDFPSVLLETAASLPS	78.43
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	408	242	276	35	SAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEV	76.1
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	408	288	308	21	DLTEFSELEYSEMGSSFSVSP	76.95
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	408	311	325	15	ESAVIVANPREEIIV	83.88
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	408	335	348	14	VSNNILHNQQELPT	76.9
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	408	352	363	12	KLVKEDEVVSSE	74.97
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	408	380	396	17	MREEYADFKPFERVWEV	79.44
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	358	213	237	25	PGNTISAGQEDFPSVLLETAASLPS	78.43
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	358	242	276	35	SAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEV	76.1
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	358	288	308	21	DLTEFSELEYSEMGSSFSVSP	76.95
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	358	311	325	15	ESAVIVANPREEIIV	83.88
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	210	358	335	348	14	VSNNILHNQQELPT	76.9
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	359	566	380	396	17	MREEYADFKPFERVWEV	79.44
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	359	566	408	418	11	AGGKIESNLES	77.38
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	359	566	426	433	8	ADSLEQTN	80.27
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	359	566	457	468	12	RSGAYITCAPFN	77.56
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	359	566	471	484	14	ATESIATNIFPLLG	80.82
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	359	566	502	511	10	AQIVTEKNTS	78.13
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	359	566	518	547	30	FLVAAQDSETDYVTTDNLTKVTEEVVANMP	76.72
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	409	616	412	418	7	IESNLES	75.92
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	409	616	426	433	8	ADSLEQTN	80.27
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	409	616	457	468	12	RSGAYITCAPFN	77.56
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	409	616	471	484	14	ATESIATNIFPLLG	80.82
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	409	616	502	511	10	AQIVTEKNTS	78.13
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	409	616	518	547	30	FLVAAQDSETDYVTTDNLTKVTEEVVANMP	76.72
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	409	616	561	592	32	SELNEVTGTKIAYETKMDLVQTSEVMQESLYP	79.47
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	774	567	592	26	TGTKIAYETKMDLVQTSEVMQESLYP	79.98
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	774	613	623	11	DIVMEAPLNSA	74.64
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	774	628	634	7	GASVIQP	89.3
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	774	642	650	9	SSVNYESIK	83.24
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	774	679	705	27	EPENINAALQETEAPYISIACDLIKET	79.64
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	774	714	722	9	DFSDYSEMA	80.27
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	774	744	754	11	PVDLFSDDSIP	79.51
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	774	762	769	8	ETVMLVKE	75.67
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	748	567	592	26	TGTKIAYETKMDLVQTSEVMQESLYP	79.98
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	748	613	623	11	DIVMEAPLNSA	74.64
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	748	628	634	7	GASVIQP	89.3
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	748	642	650	9	SSVNYESIK	83.24
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	748	679	705	27	EPENINAALQETEAPYISIACDLIKET	79.64
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	567	748	714	722	9	DFSDYSEMA	80.27
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	617	824	628	634	7	GASVIQP	89.3
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	617	824	642	650	9	SSVNYESIK	83.24
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	617	824	679	705	27	EPENINAALQETEAPYISIACDLIKET	79.64
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	617	824	714	722	9	DFSDYSEMA	80.27
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	617	824	744	754	11	PVDLFSDDSIP	79.51
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	617	824	762	784	23	ETVMLVKESLTETSFESMIEYEN	78.99
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	617	824	799	809	11	YLESFKLSLDN	75.4
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	776	784	9	FESMIEYEN	84.65
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	799	809	11	YLESFKLSLDN	75.4
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	817	823	7	DEVSTLS	74.1
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	832	861	30	MEELSTAVYSNDDLFISKEAQIRETETFSD	80.52
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	863	877	15	SPIEIIDEFPTLISS	81.98
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	879	894	16	TDSFSKLAREYTDLEV	75.1
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	896	902	7	HKSEIAN	79.93
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	928	950	23	VEEKISFSDDFSKNGSATSKVLL	78.57
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	954	968	15	DVSALATQAEIESIV	81.36
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	775	1016	991	1011	21	SPSAIFSAELSKTSVVDLLYW	80.12
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	825	1016	832	861	30	MEELSTAVYSNDDLFISKEAQIRETETFSD	80.52
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	825	1016	863	877	15	SPIEIIDEFPTLISS	81.98
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	825	1016	879	894	16	TDSFSKLAREYTDLEV	75.1
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	825	1016	896	902	7	HKSEIAN	79.93
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	825	1016	928	950	23	VEEKISFSDDFSKNGSATSKVLL	78.57
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	825	1016	954	968	15	DVSALATQAEIESIV	81.36
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	825	1016	991	1011	21	SPSAIFSAELSKTSVVDLLYW	80.12
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	1055	1094	1057	1068	12	YKGVIQAIQKSD	81.52
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	1055	1094	1072	1089	18	PFRAYLESEVAISEELVQ	79.21
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	1155	1187	1158	1172	15	HQAQIDHYLGLANKN	82.27
DP01855	Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	Homo sapiens (Human)	1155	1187	1176	1182	7	AMAKIQA	83.13
DP01858	Q96270	Late embryogenesis abundant protein 7	Arabidopsis thaliana (Mouse-ear cress)	1	169	5	11	7	QEQSYKA	80.94
DP01858	Q96270	Late embryogenesis abundant protein 7	Arabidopsis thaliana (Mouse-ear cress)	1	169	79	93	15	KTGSYMSETGEAIKN	80.27
DP01858	Q96270	Late embryogenesis abundant protein 7	Arabidopsis thaliana (Mouse-ear cress)	1	169	96	103	8	HDAAEYTK	80.06
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	1	18	18	MAAMFTTRNAIFRFSKSF	85.28
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	32	39	8	VFVASASH	88.29
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	55	63	9	MDWAYNSTS	82.35
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	68	74	7	DADEIAD	77.26
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	119	125	7	RDYAYDA	88.29
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	148	154	7	KDYAYDA	91.97
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	177	183	7	RDYAYDA	88.29
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	193	205	13	NAGETAKDYAYGA	83.1
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	221	229	9	RDYAYDATD	88.29
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	256	278	23	GAEKTAETTGEVAGAATEALKSA	74.73
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	286	293	8	AQGAWETA	84.99
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	296	304	9	ATQKIKETV	82.27
DP01859	Q5NJL5	Late embryogenesis abundant protein	Pisum sativum (Garden pea)	1	358	321	330	10	VVDEYDVELK	78.33
DP01860	P17639	Protein EMB-1 (Carrot ABA-induced in somatic embryos 4)	Daucus carota (Wild carrot)	1	92	32	39	8	AQQHLAEG	82.94
DP01860	P17639	Protein EMB-1 (Carrot ABA-induced in somatic embryos 4)	Daucus carota (Wild carrot)	1	92	77	87	11	EQEGIDIDESK	75.22
DP01861	P01042	Kininogen-1 (Alpha-2-thiol proteinase inhibitor) (Fitzgerald factor) (High molecular weight kininogen) (HMWK) (Williams-Fitzgerald-Flaujeac factor) Cleaved into: Kininogen-1 heavy chain; T-kinin (Ile-Ser-Bradykinin); Bradykinin (Kallidin I); Lysyl-bradykinin (Kallidin II); Kininogen-1 light chain; Low molecular weight growth-promoting factor	Homo sapiens (Human)	438	531	517	526	10	NGWKTEHLAS	75.25
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	1	462	35	65	31	STGYYDQEIYGGSDSRFAGYVTSIAATELED	83.31
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	1	462	86	95	10	APVALLNDIP	74.45
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	1	462	97	105	9	STEQYDPFA	75.92
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	1	462	124	130	7	RTMIISP	83.95
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	1	462	182	190	9	KVVNGAAAS	75.25
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	1	462	214	223	10	KLSSWDQAET	76.45
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	1	462	371	378	8	TPGHIMSM	75.59
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	1	462	382	393	12	QLQAWRWEREID	79.38
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	190	340	214	223	10	KLSSWDQAET	76.45
DP01863	O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	Homo sapiens (Human)	378	424	382	393	12	QLQAWRWEREID	79.38
DP01864	Q9XTN4	Brinker (Brk) (Putative transcription factor) (RE18244p)	Drosophila melanogaster (Fruit fly)	1	101	23	37	15	SENATNSHTNNGNSS	74.98
DP01864	Q9XTN4	Brinker (Brk) (Putative transcription factor) (RE18244p)	Drosophila melanogaster (Fruit fly)	1	101	53	62	10	KLQVLESYRN	77.26
DP01864	Q9XTN4	Brinker (Brk) (Putative transcription factor) (RE18244p)	Drosophila melanogaster (Fruit fly)	1	101	69	81	13	NQRATARKYNIHR	76.15
DP01864	Q9XTN4	Brinker (Brk) (Putative transcription factor) (RE18244p)	Drosophila melanogaster (Fruit fly)	1	101	83	96	14	QIQKWLQCESNLRS	79.65
DP01864	Q9XTN4	Brinker (Brk) (Putative transcription factor) (RE18244p)	Drosophila melanogaster (Fruit fly)	43	101	53	62	10	KLQVLESYRN	77.26
DP01864	Q9XTN4	Brinker (Brk) (Putative transcription factor) (RE18244p)	Drosophila melanogaster (Fruit fly)	43	101	69	81	13	NQRATARKYNIHR	76.15
DP01864	Q9XTN4	Brinker (Brk) (Putative transcription factor) (RE18244p)	Drosophila melanogaster (Fruit fly)	43	101	83	96	14	QIQKWLQCESNLRS	79.65
DP01867	P47047	ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	85	3	14	12	STDLFDVFEETP	76.23
DP01867	P47047	ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	78	3	14	12	STDLFDVFEETP	76.23
DP01867	P47047	ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	672	809	678	684	7	RLVEISV	84.52
DP01867	P47047	ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	672	809	686	703	18	GKDNYGWGAVVDFAKRIN	77.44
DP01867	P47047	ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	672	809	708	739	32	SAVYTDHESYIVNVVVNTMYIDSPVNLLKPFN	82.98
DP01867	P47047	ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	672	809	752	777	26	GEKSICAVIPITLDSIKSIGNLRLYM	79.42
DP01869	P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	Homo sapiens (Human)	48	284	53	61	9	KNNNYEPNL	82.57
DP01869	P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	Homo sapiens (Human)	48	284	72	92	21	NQLASTPIIFKEQGLTLPLYQ	80.9
DP01869	P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	Homo sapiens (Human)	48	284	161	171	11	CGSLFHTPKFV	74.03
DP01869	P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	Homo sapiens (Human)	48	284	179	188	10	HISESLGAEV	75.92
DP01869	P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	Homo sapiens (Human)	48	284	191	199	9	DMSWSSSLA	77.26
DP01869	P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	Homo sapiens (Human)	48	284	203	222	20	TLSSTVLIVRNEEASETVFP	85.18
DP01869	P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	Homo sapiens (Human)	48	284	227	237	11	ANVKSYFSNHD	77.53
DP01869	P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	Homo sapiens (Human)	48	284	243	257	15	NDRFIASVTDSENTN	79.22
DP01869	P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	Homo sapiens (Human)	48	284	265	279	15	GFGKTSGNSFKVNSC	74.85
DP01870	P84040	Histone H4	Drosophila melanogaster (Fruit fly)	22	102	23	32	10	LRDNIQGITK	76.49
DP01870	P84040	Histone H4	Drosophila melanogaster (Fruit fly)	22	102	47	75	29	ISGLIYEETRGVLKVFLENVIRDAVTYTE	79.1
DP01870	P84040	Histone H4	Drosophila melanogaster (Fruit fly)	22	102	85	92	8	MDVVYALK	77.76
DP01874	O95149	Snurportin-1 (RNA U transporter 1)	Homo sapiens (Human)	288	348	305	311	7	QLQQIME	80.98
DP01874	O95149	Snurportin-1 (RNA U transporter 1)	Homo sapiens (Human)	288	348	330	341	12	ENGHYELEHLST	75.92
DP01875	Q2GI62	120 kDa immunodominant surface protein	Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)	142	221	142	149	8	PFVAESEV	75.92
DP01875	Q2GI62	120 kDa immunodominant surface protein	Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)	142	221	153	165	13	EQEETNPEVLIKD	82.48
DP01875	Q2GI62	120 kDa immunodominant surface protein	Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)	142	221	167	174	8	QDVASHES	75.25
DP01875	Q2GI62	120 kDa immunodominant surface protein	Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)	142	221	181	193	13	AQVVTERESEIES	78.29
DP01875	Q2GI62	120 kDa immunodominant surface protein	Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)	142	221	200	207	8	KESGITES	73.91
DP01875	Q2GI62	120 kDa immunodominant surface protein	Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)	142	221	210	216	7	KEDEIVS	77.93
DP01876	P52926	High mobility group protein HMGI-C (High mobility group AT-hook protein 2)	Homo sapiens (Human)	1	109	93	104	12	AQEETEETSSQE	77.26
DP01879	Q9JIH2	Nuclear pore complex protein Nup50 (50 kDa nucleoporin) (Nuclear pore-associated protein 60 kDa-like) (Nucleoporin Nup50)	Mus musculus (Mouse)	47	109	47	62	16	NVGFESDSGGAFKGFK	74.48
DP01879	Q9JIH2	Nuclear pore complex protein Nup50 (50 kDa nucleoporin) (Nuclear pore-associated protein 60 kDa-like) (Nucleoporin Nup50)	Mus musculus (Mouse)	47	109	84	104	21	LEGLTNGNSTDNATPFSNVKT	79.07
DP01880	Q15596	Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2)	Homo sapiens (Human)	624	829	641	648	8	LLQLLTTK	77.55
DP01880	Q15596	Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2)	Homo sapiens (Human)	624	829	703	712	10	LAKLTAEATG	74.38
DP01880	Q15596	Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2)	Homo sapiens (Human)	624	829	740	750	11	KENALLRYLLD	77.74
DP01880	Q15596	Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2)	Homo sapiens (Human)	624	829	803	823	21	LDNLEEILDDLQNSQLPQLFP	80.25
DP01883	P02655	Apolipoprotein C-II (Apo-CII) (ApoC-II) (Apolipoprotein C2) Cleaved into: Proapolipoprotein C-II (ProapoC-II)	Homo sapiens (Human)	40	65	41	51	11	KESLSSYWESA	80.05
DP01883	P02655	Apolipoprotein C-II (Apo-CII) (ApoC-II) (Apolipoprotein C2) Cleaved into: Proapolipoprotein C-II (ProapoC-II)	Homo sapiens (Human)	40	65	54	60	7	AAQNLYE	88.87
DP01884	Q9UKT5	F-box only protein 4	Homo sapiens (Human)	242	271	253	260	8	SAVNKMFS	75.25
DP01890	Q07930	Pre-mRNA leakage protein 1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	61	22	29	8	KSQYIDIM	83.19
DP01890	Q07930	Pre-mRNA leakage protein 1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	61	36	43	8	GLLELESN	77.47
DP01890	Q07930	Pre-mRNA leakage protein 1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	51	22	29	8	KSQYIDIM	83.19
DP01890	Q07930	Pre-mRNA leakage protein 1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	51	36	43	8	GLLELESN	77.47
DP01890	Q07930	Pre-mRNA leakage protein 1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	22	42	22	29	8	KSQYIDIM	83.19
DP01919	Q9V0U0	Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-)	Pyrococcus abyssi (strain GE5 / Orsay)	513	633	515	554	40	KEVPIENVTDEHIREAFQLYLEGKIAKEAFEEIFKELARN	80.06
DP01919	Q9V0U0	Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-)	Pyrococcus abyssi (strain GE5 / Orsay)	513	633	567	593	27	GLTLLSEEEVTRIIEEVIQQNIEVVKA	81.67
DP01919	Q9V0U0	Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-)	Pyrococcus abyssi (strain GE5 / Orsay)	513	633	598	604	7	AMGLIMG	92.98
DP01919	Q9V0U0	Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-)	Pyrococcus abyssi (strain GE5 / Orsay)	513	633	614	623	10	ADGKLVSQIV	81.81
DP01920	P77522	FeS cluster assembly protein SufB	Escherichia coli (strain K12)	1	33	9	15	7	DDVKTWT	73.91
DP01920	P77522	FeS cluster assembly protein SufB	Escherichia coli (strain K12)	1	33	17	28	12	GPLNYKEGFFTQ	81.41
DP01920	P77522	FeS cluster assembly protein SufB	Escherichia coli (strain K12)	80	156	81	93	13	DKLNYQDYSYYSA	83.3
DP01920	P77522	FeS cluster assembly protein SufB	Escherichia coli (strain K12)	80	156	114	132	19	GANAFLSKEVEAAFEQLGV	80.34
DP01920	P77522	FeS cluster assembly protein SufB	Escherichia coli (strain K12)	80	156	141	151	11	AVDAIFDSVSV	80.75
DP01926	C4M7X2	Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase)	Entamoeba histolytica	583	769	610	624	15	GFQLEIRVGKIVEAG	79.87
DP01926	C4M7X2	Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase)	Entamoeba histolytica	583	769	631	637	7	HLLALKV	74.58
DP01926	C4M7X2	Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase)	Entamoeba histolytica	583	769	662	672	11	NQKATFVCNLK	76.13
DP01926	C4M7X2	Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase)	Entamoeba histolytica	583	769	681	691	11	SEAMILAATSL	75.89
DP01926	C4M7X2	Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase)	Entamoeba histolytica	583	769	703	714	12	ADAAIGAQVIPK	82.92
DP01926	C4M7X2	Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase)	Entamoeba histolytica	583	769	716	761	46	GKVTISAKKISIDVVGKMNLALKGGLVRTNDVPLIVKDTELTVTVD	78.25
DP01928	P03254	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)	1	137	1	30	30	MRHIICHGGVITEEMAASLLDQLIEEVLAD	80.52
DP01928	P03254	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)	1	137	43	53	11	LHELYDLDVTA	90.97
DP01928	P03254	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)	1	137	61	67	7	AVSQIFP	87
DP01928	P03254	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)	1	137	74	83	10	VQEGIDLLTF	81.24
DP01928	P03254	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)	1	137	116	127	12	VPEVIDLTCHEA	74.5
DP01928	P03254	Early E1A protein (Early E1A 32 kDa protein)	Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)	191	289	265	277	13	AVECIEDLLNESG	77.28
DP01930	P29990	Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)	Dengue virus type 2 (strain Thailand/16681/1984) (DENV-2)	108	128	111	119	9	TVMAFHLTT	79.6
DP01937	Q9EPH0	Prestin (Solute carrier family 26 member 5)	Rattus norvegicus (Rat)	564	636	574	596	23	AMRKYAKEVGNANIANATVVKVD	80.24
DP01937	Q9EPH0	Prestin (Solute carrier family 26 member 5)	Rattus norvegicus (Rat)	564	636	612	625	14	DEVKFPPIVIKTTF	77.54
DP01938	P11021	Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein)	Homo sapiens (Human)	1	24	4	15	12	SLVAAMLLLLSA	82.08
DP01939	Q5JJ98	Helicase-associated endonuclease for fork-structured DNA	Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1))	493	588	547	555	9	KVENTEIRE	75.92
DP01941	Q4JC68	ATP-dependent DNA helicase Saci_0192 (EC 3.6.4.12)	Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)	99	143	100	117	18	IPCKYCELKGSIVEVKTD	75.92
DP01941	Q4JC68	ATP-dependent DNA helicase Saci_0192 (EC 3.6.4.12)	Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)	99	143	132	138	7	LQDKFCP	81.32
DP01942	P50553	Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46)	Homo sapiens (Human)	1	236	28	52	25	AACFFATAAAAAAAAAAAAAQSAQQ	80.58
DP01942	P50553	Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46)	Homo sapiens (Human)	1	236	101	114	14	RRLNFSGFGYSLPQ	82.49
DP01942	P50553	Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46)	Homo sapiens (Human)	1	236	129	142	14	NRVKLVNLGFATLR	76.85
DP01942	P50553	Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46)	Homo sapiens (Human)	1	236	162	176	15	SAVEYIRALQQLLDE	82.88
DP01942	P50553	Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46)	Homo sapiens (Human)	1	236	180	204	25	VSAAFQAGVLSPTISPNYSNDLNSM	79.26
DP01942	P50553	Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46)	Homo sapiens (Human)	1	236	208	220	13	PVSSYSSDEGSYD	76.72
DP01943	Q9NRY2	SOSS complex subunit C (INTS3- and NABP-interacting protein) (Sensor of single-strand DNA complex subunit C) (Sensor of ssDNA subunit C) (SOSS-C) (Single-stranded DNA-binding protein-interacting protein 1) (SSB-interacting protein 1) (hSSBIP1)	Homo sapiens (Human)	1	62	1	23	23	MAANSSGQGFQNKNRVAILAELD	79.48
DP01943	Q9NRY2	SOSS complex subunit C (INTS3- and NABP-interacting protein) (Sensor of single-strand DNA complex subunit C) (Sensor of ssDNA subunit C) (SOSS-C) (Single-stranded DNA-binding protein-interacting protein 1) (SSB-interacting protein 1) (hSSBIP1)	Homo sapiens (Human)	1	62	41	48	8	GASIALSR	75.13
DP01944	P31324	cAMP-dependent protein kinase type II-beta regulatory subunit	Mus musculus (Mouse)	1	103	1	23	23	MSIEIPAGLTELLQGFTVEVLRH	79.6
DP01944	P31324	cAMP-dependent protein kinase type II-beta regulatory subunit	Mus musculus (Mouse)	1	103	26	45	20	ADLLEFALQHFTRLQQENER	89.65
DP01944	P31324	cAMP-dependent protein kinase type II-beta regulatory subunit	Mus musculus (Mouse)	1	103	72	80	9	KGVNFAEEP	79.64
DP01944	P31324	cAMP-dependent protein kinase type II-beta regulatory subunit	Mus musculus (Mouse)	394	416	400	411	12	QLVALFGTNMDI	82.55
DP01945	A0A2K8FR49	LEA	Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus)	1	172	4	15	12	HGQSYRAGEATG	79.77
DP01945	A0A2K8FR49	LEA	Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus)	1	172	58	77	20	SEKAYEAKDKTSNMAQSAKG	77.26
DP01945	A0A2K8FR49	LEA	Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus)	1	172	85	92	8	QTGSFASD	77.17
DP01945	A0A2K8FR49	LEA	Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus)	1	172	98	109	12	KDKAYQAAQATK	78.76
DP01945	A0A2K8FR49	LEA	Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus)	1	172	114	123	10	DMTEYAKETA	79.26
DP01945	A0A2K8FR49	LEA	Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus)	1	172	151	157	7	AVKNTFG	78.83
DP01946	S6AWC2	Cold induced 16	Triticum aestivum (Wheat)	1	158	16	28	13	KLVAEAAKTAYEK	78.08
DP01946	S6AWC2	Cold induced 16	Triticum aestivum (Wheat)	1	158	39	54	16	VAAASADILDSAAKYG	78.01
DP01946	S6AWC2	Cold induced 16	Triticum aestivum (Wheat)	1	158	61	78	18	VGQYLEKAEGYLKQYSSG	76.46
DP01947	O65934	ABC transporter ATP-binding/permease protein Rv1747 (EC 7.-.-.-)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	104	230	204	216	13	EAGNLATSMMKIL	77.46
DP01948	Q9HZJ8	Cell division inhibitor SulA	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	42	11	34	24	QLPLFQEAFWASNGAPLLDDVIDS	85.09
DP01951	P04083	Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35)	Homo sapiens (Human)	2	26	2	21	20	AMVSEFLKQAWFIENEEQEY	84.82
DP01951	P04083	Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35)	Homo sapiens (Human)	116	185	134	158	25	EDTLIEILASRTNKEIRDINRVYRE	87.08
DP01963	P19619	Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35)	Sus scrofa (Pig)	1	41	2	25	24	AMVSEFLKQAWFIDNEEQEYIKTV	82.8
DP01963	P19619	Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35)	Sus scrofa (Pig)	1	40	2	25	24	AMVSEFLKQAWFIDNEEQEYIKTV	82.8
DP01965	P0CE48	Elongation factor Tu 2 (EF-Tu 2) (Bacteriophage Q beta RNA-directed RNA polymerase subunit III) (P-43)	Escherichia coli (strain K12)	42	63	43	52	10	AARAFDQIDN	78.83
DP01965	P0CE48	Elongation factor Tu 2 (EF-Tu 2) (Bacteriophage Q beta RNA-directed RNA polymerase subunit III) (P-43)	Escherichia coli (strain K12)	43	63	43	52	10	AARAFDQIDN	78.83
DP01965	P0CE48	Elongation factor Tu 2 (EF-Tu 2) (Bacteriophage Q beta RNA-directed RNA polymerase subunit III) (P-43)	Escherichia coli (strain K12)	44	64	46	52	7	AFDQIDN	76.35
DP01968	A4C1A5	Cold shock protein; putative DNA-binding protein	Polaribacter irgensii 23-P	1	86	4	12	9	SQQTFSKSE	92.64
DP01968	A4C1A5	Cold shock protein; putative DNA-binding protein	Polaribacter irgensii 23-P	1	86	41	55	15	SGIQFAYVDHNGNLT	77.03
DP01968	A4C1A5	Cold shock protein; putative DNA-binding protein	Polaribacter irgensii 23-P	1	86	63	78	16	LKVEYELEDIQISVSK	82.07
DP01969	P27058	Systemin	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	200	32	40	9	KEKIIEKET	80.6
DP01969	P27058	Systemin	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	200	50	64	15	TISSYVLRDDTQEIP	80.33
DP01969	P27058	Systemin	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	200	72	93	22	GYVKEKIVEKETISQYIIKIEG	84.01
DP01969	P27058	Systemin	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	200	101	120	20	LKVEYEEEEYEKEKIVEKET	77.16
DP01969	P27058	Systemin	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	200	150	156	7	SQDIIKM	81.27
DP01969	P27058	Systemin	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	200	160	166	7	GALEITK	81.94
DP01969	P27058	Systemin	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	200	168	177	10	VCEKIIVRED	80.77
DP01970	M1GUG5	MEG-14 (Fragment)	Schistosoma mansoni (Blood fluke)	1	86	10	22	13	ATSTSTHGATSTA	73.91
DP01970	M1GUG5	MEG-14 (Fragment)	Schistosoma mansoni (Blood fluke)	1	86	31	39	9	KAAATSTIK	82.53
DP01970	M1GUG5	MEG-14 (Fragment)	Schistosoma mansoni (Blood fluke)	1	86	46	54	9	KAAATSTTE	74.51
DP01971	P01071	Trypsin inhibitor B (Kunitz-type trypsin inhibitor B)	Glycine max (Soybean) (Glycine hispida)	1	181	1	9	9	DFVLDNEGN	80.27
DP01971	P01071	Trypsin inhibitor B (Kunitz-type trypsin inhibitor B)	Glycine max (Soybean) (Glycine hispida)	1	181	13	30	18	NGGTYYILSDITAFGGIR	80.21
DP01971	P01071	Trypsin inhibitor B (Kunitz-type trypsin inhibitor B)	Glycine max (Soybean) (Glycine hispida)	1	181	53	71	19	GIGTIISSPFRIRFIAEGN	84.1
DP01971	P01071	Trypsin inhibitor B (Kunitz-type trypsin inhibitor B)	Glycine max (Soybean) (Glycine hispida)	1	181	73	99	27	LRLKFDSFAVIMLCVGIPTEWSVVEDL	78.26
DP01971	P01071	Trypsin inhibitor B (Kunitz-type trypsin inhibitor B)	Glycine max (Soybean) (Glycine hispida)	1	181	114	122	9	VDGWFRIER	82.05
DP01971	P01071	Trypsin inhibitor B (Kunitz-type trypsin inhibitor B)	Glycine max (Soybean) (Glycine hispida)	1	181	124	142	19	SDDEFNNYKLVFCTQQAED	78.45
DP01971	P01071	Trypsin inhibitor B (Kunitz-type trypsin inhibitor B)	Glycine max (Soybean) (Glycine hispida)	1	181	146	153	8	GDIGISID	79.43
DP01971	P01071	Trypsin inhibitor B (Kunitz-type trypsin inhibitor B)	Glycine max (Soybean) (Glycine hispida)	1	181	169	176	8	LVVQFQKV	87.63
DP01972	P13693	Translationally-controlled tumor protein (TCTP) (Fortilin) (Histamine-releasing factor) (HRF) (p23)	Homo sapiens (Human)	37	68	39	56	18	TEGNIDDSLIGGNASAEG	82.37
DP01973	Q09514	GLOBIN domain-containing protein	Caenorhabditis elegans	216	266	226	233	8	HQHIEISE	80.14
DP01973	Q09514	GLOBIN domain-containing protein	Caenorhabditis elegans	216	266	242	255	14	KQSEIENTAVSNEP	80.17
DP01974	P39748	Flap endonuclease 1 (FEN-1) (EC 3.1.-.-) (DNase IV) (Flap structure-specific endonuclease 1) (Maturation factor 1) (MF1) (hFEN-1)	Homo sapiens (Human)	106	130	111	125	15	LQQAQAAGAEQEVEK	76.83
DP01975	O74958	RNA binding exosome specificity factor Mmi1 (Meiotic mRNA interception protein 1) (YTH domain-containing protein mmi1)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	282	327	286	302	17	EKSSYLLSNSSNDSASR	80.05
DP01977	P49736	DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28)	Homo sapiens (Human)	1	160	4	11	8	SSESFTMA	79.43
DP01977	P49736	DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28)	Homo sapiens (Human)	1	160	35	41	7	TDALTSS	74.82
DP01977	P49736	DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28)	Homo sapiens (Human)	1	160	80	107	28	DYRAIPELDAYEAEGLALDDEDVEELTA	76.99
DP01977	P49736	DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28)	Homo sapiens (Human)	1	160	133	139	7	RGLLYDS	77.02
DP01979	Q6CMF0	KLLA0E20769p	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	39	1	17	17	MDQQFVAQLEQALGAIV	84.81
DP01979	Q6CMF0	KLLA0E20769p	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	631	656	636	646	11	GDEDFLEGIED	76.89
DP01983	Q9Q8N4	Probable host range protein 2-3	Myxoma virus (strain Lausanne) (MYXV)	151	203	154	164	11	IEEAYDASTEE	88.29
DP01983	Q9Q8N4	Probable host range protein 2-3	Myxoma virus (strain Lausanne) (MYXV)	151	203	175	191	17	DTVHLYCLEEEDEEKIA	81.53
DP01984	B4Y891	Capsid protein VP1 (Fragment)	Adeno-associated virus	1	213	3	24	22	ADGYLPDWLEDNLSEGIREWWD	75.28
DP01984	B4Y891	Capsid protein VP1 (Fragment)	Adeno-associated virus	1	213	44	57	14	GLVLPGYKYLGPFN	75.47
DP01984	B4Y891	Capsid protein VP1 (Fragment)	Adeno-associated virus	1	213	75	94	20	HDKAYDQQLKAGDNPYLRYN	80.3
DP01984	B4Y891	Capsid protein VP1 (Fragment)	Adeno-associated virus	1	213	96	105	10	ADAEFQERLQ	87.96
DP01984	B4Y891	Capsid protein VP1 (Fragment)	Adeno-associated virus	1	213	115	123	9	GRAVFQAKK	75.44
DP01984	B4Y891	Capsid protein VP1 (Fragment)	Adeno-associated virus	1	213	168	175	8	KRLNFEED	80.27
DP01987	Q14493	Histone RNA hairpin-binding protein (Histone stem-loop-binding protein)	Homo sapiens (Human)	200	224	206	219	14	DLQEIHPVDLESAE	78.26
DP01993	Q80VP1	Epsin-1 (EPS-15-interacting protein 1) (Intersectin-EH-binding protein 1) (Ibp1)	Mus musculus (Mouse)	229	407	238	246	9	LQMAIEESK	87.63
DP01993	Q80VP1	Epsin-1 (EPS-15-interacting protein 1) (Intersectin-EH-binding protein 1) (Ibp1)	Mus musculus (Mouse)	229	407	260	267	8	LADVFTTP	76.88
DP01996	Q07009	Calpain-2 catalytic subunit (EC 3.4.22.53) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (Calpain-2 large subunit) (Millimolar-calpain) (M-calpain)	Rattus norvegicus (Rat)	292	321	293	307	15	WTGKWNDNCPSWNTV	76.72
DP01996	Q07009	Calpain-2 catalytic subunit (EC 3.4.22.53) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (Calpain-2 large subunit) (Millimolar-calpain) (M-calpain)	Rattus norvegicus (Rat)	437	459	442	454	13	GQTNIHLSKNFFL	82.71
DP01997	E2IHW6	TarP	Chlamydia trachomatis	726	825	760	766	7	LDVVYPG	91.97
DP01997	E2IHW6	TarP	Chlamydia trachomatis	726	825	776	786	11	LQANQTLGDIV	75.92
DP01997	E2IHW6	TarP	Chlamydia trachomatis	726	825	794	800	7	TSQETVV	73.91
DP01999	Q8K4J6	Myocardin-related transcription factor A (MRTF-A) (Basic SAP coiled-coil transcription activator) (MKL/myocardin-like protein 1) (Megakaryoblastic leukemia 1 protein homolog) (Megakaryocytic acute leukemia protein homolog)	Mus musculus (Mouse)	67	98	75	85	11	VRMHILEETSA	74.89
DP01999	Q8K4J6	Myocardin-related transcription factor A (MRTF-A) (Basic SAP coiled-coil transcription activator) (MKL/myocardin-like protein 1) (Megakaryoblastic leukemia 1 protein homolog) (Megakaryocytic acute leukemia protein homolog)	Mus musculus (Mouse)	111	142	119	137	19	VEKNILPVESSLKEAIIVG	88.93
DP02000	O14745	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory factor 1)	Homo sapiens (Human)	242	358	260	268	9	TNGEIQKEN	76.37
DP02000	O14745	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory factor 1)	Homo sapiens (Human)	242	358	274	281	8	AEAALESP	74.08
DP02000	O14745	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory factor 1)	Homo sapiens (Human)	242	358	319	330	12	PILDFNISLAMA	79.52
DP02002	O15922	DNA-(apurinic or apyrimidinic site) endonuclease (EC 3.1.-.-)	Leishmania major	1	89	11	23	13	GDSASSSTSSLSP	77.26
DP02002	O15922	DNA-(apurinic or apyrimidinic site) endonuclease (EC 3.1.-.-)	Leishmania major	1	89	49	59	11	TDATSATVTAA	75.8
DP02002	O15922	DNA-(apurinic or apyrimidinic site) endonuclease (EC 3.1.-.-)	Leishmania major	1	89	77	83	7	SAAKITN	80.32
DP02003	P16220	Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1)	Homo sapiens (Human)	101	160	119	129	11	SYRKILNDLSS	79.93
DP02003	P16220	Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1)	Homo sapiens (Human)	101	160	147	154	8	SAPAITTV	75.92
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	674	1080	675	681	7	KQGILGN	77.26
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	674	1080	720	727	8	GMNSFNPM	87.29
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	674	1080	789	802	14	AQSQFLPQNQFPSS	76.4
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	674	1080	868	874	7	SLQHTTP	75.25
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	674	1080	921	929	9	AAQAQVTPQ	75.03
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	674	1080	964	970	7	AAASIDN	78.07
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	674	1080	976	986	11	SSVASAETNSQ	74.34
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	674	1080	1026	1044	19	LQGASQVKEETDIAEQKSE	74.78
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	1852	2057	1859	1866	8	LQQAQLMR	75.25
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	1852	2057	1954	1964	11	AAVEAARQIER	75.25
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	1852	2057	1968	1979	12	QQQHLYRVNINN	88.74
DP02004	Q92793	CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Homo sapiens (Human)	1852	2057	2037	2051	15	RPVISMQAQAAVAGP	74.58
DP02005	P47710	Alpha-S1-casein Cleaved into: Casoxin-D	Homo sapiens (Human)	1	185	1	15	15	MRLLILTCLVAVALA	81.05
DP02005	P47710	Alpha-S1-casein Cleaved into: Casoxin-D	Homo sapiens (Human)	1	185	41	47	7	SREEYMN	74.77
DP02005	P47710	Alpha-S1-casein Cleaved into: Casoxin-D	Homo sapiens (Human)	1	185	83	91	9	MESSISSSS	84.95
DP02005	P47710	Alpha-S1-casein Cleaved into: Casoxin-D	Homo sapiens (Human)	1	185	102	124	23	QFCRLNEYNQLQLQAAHAQEQIR	81.53
DP02005	P47710	Alpha-S1-casein Cleaved into: Casoxin-D	Homo sapiens (Human)	1	185	132	162	31	VQVPFQQLNQLAAYPYAVWYYPQIMQYVPFP	82.36
DP02005	P47710	Alpha-S1-casein Cleaved into: Casoxin-D	Homo sapiens (Human)	1	185	172	180	9	AHENYEKNN	87.77
DP02006	P04183	Thymidine kinase; cytosolic (EC 2.7.1.21)	Homo sapiens (Human)	193	234	218	229	12	ARKLFAPQQILQ	77.45
DP02007	Q9H2Y7	Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474)	Homo sapiens (Human)	1265	1521	1284	1294	11	SAGLSSINKEG	88.81
DP02007	Q9H2Y7	Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474)	Homo sapiens (Human)	1265	1521	1307	1321	15	CTSSFLRLSFASETP	75.88
DP02007	Q9H2Y7	Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474)	Homo sapiens (Human)	1265	1521	1334	1346	13	EQQAESTLTSAET	76.64
DP02007	Q9H2Y7	Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474)	Homo sapiens (Human)	1265	1521	1394	1403	10	GKVTTSTWED	78.53
DP02007	Q9H2Y7	Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474)	Homo sapiens (Human)	1265	1521	1423	1443	21	LEVLEIPNPQLEVVAIDSSES	86.42
DP02007	Q9H2Y7	Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474)	Homo sapiens (Human)	1265	1521	1454	1462	9	KDIWNSTEQ	85.54
DP02007	Q9H2Y7	Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474)	Homo sapiens (Human)	1265	1521	1491	1504	14	VSVAETQTVISSIK	81.68
DP02007	Q9H2Y7	Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474)	Homo sapiens (Human)	1265	1521	1508	1514	7	NSSEISS	85.28
DP02008	Q9M4V2	O-acyltransferase	Brassica napus (Rape)	1	113	82	89	8	VDVRYTYR	80.43
DP02009	O75683	Surfeit locus protein 6	Homo sapiens (Human)	1	182	1	23	23	MASLLAKDAYLQSLAKKICSHSA	78.13
DP02009	O75683	Surfeit locus protein 6	Homo sapiens (Human)	1	182	88	97	10	EEAAWASSSA	85.82
DP02009	O75683	Surfeit locus protein 6	Homo sapiens (Human)	1	182	108	119	12	PESVFALDVLRQ	78.43
DP02009	O75683	Surfeit locus protein 6	Homo sapiens (Human)	1	182	171	177	7	AEEATEA	75.59
DP02010	Q9NRJ3	C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28)	Homo sapiens (Human)	1	108	4	27	24	RGLAIVALAVCAALHASEAILPIA	88.28
DP02010	Q9NRJ3	C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28)	Homo sapiens (Human)	1	108	60	67	8	LAAVILHV	81.73
DP02012	Q9Z8L4	Low calcium response E (Type III secreted protein SctW) (Type III secretion regulator YopN/LcrE/InvE/MxiC)	Chlamydia pneumoniae (Chlamydophila pneumoniae)	1	94	14	37	24	QGVNLAAVEAAAAKADAAEVVASQ	77.15
DP02012	Q9Z8L4	Low calcium response E (Type III secreted protein SctW) (Type III secretion regulator YopN/LcrE/InvE/MxiC)	Chlamydia pneumoniae (Chlamydophila pneumoniae)	1	94	41	53	13	EMNMIQQSQDLTN	78.24
DP02012	Q9Z8L4	Low calcium response E (Type III secreted protein SctW) (Type III secretion regulator YopN/LcrE/InvE/MxiC)	Chlamydia pneumoniae (Chlamydophila pneumoniae)	1	94	63	72	10	KEEKFQTLES	76.62
DP02015	P52272	Heterogeneous nuclear ribonucleoprotein M (hnRNP M)	Homo sapiens (Human)	41	70	57	65	9	GGNRFEPYA	77.48
DP02016	Q9RSK0	50S ribosomal protein L36	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)	1	36	22	30	9	RVLVICSNV	82.61
DP02025	P30429	Cell death protein 4	Caenorhabditis elegans	1	108	1	7	7	MLCEIEC	77.54
DP02025	P30429	Cell death protein 4	Caenorhabditis elegans	1	108	14	22	9	HTRLIHDFE	75.92
DP02025	P30429	Cell death protein 4	Caenorhabditis elegans	1	108	24	48	25	RDALTYLEGKNIFTEDHSELISKMS	78.85
DP02025	P30429	Cell death protein 4	Caenorhabditis elegans	1	108	50	62	13	RLERIANFLRIYR	83.64
DP02025	P30429	Cell death protein 4	Caenorhabditis elegans	1	108	68	98	31	LGPLIDFFNYNNQSHLADFLEDYIDFAINEP	85.31
DP02027	P17405	Sphingomyelin phosphodiesterase (EC 3.1.4.12) (Acid sphingomyelinase) (aSMase)	Homo sapiens (Human)	49	85	52	59	8	SRVLWAPA	77.59
DP02027	P17405	Sphingomyelin phosphodiesterase (EC 3.1.4.12) (Acid sphingomyelinase) (aSMase)	Homo sapiens (Human)	170	197	170	182	13	WDIFSSWNISLPT	78.9
DP02030	P09546	Bifunctional protein PutA Includes: Proline dehydrogenase (EC 1.5.5.2) (Proline oxidase); Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C dehydrogenase) (EC 1.2.1.88) (L-glutamate gamma-semialdehyde dehydrogenase)	Escherichia coli (strain K12)	611	669	630	650	21	LASLSSALLNSALQKWQALPM	84.47
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	1	15	15	MRSSILFLLKLMKIM	80.65
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	29	35	7	RFQELVD	79.93
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	43	64	22	HQYKTYYTKYIQWCQLNQIIPT	82.97
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	68	93	26	NSVNSVPYKDLPISAELIHWFLLDTL	78.85
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	112	136	25	EEENSFKIATLKKIIGSLNFLSKLC	80.64
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	142	156	15	PNANIDTKYLESVTK	78.39
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	158	183	26	HTHWIDSQKAITTNETNNTNTQVLCP	79.83
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	188	208	21	VSLNLWNPETNHLSEKFFKTC	78.2
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	211	235	25	KLRFLVDFQLRSYLNLSFEERSKIR	78.19
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	246	254	9	RDAIIYHKV	78.82
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	266	281	16	HHQLLALLPQDCPFIC	75.82
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	285	298	14	TLAAYLYLRFYGIP	87.2
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	314	324	11	NGSLLQDIPIL	76.77
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	328	349	22	SLTTYPREETFSNYYTTVFRYC	83.66
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	355	397	43	RREYFNKCNLVYPTWDEDTFRTFFNEENHGNWLEQPEAFAFPD	81.21
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	402	410	9	DFKKIMNFK	83.61
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	413	420	8	YTSYSTNA	79.26
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	431	443	13	LLVQIFPEIDEYK	80.91
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	447	505	59	YEGLSQNSRDFLDLMEVLRERFLSNLPWIYKFFPNHDIFQDPIFGNSDFQSYFNDKTIH	79.71
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	510	537	28	PILSFDILPGFNKIYKNKTNFYSLLIER	80.21
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	539	546	8	SQLTFASS	83.28
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	571	609	39	TQLNELLKQQSFEYVQFQTLSNFQILLSVFNKIFEKLEM	82.63
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	613	638	26	SRGYILHQLNLFKITLDERIKKSKID	78.96
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	652	660	9	KEENIVNED	89.07
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	673	681	9	QIRLLSIAD	84.32
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	695	711	17	KKDGESIEDGAYGENED	79.89
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	719	739	21	EQLKSMINELINSKISTFLRD	83.36
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	741	795	55	MDQFELKINALLDKILEEKVTRIIEQKLGSHTGKFSTLKRPQLYMTEEHNVGFDM	80.98
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	803	811	9	TSGKYAETV	77.48
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	833	874	42	EAKSYTDEQEFMLDKSIDSIEGIILEWFTPNAKYANQCVHSM	78.36
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	885	893	9	NCEALYKER	80.3
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	895	908	14	SIVEFYIYLVNHES	85.26
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	925	936	12	NEGSFSRLAKFL	80.43
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	956	942	951	10	DHQNSFDGLL	85.79
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	43	1	15	15	MRSSILFLLKLMKIM	80.65
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	43	29	35	7	RFQELVD	79.93
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	539	546	8	SQLTFASS	83.28
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	571	609	39	TQLNELLKQQSFEYVQFQTLSNFQILLSVFNKIFEKLEM	82.63
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	613	638	26	SRGYILHQLNLFKITLDERIKKSKID	78.96
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	652	660	9	KEENIVNED	89.07
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	673	681	9	QIRLLSIAD	84.32
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	695	711	17	KKDGESIEDGAYGENED	79.89
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	719	739	21	EQLKSMINELINSKISTFLRD	83.36
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	741	795	55	MDQFELKINALLDKILEEKVTRIIEQKLGSHTGKFSTLKRPQLYMTEEHNVGFDM	80.98
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	803	811	9	TSGKYAETV	77.48
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	833	874	42	EAKSYTDEQEFMLDKSIDSIEGIILEWFTPNAKYANQCVHSM	78.36
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	885	893	9	NCEALYKER	80.3
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	895	908	14	SIVEFYIYLVNHES	85.26
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	925	936	12	NEGSFSRLAKFL	80.43
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	538	956	942	951	10	DHQNSFDGLL	85.79
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	571	609	39	TQLNELLKQQSFEYVQFQTLSNFQILLSVFNKIFEKLEM	82.63
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	613	638	26	SRGYILHQLNLFKITLDERIKKSKID	78.96
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	652	660	9	KEENIVNED	89.07
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	673	681	9	QIRLLSIAD	84.32
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	695	711	17	KKDGESIEDGAYGENED	79.89
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	719	739	21	EQLKSMINELINSKISTFLRD	83.36
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	741	795	55	MDQFELKINALLDKILEEKVTRIIEQKLGSHTGKFSTLKRPQLYMTEEHNVGFDM	80.98
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	803	811	9	TSGKYAETV	77.48
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	833	874	42	EAKSYTDEQEFMLDKSIDSIEGIILEWFTPNAKYANQCVHSM	78.36
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	885	893	9	NCEALYKER	80.3
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	895	908	14	SIVEFYIYLVNHES	85.26
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	925	936	12	NEGSFSRLAKFL	80.43
DP02033	P32504	Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	552	956	942	951	10	DHQNSFDGLL	85.79
DP02035	A6QHR2	Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS)	Staphylococcus aureus (strain Newman)	323	420	326	333	8	GDLKSLSA	74.58
DP02035	A6QHR2	Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS)	Staphylococcus aureus (strain Newman)	323	420	344	365	22	PQVTLSNDTTNIVEVLIETGIS	77.76
DP02035	A6QHR2	Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS)	Staphylococcus aureus (strain Newman)	323	420	376	385	10	NNGAIYINGE	81.81
DP02035	A6QHR2	Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS)	Staphylococcus aureus (strain Newman)	323	420	388	395	8	QDVNYALA	81.86
DP02035	A6QHR2	Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS)	Staphylococcus aureus (strain Newman)	323	420	400	406	7	IDGEFTI	86
DP02049	O74774	Elongation factor 1 alpha-like protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	155	30	79	50	QEEEFRSAVATVRETLLGVPISEKEIADTVWYYYFDVEKSVNYLLQKASS	82.13
DP02049	O74774	Elongation factor 1 alpha-like protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	155	111	126	16	LDESSNGIKNLSLNKN	74.96
DP02049	O74774	Elongation factor 1 alpha-like protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	204	259	221	232	12	KGSFSYAWLLDT	87.76
DP02049	O74774	Elongation factor 1 alpha-like protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	204	259	243	254	12	MDVASTTFESDK	77.4
DP02050	P41814	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	88	188	112	133	22	SVSLELSSIDSSATNQNLVNMG	80.34
DP02050	P41814	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	88	188	135	146	12	KAQELTVEEIEK	85.59
DP02050	P41814	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	88	188	149	163	15	QESLSSKEIIDKIIK	79.87
DP02050	P41814	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	88	188	170	183	14	NKTVYSQEKYVNRK	86.5
DP02055	P33322	"H/ACA ribonucleoprotein complex subunit CBF5 (EC 5.4.99.-) (Centromere-binding factor 5) (Centromere/microtubule-binding protein CBF5) (H/ACA snoRNP protein CBF5) (Small nucleolar RNP protein CBF5) (p64)"	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	351	394	367	379	13	KLDKYGRVNENTP	78.13
DP02061	P70447	Neurogenin-2 (NGN-2) (Helix-loop-helix protein mATH-4A) (mATH4A) (Protein atonal homolog 4)	Mus musculus (Mouse)	1	31	1	22	22	MFVKSETLELKEEEEVLMLLGS	78.31
DP02066	Q9FG31	Late embryogenesis abundant protein 46 (Late embryogenesis abundant protein 4-5) (AtLEA4-5)	Arabidopsis thaliana (Mouse-ear cress)	1	158	7	17	11	TASNIAASAKS	84.4
DP02066	Q9FG31	Late embryogenesis abundant protein 46 (Late embryogenesis abundant protein 4-5) (AtLEA4-5)	Arabidopsis thaliana (Mouse-ear cress)	1	158	45	58	14	TQVKEDKINQAEMQ	77.4
DP02071	P04383	Capsid protein (Coat protein) (p38)	Carnation mottle virus (CarMV)	1	81	24	39	16	LAVKLVTRGWASLSTN	78.26
DP02071	P04383	Capsid protein (Coat protein) (p38)	Carnation mottle virus (CarMV)	1	81	46	57	12	MLAGYTPAILAF	84.39
DP02075	P28300	Protein-lysine 6-oxidase (EC 1.4.3.13) (Lysyl oxidase) Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form	Homo sapiens (Human)	22	168	42	65	24	WRQQIQWENNGQVFSLLSLGSQYQ	80.03
DP02075	P28300	Protein-lysine 6-oxidase (EC 1.4.3.13) (Lysyl oxidase) Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form	Homo sapiens (Human)	22	168	79	86	8	AANASAQQ	80.27
DP02075	P28300	Protein-lysine 6-oxidase (EC 1.4.3.13) (Lysyl oxidase) Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form	Homo sapiens (Human)	22	168	90	96	7	PILLIRD	75.16
DP02075	P28300	Protein-lysine 6-oxidase (EC 1.4.3.13) (Lysyl oxidase) Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form	Homo sapiens (Human)	22	168	120	133	14	TARHWFQAGYSTSR	78.4
DP02076	O69245	FixK2 protein	Bradyrhizobium japonicum	1	37	7	20	14	KTQVINTQIGGKIA	80.72
DP02078	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	1	171	11	23	13	HGSKYLATASTMD	81.04
DP02078	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	1	171	38	47	10	ILDSIGRFFG	76.52
DP02078	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	1	171	86	95	10	PVVHFFKNIV	86.76
DP02078	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	1	171	109	119	11	GLSLSRFSWGA	76.28
DP02078	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	1	171	147	158	12	AQGTLSKIFKLG	79.68
DP02079	E1BSW7	Centromere protein S (CENP-S)	Gallus gallus (Chicken)	107	139	123	133	11	TEENETPVTES	74.25
DP02086	Q9JPP1	Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132)	Neisseria meningitidis	133	274	146	161	16	NGVLIDGPSQNITLTH	90.43
DP02086	Q9JPP1	Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132)	Neisseria meningitidis	133	274	182	194	13	EFENLNESERIEK	78.49
DP02086	Q9JPP1	Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132)	Neisseria meningitidis	133	274	203	226	24	KFTNLVATAVQANGTNKYVIIYKD	83.85
DP02086	Q9JPP1	Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132)	Neisseria meningitidis	133	274	229	237	9	ASSSFARFR	77.26
DP02094	P49427	Ubiquitin-conjugating enzyme E2 R1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme R1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme R1) (Ubiquitin-conjugating enzyme E2-32 kDa complementing) (Ubiquitin-conjugating enzyme E2-CDC34) (Ubiquitin-protein ligase R1)	Homo sapiens (Human)	183	236	185	195	11	TTLAEYCVKTK	76.1
DP02094	P49427	Ubiquitin-conjugating enzyme E2 R1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme R1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme R1) (Ubiquitin-conjugating enzyme E2-32 kDa complementing) (Ubiquitin-conjugating enzyme E2-CDC34) (Ubiquitin-protein ligase R1)	Homo sapiens (Human)	183	236	202	225	24	GSDLFYDDYYEDGEVEEEADSCFG	78.51
DP02097	P27472	Glycogen starch synthase isoform 2 (EC 2.4.1.11)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	627	705	662	668	7	NSTVYMT	77.69
DP02097	P27472	Glycogen starch synthase isoform 2 (EC 2.4.1.11)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	627	705	676	692	17	QEVNNADDYFSLGVNPA	77.61
DP02097	P27472	Glycogen starch synthase isoform 2 (EC 2.4.1.11)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	640	705	662	668	7	NSTVYMT	77.69
DP02097	P27472	Glycogen starch synthase isoform 2 (EC 2.4.1.11)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	640	705	676	692	17	QEVNNADDYFSLGVNPA	77.61
DP02097	P27472	Glycogen starch synthase isoform 2 (EC 2.4.1.11)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	648	705	662	668	7	NSTVYMT	77.69
DP02097	P27472	Glycogen starch synthase isoform 2 (EC 2.4.1.11)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	648	705	676	692	17	QEVNNADDYFSLGVNPA	77.61
DP02105	P74518	Ribosome hibernation promotion factor (HPF) (Light-repressed protein A)	Synechocystis sp. (strain PCC 6803 / Kazusa)	100	191	104	112	9	GNVKTSEIV	83.39
DP02105	P74518	Ribosome hibernation promotion factor (HPF) (Light-repressed protein A)	Synechocystis sp. (strain PCC 6803 / Kazusa)	100	191	117	123	7	VEENLIG	86.53
DP02105	P74518	Ribosome hibernation promotion factor (HPF) (Light-repressed protein A)	Synechocystis sp. (strain PCC 6803 / Kazusa)	100	191	131	142	12	SEVLRMKYFAMP	78.68
DP02105	P74518	Ribosome hibernation promotion factor (HPF) (Light-repressed protein A)	Synechocystis sp. (strain PCC 6803 / Kazusa)	100	191	150	165	16	LEQLQLVDHDFYMFRN	78.03
DP02105	P74518	Ribosome hibernation promotion factor (HPF) (Light-repressed protein A)	Synechocystis sp. (strain PCC 6803 / Kazusa)	100	191	167	186	20	DTDEINVIYIRNHGGYGVIQ	83.58
DP02109	O94316	Pre-mRNA-splicing factor cwf10 (114 kDa U5 small nuclear ribonucleoprotein component homolog) (Complexed with cdc5 protein 10)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	60	3	15	13	EEDLYDEFGNYIG	85.1
DP02109	O94316	Pre-mRNA-splicing factor cwf10 (114 kDa U5 small nuclear ribonucleoprotein component homolog) (Complexed with cdc5 protein 10)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	60	35	55	21	AQVPSFEEVIPDEELEDVERA	78.82
DP02117	A0A045GWT8	Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)	Mycobacterium tuberculosis	1	50	39	45	7	LLDEIDD	79.93
DP02117	A0A045GWT8	Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)	Mycobacterium tuberculosis	21	58	39	53	15	LLDEIDDVLEENAED	79.93
DP02117	A0A045GWT8	Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)	Mycobacterium tuberculosis	30	59	39	54	16	LLDEIDDVLEENAEDF	80.41
DP02118	P19836	Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A)	Rattus norvegicus (Rat)	1	75	48	56	9	SDEIEVDFS	80.16
DP02118	P19836	Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A)	Rattus norvegicus (Rat)	233	272	233	246	14	SFINEKKYHLQERV	75.25
DP02118	P19836	Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A)	Rattus norvegicus (Rat)	236	312	271	280	10	SIDLIQKWEE	84.38
DP02118	P19836	Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A)	Rattus norvegicus (Rat)	236	312	282	294	13	SREFIGSFLEMFG	80.89
DP02118	P19836	Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A)	Rattus norvegicus (Rat)	237	293	271	280	10	SIDLIQKWEE	84.38
DP02118	P19836	Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A)	Rattus norvegicus (Rat)	237	293	282	288	7	SREFIGS	81.13
DP02122	Q02199	Nucleoporin NUP49/NSP49 (Nuclear pore protein NUP49/NSP49)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	121	154	123	139	17	SRGLFGNNNTNNINNSS	83.2
DP02123	P52948	Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96)	Homo sapiens (Human)	2	150	16	56	41	GFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQ	79.66
DP02123	P52948	Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96)	Homo sapiens (Human)	2	150	61	70	10	GLFGTSSFSQ	79.8
DP02123	P52948	Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96)	Homo sapiens (Human)	2	150	72	96	25	ATSTSTGFGFGTSTGTANTLFGTAS	78.1
DP02123	P52948	Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96)	Homo sapiens (Human)	2	150	98	112	15	GTSLFSSQNNAFAQN	79.93
DP02123	P52948	Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96)	Homo sapiens (Human)	2	150	116	138	23	GFGNFGTSTSSGGLFGTTNTTSN	78.78
DP02124	Q03281	Inner nuclear membrane protein HEH2 (Helix-extension-helix domain-containing protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	99	140	105	112	8	REQISTDN	75.92
DP02127	P0AG30	Transcription termination factor Rho	Escherichia coli (strain K12)	1	30	11	18	8	VSELITLG	81.4
DP02127	P0AG30	Transcription termination factor Rho	Escherichia coli (strain K12)	355	411	356	363	8	PAIDYNRS	73.58
DP02127	P0AG30	Transcription termination factor Rho	Escherichia coli (strain K12)	355	411	367	388	22	KEELLTTQEELQKMWILRKIIH	78.2
DP02127	P0AG30	Transcription termination factor Rho	Escherichia coli (strain K12)	355	411	394	406	13	DAMEFLINKLAMT	83.59
DP02128	P06437	Envelope glycoprotein B (gB)	Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)	31	109	40	48	9	VAAATQAAN	76.25
DP02128	P06437	Envelope glycoprotein B (gB)	Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)	31	109	85	97	13	GDNATVAAGHATL	80.6
DP02128	P06437	Envelope glycoprotein B (gB)	Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)	31	104	40	48	9	VAAATQAAN	76.25
DP02128	P06437	Envelope glycoprotein B (gB)	Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)	31	104	85	97	13	GDNATVAAGHATL	80.6
DP02128	P06437	Envelope glycoprotein B (gB)	Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)	460	492	460	466	7	LAELYVR	97.99
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	233	240	8	VPGNFKSQ	74.08
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	265	271	7	GGNEITR	85.95
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	291	298	8	SAGSWNSG	79.26
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	330	337	8	STGSWNSG	78.43
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	356	363	8	STGTWNPG	79.93
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	369	378	10	SAGHWTSESS	76.96
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	383	389	7	TGQWHSE	80.51
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	409	418	10	DWGTFEEVSG	79
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	480	486	7	KEVVTSE	76.4
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	499	507	9	TLSGIGTLD	76.03
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	515	546	32	DEAAFFDTASTGKTFPGFFSPMLGEFVSETES	79.66
DP02130	P02671	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Homo sapiens (Human)	232	581	549	558	10	SESGIFTNTK	77.56
DP02132	P04386	Regulatory protein GAL4	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	107	144	126	132	7	RISATSS	75.92
DP02137	P0AGE0	Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein)	Escherichia coli (strain K12)	113	178	144	151	8	GGNQFSGG	75.59
DP02143	O67086	50S ribosomal protein L20	Aquifex aeolicus (strain VF5)	1	59	38	47	10	MRALYYQYRD	80.27
DP02143	O67086	50S ribosomal protein L20	Aquifex aeolicus (strain VF5)	90	118	100	113	14	DPQAFEQVVNKVKE	76.49
DP02145	P47054	Nucleoporin NUP192 (Nuclear pore protein NUP192)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	328	424	337	357	21	SMELFYDIRSLLERHIPRLIP	78.56
DP02145	P47054	Nucleoporin NUP192 (Nuclear pore protein NUP192)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	328	424	362	376	15	DDEKIFSQTTNSTYN	84.48
DP02145	P47054	Nucleoporin NUP192 (Nuclear pore protein NUP192)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	328	424	386	393	8	GRGLWNPS	78.01
DP02145	P47054	Nucleoporin NUP192 (Nuclear pore protein NUP192)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	328	424	411	419	9	NNVNEYSYT	84.8
DP02145	P47054	Nucleoporin NUP192 (Nuclear pore protein NUP192)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	576	601	579	596	18	RQQFSESTHNDIDSTAVA	76.92
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	49	307	52	58	7	LAQKLQA	75.25
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	49	307	73	99	27	HDGTWNDNQLQEMAQLRIKHQEELTEL	78.61
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	49	307	107	117	11	AQLVIDLNNQM	81.24
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	49	307	124	148	25	MQMNEAKIAECLQTISDLETECLDL	79.46
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	49	307	167	178	12	DALQITFTALEG	80.07
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	49	307	187	196	10	NQELVTRWMA	73.91
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	49	307	204	211	8	RLNAENEK	75.25
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	49	307	239	249	11	DIEVIVDETSD	75.95
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	49	307	272	284	13	AGGLLDSITNIFG	84.46
DP02148	Q676U5	Autophagy-related protein 16-1 (APG16-like 1)	Homo sapiens (Human)	59	84	73	79	7	HDGTWND	79.36
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	125	1	19	19	MFNKSVNSGFTFGNQNTST	79.55
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	125	37	52	16	STGLFGNVNVNANTST	77.24
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	125	56	71	16	SGGLFNANSNANSISQ	80.73
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	125	75	81	7	NNSLFGN	88.29
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	125	87	120	34	SGGLFGATNNTTSKSAGSLFGNNNATANSTGSTG	79.99
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	124	1	19	19	MFNKSVNSGFTFGNQNTST	79.55
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	124	37	52	16	STGLFGNVNVNANTST	77.24
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	124	56	71	16	SGGLFNANSNANSISQ	80.73
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	124	75	81	7	NNSLFGN	88.29
DP02155	P49687	Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	124	87	119	33	SGGLFGATNNTTSKSAGSLFGNNNATANSTGST	79.79
DP02156	P46673	Nucleoporin NUP85 (Nuclear pore protein NUP85)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	43	14	21	8	DQFDFLDD	77.34
DP02156	P46673	Nucleoporin NUP85 (Nuclear pore protein NUP85)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	43	23	29	7	TAQLSNN	86.62
DP02157	P35729	Nucleoporin NUP120 (Nuclear pore protein NUP120)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	30	52	40	46	7	GDKSIST	78.26
DP02158	P36161	Nucleoporin NUP133 (Nuclear pore protein NUP133)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	55	14	44	31	LSVPIAVVENESLAQLSYEEESQASLMDISM	78.15
DP02159	P32566	Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	340	505	376	384	9	TLNAESIKG	79.3
DP02159	P32566	Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	340	505	390	407	18	ADVQSVQDHESVKIVKTE	81.16
DP02159	P32566	Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	340	505	414	429	16	TTVNTESLGQAEHEIK	75.77
DP02162	P16050	Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12)	Homo sapiens (Human)	22	162	22	28	7	VQLWLVG	79.41
DP02162	P16050	Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12)	Homo sapiens (Human)	22	162	52	66	15	EVPEYLGPLLFVKLR	79.06
DP02162	P16050	Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12)	Homo sapiens (Human)	22	162	72	83	12	KDDAWFCNWISV	83.05
DP02162	P16050	Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12)	Homo sapiens (Human)	22	162	103	109	7	NGVLSLP	82.94
DP02162	P16050	Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12)	Homo sapiens (Human)	22	162	145	157	13	KDGLILNMAGAKL	83.1
DP02163	Q02388	Collagen alpha-1(VII) chain (Long-chain collagen) (LC collagen)	Homo sapiens (Human)	1940	1978	1944	1973	30	RLLETAGIKASALREIVETWDESSGSFLPV	77.26
DP02164	Q8WUM0	Nuclear pore complex protein Nup133 (133 kDa nucleoporin) (Nucleoporin Nup133)	Homo sapiens (Human)	244	293	259	268	10	VSSLFGILSP	85.75
DP02164	Q8WUM0	Nuclear pore complex protein Nup133 (133 kDa nucleoporin) (Nucleoporin Nup133)	Homo sapiens (Human)	244	293	270	280	11	SDLTLSSVLWD	82.27
DP02167	Q8N726	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF)	Homo sapiens (Human)	1	132	4	12	9	RFLVTLRIR	79.6
DP02167	Q8N726	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF)	Homo sapiens (Human)	1	132	19	28	10	RVRVFVVHIP	83.88
DP02167	Q8N726	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF)	Homo sapiens (Human)	1	132	30	37	8	LTGEWAAP	76.92
DP02167	Q8N726	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF)	Homo sapiens (Human)	1	132	41	52	12	AAVALVLMLLRS	78.26
DP02167	Q8N726	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF)	Homo sapiens (Human)	1	37	4	12	9	RFLVTLRIR	79.6
DP02167	Q8N726	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF)	Homo sapiens (Human)	1	37	19	28	10	RVRVFVVHIP	83.88
DP02171	P08621	U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70)	Homo sapiens (Human)	1	100	8	16	9	NLLALFAPR	94.91
DP02171	P08621	U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70)	Homo sapiens (Human)	1	100	34	49	16	HNQPYCGIAPYIREFE	77.3
DP02171	P08621	U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70)	Homo sapiens (Human)	1	100	80	86	7	QEVETEL	77.26
DP02171	P08621	U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70)	Homo sapiens (Human)	1	33	8	16	9	NLLALFAPR	94.91
DP02173	Q9BS26	Endoplasmic reticulum resident protein 44 (ER protein 44) (ERp44) (Thioredoxin domain-containing protein 4)	Homo sapiens (Human)	328	358	328	341	14	HMYVFGDFKDVLIP	84.23
DP02173	Q9BS26	Endoplasmic reticulum resident protein 44 (ER protein 44) (ERp44) (Thioredoxin domain-containing protein 4)	Homo sapiens (Human)	328	358	343	353	11	KLKQFVFDLHS	80.15
DP02192	O00571	ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2)	Homo sapiens (Human)	1	167	4	25	22	VAVENALGLDQQFAGLDLNSSD	77.61
DP02192	O00571	ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2)	Homo sapiens (Human)	1	167	66	73	8	KDAYSSFG	85.45
DP02192	O00571	ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2)	Homo sapiens (Human)	1	167	80	87	8	GKSSFFSD	77.97
DP02192	O00571	ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2)	Homo sapiens (Human)	1	167	146	162	17	LEQELFSGGNTGINFEK	81.21
DP02193	P21734	Ubiquitin-conjugating enzyme E2 1 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 1) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	150	172	158	167	10	GNVEESDLYG	75.65
DP02195	P53136	Ribosome biogenesis protein NSA1 (NOP7-associated protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	434	463	441	448	8	ADELWNKL	80.02
DP02196	P37455	Single-stranded DNA-binding protein A (SSB A)	Bacillus subtilis (strain 168)	107	171	112	137	26	GSGGYNEGNSGGGQYFGGGQNDNPFG	80.73
DP02196	P37455	Single-stranded DNA-binding protein A (SSB A)	Bacillus subtilis (strain 168)	107	171	146	157	12	NQGNSFNDDPFA	83.36
DP02197	P0ADV9	Lipopolysaccharide export system protein LptC	Escherichia coli (strain K12)	24	58	31	43	13	AQVVVNNNDPTYK	77.67
DP02201	P0A9A6	Cell division protein FtsZ	Escherichia coli (strain K12)	317	383	323	329	7	ITLVTNK	75.59
DP02202	P17865	Cell division protein FtsZ	Bacillus subtilis (strain 168)	317	382	330	336	7	LNQSIKT	75.06
DP02202	P17865	Cell division protein FtsZ	Bacillus subtilis (strain 168)	317	382	352	358	7	QQQNTVS	87.96
DP02202	P17865	Cell division protein FtsZ	Bacillus subtilis (strain 168)	317	382	370	377	8	DIPTFLRN	77.26
DP02203	Q9Q6P4	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (strain NY-99) (WNV) (West Nile virus (strain NY-1999))	899	919	900	914	15	EKLEIGWKAWGKSIL	77.88
DP02204	Q5UB51	Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)	Dengue virus type 3 (strain Singapore/8120/1995) (DENV-3)	1413	1438	1415	1421	7	HNLMITV	81.18
DP02205	Q2TUW1	Abscisic stress ripening-like protein	Glycine max (Soybean) (Glycine hispida)	1	238	28	36	9	GYDNTSYSK	75.14
DP02205	Q2TUW1	Abscisic stress ripening-like protein	Glycine max (Soybean) (Glycine hispida)	1	238	57	68	12	YEGGYNKTSYSS	77.01
DP02205	Q2TUW1	Abscisic stress ripening-like protein	Glycine max (Soybean) (Glycine hispida)	1	238	124	130	7	GGGVYPD	75.92
DP02205	Q2TUW1	Abscisic stress ripening-like protein	Glycine max (Soybean) (Glycine hispida)	1	238	133	152	20	TDGGYSKTSGGGYDDEVDYK	75.82
DP02205	Q2TUW1	Abscisic stress ripening-like protein	Glycine max (Soybean) (Glycine hispida)	1	238	171	180	10	SAAAYALHEK	76.05
DP02205	Q2TUW1	Abscisic stress ripening-like protein	Glycine max (Soybean) (Glycine hispida)	1	238	194	215	22	KIEEEVAAAAAVGSGGFAFHEH	74.93
DP02207	P02808	Statherin	Homo sapiens (Human)	20	62	22	41	20	SEEKFLRRIGRFGYGYGPYQ	77.96
DP02207	P02808	Statherin	Homo sapiens (Human)	20	62	45	57	13	EQPLYPQPYQPQY	77.98
DP02208	A0A140GKJ0	ICP47 protein (Immediate-early protein IE12) (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)	Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)	56	88	57	69	13	LLPEIAPNASLGV	77.15
DP02209	O82132	Dehydration-responsive element-binding protein 2A (Protein DREB2A)	Arabidopsis thaliana (Mouse-ear cress)	168	335	181	190	10	MYCLENGAEE	82.61
DP02209	O82132	Dehydration-responsive element-binding protein 2A (Protein DREB2A)	Arabidopsis thaliana (Mouse-ear cress)	168	335	197	214	18	ADKHWLSEFEHNYWSDIL	79.36
DP02209	O82132	Dehydration-responsive element-binding protein 2A (Protein DREB2A)	Arabidopsis thaliana (Mouse-ear cress)	168	335	221	229	9	KEQGIVETC	83.5
DP02209	O82132	Dehydration-responsive element-binding protein 2A (Protein DREB2A)	Arabidopsis thaliana (Mouse-ear cress)	168	335	234	246	13	QDSLSVADYGWPN	80.94
DP02209	O82132	Dehydration-responsive element-binding protein 2A (Protein DREB2A)	Arabidopsis thaliana (Mouse-ear cress)	168	335	270	293	24	GDDVFAGLNQDRYPGNSVANGSYR	78.93
DP02209	O82132	Dehydration-responsive element-binding protein 2A (Protein DREB2A)	Arabidopsis thaliana (Mouse-ear cress)	168	335	304	312	9	LQSLNYGIP	87.07
DP02209	O82132	Dehydration-responsive element-binding protein 2A (Protein DREB2A)	Arabidopsis thaliana (Mouse-ear cress)	168	335	321	330	10	GNGFFDDLSY	83.41
DP02210	Q03519	Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11)	Homo sapiens (Human)	1	129	9	24	16	WTSLLLVDAALLWLLQ	85.43
DP02210	Q03519	Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11)	Homo sapiens (Human)	1	129	35	42	8	LPGLWLEG	84.11
DP02210	Q03519	Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11)	Homo sapiens (Human)	1	129	46	86	41	LGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGA	75.7
DP02210	Q03519	Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11)	Homo sapiens (Human)	1	129	92	119	28	ARVASAPWSWLLVGYGAAGLSWSLWAVL	81.83
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	1	100	14	24	11	SDQYIDPLGIV	96.32
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	1	100	49	57	9	DTNSYGNSS	77.03
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	1	100	61	67	7	DYDSYLD	81.27
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	1	100	74	83	10	DVDAYYANDN	77.12
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	410	422	13	QPSTFAGGISNNA	77.67
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	432	441	10	TSSHFNRNTD	76.32
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	490	498	9	SRSTITNGN	79.93
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	518	530	13	SDSEITSEGSYSD	83.35
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	572	580	9	IETRFNTYK	83.72
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	639	648	10	EVGNFYSKSN	79.73
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	687	695	9	SANGFINRR	90.04
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	716	722	7	QTAVYQN	79.93
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	726	737	12	GAPYIPQQPTYQ	80.1
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	766	772	7	HGQQYPP	73.91
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	775	781	7	QQQPIYQ	86.53
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	789	798	10	PYNSIQNNPQ	74.45
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	802	808	7	SPFNYSQ	78.07
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	826	840	15	NQPHINQNGYQNSYN	88.18
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	856	862	7	PQFNHYG	89.39
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	893	903	11	GNFKLADYERD	75.55
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	905	911	7	MTVGYSQ	77.54
DP02216	Q9U3S5	MUTator	Caenorhabditis elegans	400	950	931	945	15	GYDNFNGNSAPYFNK	87.18
DP02220	P32521	Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1191	1480	1205	1215	11	PSAAFSQNSTN	76.28
DP02220	P32521	Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1191	1480	1241	1247	7	GHNPYFK	76.25
DP02220	P32521	Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1191	1480	1331	1338	8	QANTSNEK	79.93
DP02220	P32521	Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1191	1480	1376	1388	13	SAPAIATAVQKSG	77.26
DP02220	P32521	Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1191	1480	1407	1425	19	TQQASTSEPIIAHVDNYNG	82.17
DP02220	P32521	Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1191	1480	1439	1446	8	DDVLSIPE	78.39
DP02224	P29375	Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A)	Homo sapiens (Human)	184	360	194	200	7	PEVLSTD	74.58
DP02224	P29375	Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A)	Homo sapiens (Human)	184	360	209	215	7	TRMNILP	80.27
DP02224	P29375	Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A)	Homo sapiens (Human)	184	360	237	244	8	KKLQIFGA	77.01
DP02224	P29375	Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A)	Homo sapiens (Human)	184	360	271	279	9	RSDAFNMQM	76.51
DP02224	P29375	Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A)	Homo sapiens (Human)	184	360	286	299	14	LSVNFVDLYVCMFC	86.79
DP02224	P29375	Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A)	Homo sapiens (Human)	184	360	317	325	9	SYHTFCLIP	88.63
DP02226	P24385	G1/S-specific cyclin-D1 (B-cell lymphoma 1 protein) (BCL-1) (BCL-1 oncogene) (PRAD1 oncogene)	Homo sapiens (Human)	1	24	3	19	17	HQLLCCEVETIRRAYPD	78.79
DP02233	Q13547	Histone deacetylase 1 (HD1) (EC 3.5.1.98)	Homo sapiens (Human)	377	482	380	386	7	QMQAIPE	83.28
DP02233	Q13547	Histone deacetylase 1 (HD1) (EC 3.5.1.98)	Homo sapiens (Human)	377	482	403	426	24	KRISICSSDKRIACEEEFSDSEEE	76.06
DP02234	P08476	Inhibin beta A chain (Activin beta-A chain) (Erythroid differentiation protein) (EDF)	Homo sapiens (Human)	359	386	363	377	15	GSSLSFHSTVINHYR	80.91
DP02247	P10721	Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117)	Homo sapiens (Human)	544	565	553	560	8	YEVQWKVV	79.6
DP02248	Q8RWK8	Coilin (Atcoilin)	Arabidopsis thaliana (Mouse-ear cress)	117	350	123	144	22	GEMLLANEEFQKETGGYESESE	83.55
DP02248	Q8RWK8	Coilin (Atcoilin)	Arabidopsis thaliana (Mouse-ear cress)	117	350	194	201	8	TAVVSNVV	75.33
DP02248	Q8RWK8	Coilin (Atcoilin)	Arabidopsis thaliana (Mouse-ear cress)	117	350	210	217	8	LDVQSANN	75.25
DP02248	Q8RWK8	Coilin (Atcoilin)	Arabidopsis thaliana (Mouse-ear cress)	117	350	235	241	7	SQQEESK	74.58
DP02248	Q8RWK8	Coilin (Atcoilin)	Arabidopsis thaliana (Mouse-ear cress)	117	350	246	253	8	LCQLSAET	76.17
DP02248	Q8RWK8	Coilin (Atcoilin)	Arabidopsis thaliana (Mouse-ear cress)	117	350	279	292	14	KEELLQTQLVVAPS	76.25
DP02248	Q8RWK8	Coilin (Atcoilin)	Arabidopsis thaliana (Mouse-ear cress)	117	350	294	300	7	KPVITID	79.65
DP02248	Q8RWK8	Coilin (Atcoilin)	Arabidopsis thaliana (Mouse-ear cress)	117	350	314	322	9	NQQAEEVSD	75.66
DP02253	Q96F86	Enhancer of mRNA-decapping protein 3 (LSM16 homolog) (YjeF N-terminal domain-containing protein 2) (YjeF_N2) (hYjeF_N2) (YjeF domain-containing protein 1)	Homo sapiens (Human)	203	258	206	226	21	FEGNLALFDKAAVFEEIDTYE	85.67
DP02253	Q96F86	Enhancer of mRNA-decapping protein 3 (LSM16 homolog) (YjeF N-terminal domain-containing protein 2) (YjeF_N2) (hYjeF_N2) (YjeF domain-containing protein 1)	Homo sapiens (Human)	203	258	246	253	8	HDENILES	78.43
DP02262	P42226	Signal transducer and activator of transcription 6 (IL-4 Stat)	Homo sapiens (Human)	783	814	783	792	10	GTWIGEDIFP	77.59
DP02263	P32120	Beta-arrestin-2 (Arrestin beta-2) (Arrestin-3)	Bos taurus (Bovine)	350	393	381	388	8	DTNLIEFE	84.57
DP02267	Q8IVG9	Humanin (Humanin mitochondrial) (HNM)	Homo sapiens (Human)	1	24	5	17	13	GFSCLLLLTSEID	81.55
DP02269	Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	Homo sapiens (Human)	1	43	4	14	11	HLWKSQLCEMV	79.93
DP02269	Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	Homo sapiens (Human)	1	43	24	31	8	QDVLGEES	74.25
DP02269	Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	Homo sapiens (Human)	44	111	67	74	8	QSNQILRE	75.25
DP02269	Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	Homo sapiens (Human)	44	111	78	86	9	ELLHFQASQ	82.5
DP02269	Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	Homo sapiens (Human)	44	111	88	98	11	EEKEFLMCKFQ	78.66
DP02271	P29131	Cell division protein FtsN	Escherichia coli (strain K12)	124	215	134	144	11	TQLVEVPWNEQ	76.83
DP02271	P29131	Cell division protein FtsN	Escherichia coli (strain K12)	124	215	159	185	27	AQQLAEQQRLAQQSRTTEQSWQQQTRT	76.58
DP02271	P29131	Cell division protein FtsN	Escherichia coli (strain K12)	124	215	203	210	8	SQQPYQDL	77.59
DP02272	Q7KLE5	Endophilin-A (SH3 domain-containing GRB2-like protein)	Drosophila melanogaster (Fruit fly)	242	452	267	284	18	KLNNANINSNYQNQITTN	84.26
DP02272	Q7KLE5	Endophilin-A (SH3 domain-containing GRB2-like protein)	Drosophila melanogaster (Fruit fly)	242	452	321	328	8	AALVSATP	79.93
DP02272	Q7KLE5	Endophilin-A (SH3 domain-containing GRB2-like protein)	Drosophila melanogaster (Fruit fly)	242	452	348	360	13	GLNASAKATTTTQ	79.93
DP02272	Q7KLE5	Endophilin-A (SH3 domain-containing GRB2-like protein)	Drosophila melanogaster (Fruit fly)	242	452	367	374	8	KAVVSEAV	79.43
DP02272	Q7KLE5	Endophilin-A (SH3 domain-containing GRB2-like protein)	Drosophila melanogaster (Fruit fly)	242	452	382	389	8	AAVAASVT	79.52
DP02272	Q7KLE5	Endophilin-A (SH3 domain-containing GRB2-like protein)	Drosophila melanogaster (Fruit fly)	242	452	397	412	16	AQINGNNNEPSIVKEG	77.05
DP02272	Q7KLE5	Endophilin-A (SH3 domain-containing GRB2-like protein)	Drosophila melanogaster (Fruit fly)	242	452	433	442	10	AANNGNSIEE	75.15
DP02290	Q92905	COP9 signalosome complex subunit 5 (SGN5) (Signalosome subunit 5) (EC 3.4.-.-) (Jun activation domain-binding protein 1)	Homo sapiens (Human)	198	218	199	213	15	GPSEYQTIPLNKIED	79.6
DP02291	P04486	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1)	412	490	416	427	12	TDVSLGDELHLD	74.94
DP02291	P04486	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1)	412	490	471	485	15	ADFEFEQMFTDALGI	77.86
DP02291	P04486	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1)	456	490	471	485	15	ADFEFEQMFTDALGI	77.86
DP02292	Q96PU5	E3 ubiquitin-protein ligase NEDD4-like (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase NED4L) (NEDD4.2) (Nedd4-2)	Homo sapiens (Human)	400	480	402	408	7	YYVNHNN	86.62
DP02292	Q96PU5	E3 ubiquitin-protein ligase NEDD4-like (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase NED4L) (NEDD4.2) (Nedd4-2)	Homo sapiens (Human)	400	480	426	439	14	SGSATNSNNHLIEP	78.36
DP02295	Q05471	Helicase SWR1 (EC 3.6.4.12) (Swi2/Snf2-related 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	599	627	599	607	9	SVGLSALFG	83.24
DP02296	P60761	Neurogranin (Ng) (RC3) Cleaved into: NEUG(55-78)	Mus musculus (Mouse)	26	47	29	39	11	AAAKIQASFRG	81.97
DP02299	P50498	Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen)	Plasmodium falciparum (isolate 3D7)	1	272	5	40	36	KTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIR	84.61
DP02299	P50498	Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen)	Plasmodium falciparum (isolate 3D7)	1	272	238	267	30	GAATSLLNNSSNIASINKFVVLISATLVLS	86.63
DP02299	P50498	Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen)	Plasmodium falciparum (isolate 3D7)	1	270	5	40	36	KTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIR	84.61
DP02299	P50498	Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen)	Plasmodium falciparum (isolate 3D7)	1	270	238	265	28	GAATSLLNNSSNIASINKFVVLISATLV	85.99
DP02304	Q9Y5X1	Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A)	Homo sapiens (Human)	73	183	75	104	30	ADQAFLDSLSASTAQASSSAASNNHQVGSG	76.42
DP02304	Q9Y5X1	Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A)	Homo sapiens (Human)	73	183	108	122	15	WSAWSASKSGNWESS	78.06
DP02304	Q9Y5X1	Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A)	Homo sapiens (Human)	73	183	134	155	22	AQRNTNTPNNWDTAFGHPQAYQ	80.3
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	1	29	29	MRIIILALLIVCTIINYYCAVQNNGNKSL	85.5
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	64	76	13	NDNNEMNNENAES	76.18
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	80	96	17	QGENSNNQEQLNENVHA	78.44
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	98	104	7	DDAMYEG	79.93
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	116	126	11	VDANNNEQEYG	82.12
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	149	174	26	GNDNINNNDNFNNNDNYNDNDNFNEE	79.07
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	184	190	7	EDELTEG	75.25
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	201	216	16	EEATINEMGKITNPFE	78.39
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	236	246	11	NLQSFLSSLTG	77.29
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	258	265	8	DMMNIFGV	89.84
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	284	290	7	KQINELK	79.93
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	314	331	18	NDLLKNKQLLKEAISKLT	77.31
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	358	373	16	MMKMFNALSNENGNLD	82.55
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	380	389	10	TDGSFDSFND	80.17
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	391	399	9	VDNNLVPSN	85.62
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	420	443	24	DDKSFVVNSKYADNSFEDKFNTFD	84.39
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	447	470	24	DDVKYELFGENEEAEELNNNTTTA	83.1
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	475	483	9	DANNSVNTQ	80.6
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	487	539	53	GEEESFSANEENINNNNNHNNKNYNNYNTSQQEEDDNSFNENDEPLISSSQFD	81.2
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	562	584	23	LDLESTNYGSNSSSSMSNNYNSK	82.11
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	606	623	18	GKVSFDMATLQKTIKNFG	81.61
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	1	667	625	642	18	ADNEIVQNILKKYVTIDN	90.77
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	824	993	828	841	14	EGGNFKSPLYDKYG	77.21
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	824	993	843	861	19	KLQKFKRQRAFNILKQWRA	85
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	824	993	879	893	15	KEFDFSKNYNFSSKN	81.81
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	824	993	895	913	19	GGVTMFSKDQLEDMVKNFG	78.88
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	824	993	927	935	9	KENPFVPTN	75.25
DP02305	Q8ILA1	Translocon component PTEX150	Plasmodium falciparum (isolate 3D7)	824	993	946	954	9	MDNGYVTFD	91.19
DP02306	Q8TBC4	NEDD8-activating enzyme E1 catalytic subunit (EC 6.2.1.64) (NEDD8-activating enzyme E1C) (Ubiquitin-activating enzyme E1C) (Ubiquitin-like modifier-activating enzyme 3) (Ubiquitin-activating enzyme 3)	Homo sapiens (Human)	405	463	410	423	14	NRTLYLQSVTSIEE	75.56
DP02306	Q8TBC4	NEDD8-activating enzyme E1 catalytic subunit (EC 6.2.1.64) (NEDD8-activating enzyme E1C) (Ubiquitin-activating enzyme E1C) (Ubiquitin-like modifier-activating enzyme 3) (Ubiquitin-activating enzyme 3)	Homo sapiens (Human)	405	463	441	458	18	GQELAVADVTTPQTVLFK	79.23
DP02309	Q96RF0	Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1)	Homo sapiens (Human)	59	224	103	110	8	AFQALLQP	81.73
DP02309	Q96RF0	Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1)	Homo sapiens (Human)	59	224	124	134	11	AGFPYGGGALQ	79.93
DP02309	Q96RF0	Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1)	Homo sapiens (Human)	59	224	137	148	12	PQQLYGGYQASQ	82.02
DP02309	Q96RF0	Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1)	Homo sapiens (Human)	59	224	189	197	9	AAGRYRLST	75.25
DP02311	Q7DD77	PilP protein	Neisseria meningitidis serogroup B (strain MC58)	20	84	22	29	8	DLNEWMAQ	76.63
DP02311	Q7DD77	PilP protein	Neisseria meningitidis serogroup B (strain MC58)	20	84	34	42	9	AKAEIIPFQ	78.08
DP02311	Q7DD77	PilP protein	Neisseria meningitidis serogroup B (strain MC58)	20	84	48	54	7	VAPVYSP	77.93
DP02311	Q7DD77	PilP protein	Neisseria meningitidis serogroup B (strain MC58)	20	84	59	66	8	GPNAFDFR	78.68
DP02311	Q7DD77	PilP protein	Neisseria meningitidis serogroup B (strain MC58)	20	69	22	29	8	DLNEWMAQ	76.63
DP02311	Q7DD77	PilP protein	Neisseria meningitidis serogroup B (strain MC58)	20	69	34	42	9	AKAEIIPFQ	78.08
DP02311	Q7DD77	PilP protein	Neisseria meningitidis serogroup B (strain MC58)	20	69	48	54	7	VAPVYSP	77.93
DP02312	Q8T9B6	LDLR chaperone boca	Drosophila melanogaster (Fruit fly)	19	91	46	52	7	LDQWEED	79.5
DP02312	Q8T9B6	LDLR chaperone boca	Drosophila melanogaster (Fruit fly)	31	91	46	52	7	LDQWEED	79.5
DP02313	Q8IG33	Boca/MESD chaperone for YWTD beta-propeller-EGF	Caenorhabditis elegans	18	88	26	45	20	DLSSYTDAELEKLYEEWEEN	78.7
DP02316	O43663	Protein regulator of cytokinesis 1	Homo sapiens (Human)	467	620	487	514	28	KLNTTTMSNATANSSIRPIFGGTVYHSP	78.32
DP02316	O43663	Protein regulator of cytokinesis 1	Homo sapiens (Human)	467	620	543	558	16	GANKENLELNGSILSG	77.68
DP02316	O43663	Protein regulator of cytokinesis 1	Homo sapiens (Human)	467	620	566	583	18	LQRNFSINSVASTYSEFA	86.64
DP02316	O43663	Protein regulator of cytokinesis 1	Homo sapiens (Human)	467	620	608	615	8	ATSGILNS	78.72
DP02317	Q03689	Heterokaryon incompatibility protein s (Small s protein) (Vegetative incompatibility protein s)	Podospora anserina (Pleurage anserina)	228	289	242	267	26	GNVVTAAALHGGIRISDQTTNSVETV	77.91
DP02317	Q03689	Heterokaryon incompatibility protein s (Small s protein) (Vegetative incompatibility protein s)	Podospora anserina (Pleurage anserina)	228	289	273	284	12	SRVLIGNEYGGK	81.63
DP02322	A0LU48	Depupylase (EC 3.4.-.-)	Acidothermus cellulolyticus (strain ATCC 43068 / 11B)	36	80	45	53	9	ARWDFEEEN	75.59
DP02323	Q5L0X5	Cell division protein DivIB	Geobacillus kaustophilus (strain HTA426)	233	261	233	246	14	KGVIHLEVGSYFVP	84.73
DP02327	Q00169	Phosphatidylinositol transfer protein alpha isoform (PI-TP-alpha) (PtdIns transfer protein alpha) (PtdInsTP alpha)	Homo sapiens (Human)	119	190	136	144	9	VEAVYIDIA	82.53
DP02327	Q00169	Phosphatidylinositol transfer protein alpha isoform (PI-TP-alpha) (PtdIns transfer protein alpha) (PtdInsTP alpha)	Homo sapiens (Human)	119	190	178	185	8	KQELVNQK	75.59
DP02327	Q00169	Phosphatidylinositol transfer protein alpha isoform (PI-TP-alpha) (PtdIns transfer protein alpha) (PtdInsTP alpha)	Homo sapiens (Human)	233	270	235	241	7	WVDLTMD	74.25
DP02328	P53779	Mitogen-activated protein kinase 10 (MAP kinase 10) (MAPK 10) (EC 2.7.11.24) (MAP kinase p49 3F12) (Stress-activated protein kinase 1b) (SAPK1b) (Stress-activated protein kinase JNK3) (c-Jun N-terminal kinase 3)	Homo sapiens (Human)	206	231	213	226	14	TAGTSFMMTPYVVT	75.47
DP02329	K7J0R2	Uncharacterized protein	Nasonia vitripennis	351	385	364	376	13	DGSVFDNNDDSYL	77.1
DP02330	C4PB33	Vitellogenin	Bombus ignitus (Bumblebee)	361	395	364	390	27	KGQNYRSLSSDSSSSSSFSNSEEDHYW	78.79
DP02331	O17428	Vitellogenin	Pimpla nipponica	356	397	383	392	10	LESNEEQLYW	84.58
DP02332	Q9BUQ8	Probable ATP-dependent RNA helicase DDX23 (EC 3.6.4.13) (100 kDa U5 snRNP-specific protein) (DEAD box protein 23) (PRP28 homolog) (U5-100kD)	Homo sapiens (Human)	1	257	143	149	7	SLEELLA	79.36
DP02332	Q9BUQ8	Probable ATP-dependent RNA helicase DDX23 (EC 3.6.4.13) (100 kDa U5 snRNP-specific protein) (DEAD box protein 23) (PRP28 homolog) (U5-100kD)	Homo sapiens (Human)	1	257	246	252	7	ELHAIKE	77.26
DP02334	Q98148	"Kaposis sarcoma-associated herpes-like virus ORF73 homolog"	"Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)"	1110	1162	1118	1125	8	ARLAWEAS	79.31
DP02334	Q98148	"Kaposis sarcoma-associated herpes-like virus ORF73 homolog"	"Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)"	1110	1162	1128	1140	13	LAGNLQSSIVKFK	85.34
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	1	342	11	38	28	LEGIETDTQPILLQSCTGLVTHRLLEED	73.91
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	1	342	84	93	10	ADSPYSSGIM	77.26
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	1	342	95	109	15	TQSLESKAERIARYK	77.93
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	1	342	116	125	10	LAEKYGLTLD	81.94
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	1	342	163	174	12	AGSSYSRTELSG	86.62
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	1	342	196	204	9	TEVLLNAEN	83.61
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	1	342	224	234	11	GEVSSSFSFSG	79.72
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	1	342	284	290	7	KHEWFLQ	87.63
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	1	342	297	305	9	TPSLINWPS	78.67
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	11	174	11	38	28	LEGIETDTQPILLQSCTGLVTHRLLEED	73.91
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	11	174	84	93	10	ADSPYSSGIM	77.26
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	11	174	95	109	15	TQSLESKAERIARYK	77.93
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	11	174	116	125	10	LAEKYGLTLD	81.94
DP02337	O46385	Supervillin (Archvillin) (p205/p250)	Bos taurus (Bovine)	11	174	163	169	7	AGSSYSR	86.62
DP02340	A0A3N4AZ09	Putative exported protein	Yersinia pestis	21	112	26	53	28	KVCFYMDDDYNGESLCAAQGNSVASIPD	78.69
DP02340	A0A3N4AZ09	Putative exported protein	Yersinia pestis	21	112	56	65	10	NDRISSISIP	83.68
DP02340	A0A3N4AZ09	Putative exported protein	Yersinia pestis	21	112	67	107	41	GLVVTVYEDVDFLGASRSFEADVDLVSDKDLIYLNDNISAF	80.49
DP02340	A0A3N4AZ09	Putative exported protein	Yersinia pestis	110	215	111	142	32	KAVCFYGESNFTGDSLCLSSGEQFDLYRGNYP	82.31
DP02340	A0A3N4AZ09	Putative exported protein	Yersinia pestis	110	215	145	163	19	KQSHLVNPLNDEVYSIKIP	77.59
DP02340	A0A3N4AZ09	Putative exported protein	Yersinia pestis	110	215	165	188	24	GMQTTVYEDDDYNGKYFVLTEDYT	79.4
DP02340	A0A3N4AZ09	Putative exported protein	Yersinia pestis	110	215	190	203	14	DDLLIIRMNNKISS	81.82
DP02341	A0A178W0D3	Plastid transcriptionally active 4	Arabidopsis thaliana (Mouse-ear cress)	221	259	231	238	8	TVAASTRY	73.91
DP02341	A0A178W0D3	Plastid transcriptionally active 4	Arabidopsis thaliana (Mouse-ear cress)	221	259	241	252	12	KDSEIENELNEL	80.52
DP02345	Q92804	TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56)	Homo sapiens (Human)	1	198	13	21	9	EQQSYSTYG	88.93
DP02345	Q92804	TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56)	Homo sapiens (Human)	1	198	24	84	61	GSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYN	80.22
DP02345	Q92804	TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56)	Homo sapiens (Human)	1	198	88	94	7	QQQNMES	77.26
DP02345	Q92804	TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56)	Homo sapiens (Human)	1	198	112	123	12	QQDSYDQQSGYD	80.1
DP02345	Q92804	TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56)	Homo sapiens (Human)	1	198	125	136	12	HQGSYDEQSNYD	90.47
DP02345	Q92804	TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56)	Homo sapiens (Human)	1	198	139	160	22	HDSYSQNQQSYHSQRENYSHHT	82.49
DP02346	Q9BTL3	RNA guanine-N7 methyltransferase activating subunit	Homo sapiens	2	45	11	29	19	FEEMFASRFTENDKEYQEY	81.18
DP02353	P0DMV9	Heat shock 70 kDa protein 1B (Heat shock 70 kDa protein 2) (HSP70-2) (HSP70.2)	Homo sapiens (Human)	229	306	236	246	11	RLVNHFVEEFK	84.01
DP02353	P0DMV9	Heat shock 70 kDa protein 1B (Heat shock 70 kDa protein 2) (HSP70-2) (HSP70.2)	Homo sapiens (Human)	229	306	279	299	21	QASLEIDSLFEGIDFYTSITR	82.04
DP02355	P36080	Ribosomal RNA-processing protein 14	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	1	295	12	39	28	NSSAFDGLLALIPAKYYYDEKSQEQWKA	84.71
DP02355	P36080	Ribosomal RNA-processing protein 14	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	1	295	130	136	7	DIKVIFD	89.44
DP02355	P36080	Ribosomal RNA-processing protein 14	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	1	295	181	187	7	LQAKISD	89.63
DP02355	P36080	Ribosomal RNA-processing protein 14	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	1	295	197	205	9	SREAILAQR	76.66
DP02355	P36080	Ribosomal RNA-processing protein 14	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	1	295	224	231	8	DQDEIASD	79.93
DP02355	P36080	Ribosomal RNA-processing protein 14	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	1	295	261	272	12	DGVMFQNIIFDD	89.66
DP02356	P78794	Pre-mRNA-splicing factor cwf15	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	71	222	80	89	10	NSKLIEGFTS	76.72
DP02356	P78794	Pre-mRNA-splicing factor cwf15	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	71	222	100	114	15	VEVDYQELLRQTLEA	80.56
DP02356	P78794	Pre-mRNA-splicing factor cwf15	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	71	222	141	149	9	TESNSQESV	76.25
DP02356	P78794	Pre-mRNA-splicing factor cwf15	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	71	222	167	179	13	TQQLLRELENIKQ	81.61
DP02356	P78794	Pre-mRNA-splicing factor cwf15	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	71	222	200	214	15	REREIAFGNELLNKA	79.82
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2046	2055	10	QRQQIAEIEK	84.08
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2060	2072	13	NAQVTAVTTKTTN	80.09
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2077	2093	17	EMVVTTTSAYENEKFSS	78.63
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2098	2144	47	RNRAISSISLPLRTKNIYVNSDNISETFPYTYILPQNLLRKFVTISD	81.92
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2147	2155	9	TQVAGYMYG	80.94
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2163	2173	11	QIKEIRCIALV	75.55
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2175	2186	12	QLGSIRNVQLPS	77.26
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2192	2198	7	LQPSILE	77.26
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2202	2230	29	PLGWIHTQSSELPYLSSVDVTTHAKILSS	77.81
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2237	2258	22	KAVTLTVSYIPGSISLAAYTVS	87.61
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2269	2281	13	MDINSDEAIGYEP	78.24
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2286	2327	42	KCQLLLSDRIQGFFLVPEEGVWNYNFNGASFSPKMTYSLKLD	80.9
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2331	2337	7	PFFALEH	74.3
DP02357	O14187	Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	2044	2363	2340	2356	17	THVISYTELETNDRLEE	80.9
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	1	299	1	21	21	MDAGFFRGTSAEQDNRFSNKQ	80.12
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	1	299	26	36	11	KQLKFAECLEK	81.36
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	1	299	42	77	36	KVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEV	80.91
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	1	299	83	142	60	KMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLA	79.33
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	1	299	235	247	13	VQEATSTSDILKV	80.27
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	1	31	1	21	21	MDAGFFRGTSAEQDNRFSNKQ	80.12
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	127	904	235	247	13	VQEATSTSDILKV	80.27
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	127	904	459	466	8	KVELSESE	75.25
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	127	904	489	495	7	NQQSSSD	76.25
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	127	904	835	863	29	KAVAAAAAAAVTPAAIAAATTTLAQEEPV	76.81
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	351	688	459	466	8	KVELSESE	75.25
DP02359	Q8IYB3	Serine/arginine repetitive matrix protein 1	Homo sapiens	351	688	489	495	7	NQQSSSD	76.25
DP02369	Q00780	Collagen alpha-1(VIII) chain Cleaved into: Vastatin	Mus musculus (Mouse)	570	612	580	586	7	PQGEYLP	80.27
DP02371	O08583	THO complex subunit 4	Mus musculus	77	182	87	96	10	QHDLFDSGFG	75.45
DP02371	O08583	THO complex subunit 4	Mus musculus	77	182	99	132	34	AGVETGGKLLVSNLDFGVSDADIQELFAEFGTLK	82.24
DP02371	O08583	THO complex subunit 4	Mus musculus	77	182	161	168	8	AMKQYNGV	75.25
DP02371	O08583	THO complex subunit 4	Mus musculus	77	104	87	96	10	QHDLFDSGFG	75.45
DP02372	Q88MI5	Putative Killer protein	Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)	1	22	10	17	8	TEALFTTG	86.08
DP02373	Q92837	Proto-oncogene FRAT1	Homo sapiens	1	198	22	38	17	EDSFLLLQQSVALGSSG	76.08
DP02373	Q92837	Proto-oncogene FRAT1	Homo sapiens	1	198	43	60	18	LVAQIGETLQLDAAQHSP	75.07
DP02373	Q92837	Proto-oncogene FRAT1	Homo sapiens	1	198	128	141	14	YCVAELATGPSALS	77.9
DP02373	Q92837	Proto-oncogene FRAT1	Homo sapiens	188	226	202	216	15	LLQQLVLSGNLIKEA	79.26
DP02380	O23661	Auxin response factor 3	Arabidopsis thaliana	388	594	390	403	14	SGSISNSGSFVTTG	80.29
DP02380	O23661	Auxin response factor 3	Arabidopsis thaliana	388	594	408	414	7	RIGFSSG	73.91
DP02380	O23661	Auxin response factor 3	Arabidopsis thaliana	388	594	427	451	25	TDFEESLRFQRVLQGQEIFPGFINT	81.08
DP02380	O23661	Auxin response factor 3	Arabidopsis thaliana	388	594	470	478	9	GDSYGFHKV	75.25
DP02380	O23661	Auxin response factor 3	Arabidopsis thaliana	388	594	480	492	13	QGQETVPAYSITD	81.32
DP02380	O23661	Auxin response factor 3	Arabidopsis thaliana	388	594	500	517	18	SQRNIWCGPFQNFSTRIL	81.25
DP02380	O23661	Auxin response factor 3	Arabidopsis thaliana	388	594	526	536	11	SSVLLTNSNSP	79.08
DP02380	O23661	Auxin response factor 3	Arabidopsis thaliana	388	594	549	569	21	RCRLFGFPLTDETTAVASATA	77.61
DP02380	O23661	Auxin response factor 3	Arabidopsis thaliana	388	594	582	589	8	SAVQSNHH	75.25
DP02381	O60706-2	Isoform SUR2B of ATP-binding cassette sub-family C member 9	Homo sapiens	618	669	651	657	7	HLDSYEQ	79.36
DP02382	Q15046	Lysine--tRNA ligase	Homo sapiens	1	70	4	12	9	VQAAEVKVD	79.93
DP02382	Q15046	Lysine--tRNA ligase	Homo sapiens	1	70	48	60	13	LSQATAAATNHTT	75.92
DP02383	P08631	Tyrosine-protein kinase HCK	Homo sapiens	2	79	25	44	20	MKSKFLQVGGNTFSKTETSA	77.29
DP02384	P82804	Partner of Y14 and mago (DmPYM) (Protein within the bgcn gene intron)	Drosophila melanogaster (Fruit fly)	33	58	38	44	7	EVPLYES	79.26
DP02386	Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	Homo sapiens (Human)	156	513	237	245	9	RNRTYSSSG	75.92
DP02386	Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	Homo sapiens (Human)	156	513	346	354	9	HPVQFYSMN	79.19
DP02386	Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	Homo sapiens (Human)	156	513	382	395	14	SLQNQMNGGPFYSQ	76.45
DP02386	Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	Homo sapiens (Human)	156	513	431	438	8	AAVVEYSD	82.32
DP02386	Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	Homo sapiens (Human)	156	513	455	464	10	KVVAIYDYTK	87.39
DP02386	Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	Homo sapiens (Human)	156	513	467	483	17	EDELSFQEGAIIYVIKK	84.73
DP02386	Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	Homo sapiens (Human)	156	513	485	508	24	DDGWYEGVMNGVTGLFPGNYVESI	81.66
DP02390	Q9NQS7	Inner centromere protein	Homo sapiens (Human)	853	903	853	862	10	QAIIHQYYHP	83.91
DP02390	Q9NQS7	Inner centromere protein	Homo sapiens (Human)	853	903	864	873	10	NLLELFGTIL	91.1
DP02390	Q9NQS7	Inner centromere protein	Homo sapiens (Human)	853	903	876	884	9	DLEDIFKKS	79.64
DP02391	Q9Y580	RNA-binding protein 7	Homo sapiens	90	266	93	101	9	QDVSLSYPQ	77.85
DP02391	Q9Y580	RNA-binding protein 7	Homo sapiens	90	266	127	142	16	SAQIIQRSFSSPENFQ	79.83
DP02391	Q9Y580	RNA-binding protein 7	Homo sapiens	90	266	152	161	10	RQMSYGGKFG	76.86
DP02391	Q9Y580	RNA-binding protein 7	Homo sapiens	90	266	166	191	26	DQSGFSPSVQSHSHSFNQSSSSQWRQ	75.97
DP02391	Q9Y580	RNA-binding protein 7	Homo sapiens	90	266	201	221	21	RMNSYPYLADRHYSREQRYTD	77.8
DP02391	Q9Y580	RNA-binding protein 7	Homo sapiens	90	266	232	239	8	RDDFFYED	87.63
DP02395	P35201	Inner kinetochore subunit MIF2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	331	438	378	409	32	NEDIIERIESGGIENGEWLKHGILEANVKISD	81.4
DP02395	P35201	Inner kinetochore subunit MIF2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	331	438	415	430	16	KDEIIAFAPNLSQTEQ	92.43
DP02395	P35201	Inner kinetochore subunit MIF2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	365	436	378	409	32	NEDIIERIESGGIENGEWLKHGILEANVKISD	81.4
DP02395	P35201	Inner kinetochore subunit MIF2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	365	436	415	430	16	KDEIIAFAPNLSQTEQ	92.43
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1735	1918	1738	1746	9	SLWKSVFSG	78.78
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1735	1918	1789	1796	8	RQLSFSED	78.43
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1735	1918	1802	1809	8	DDVLEKSS	76.59
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1735	1918	1820	1830	11	TEEELNAKLTR	75.92
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1735	1918	1850	1856	7	RAQIIQR	76.68
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1735	1918	1858	1864	7	LQQVEER	74.58
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1735	1918	1893	1913	21	LMQEWFKLVQEKNAMVRYESE	80.12
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1881	1990	1893	1925	33	LMQEWFKLVQEKNAMVRYESELMIFARELELED	78.44
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1881	1990	1930	1936	7	LQQELRE	74.25
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1881	1990	1953	1966	14	EKQILNEMLEVVEQ	77.09
DP02396	Q7RTP6	F-actin-monooxygenase MICAL3	Homo sapiens	1881	1990	1969	1977	9	SLVALLEEQ	77.74
DP02398	Q04637	Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220)	Homo sapiens (Human)	161	216	192	198	7	ITEEIMS	76.06
DP02398	Q04637	Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220)	Homo sapiens (Human)	178	203	192	198	7	ITEEIMS	76.06
DP02400	P48598	Eukaryotic translation initiation factor 4E1	Drosophila melanogaster	1	68	16	22	7	SMFKTSA	75.25
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	1	272	32	44	13	GASSTNGGLHYSE	76.82
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	1	272	61	73	13	VGAEYQARIPEFD	77.51
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	1	272	75	81	7	GATKYTD	80.6
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	1	272	86	93	8	GMLVWSPY	84.7
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	1	272	100	111	12	KLDEYIAIAKEK	91.86
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	1	272	113	134	22	GYNVEQALGMLFWHKHNIEKSL	76.41
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	1	272	151	163	13	DKVLFEQAFSFHG	78.98
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	1	272	165	190	26	SFHRIQQMLPDKTIASLVKYYYSWKK	79.17
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	406	553	407	427	21	GTQASNGDASTLGEETKSASN	79.93
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	406	553	494	501	8	QQQARFIQ	84.53
DP02408	Q9P2K3	REST corepressor 3	Homo sapiens (Human)	406	553	540	548	9	SLIGIQTDS	77.26
DP02409	Q9BTT0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	Homo sapiens	186	232	215	227	13	EVGLSYLMKEEIQ	81.48
DP02446	Q8IU57	Interferon lambda receptor 1	Homo sapiens	270	299	274	280	7	HPVATFQ	78.4
DP02446	Q8IU57	Interferon lambda receptor 1	Homo sapiens	270	299	287	294	8	VNDLFLCP	80.6
DP02451	P46938	Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog)	Mus musculus (Mouse)	35	64	44	58	15	GDSETDLEALFNAVM	78.13
DP02455	Q9UKX7	Nuclear pore complex protein Nup50 (50 kDa nucleoporin) (Nuclear pore-associated protein 60 kDa-like) (Nucleoporin Nup50)	Homo sapiens (Human)	48	109	48	62	15	VGFESDTGGAFKGFK	75.45
DP02455	Q9UKX7	Nuclear pore complex protein Nup50 (50 kDa nucleoporin) (Nuclear pore-associated protein 60 kDa-like) (Nucleoporin Nup50)	Homo sapiens (Human)	48	109	85	97	13	LEGLSNGNNITSA	77.18
DP02458	P17181	Interferon alpha/beta receptor 1	Homo sapiens	330	436	335	352	18	PVFNIRSLSDSFHIYIGA	80.64
DP02458	P17181	Interferon alpha/beta receptor 1	Homo sapiens	330	436	361	386	26	VIQDYPLIYEIIFWENTSNAERKIIE	82.11
DP02458	P17181	Interferon alpha/beta receptor 1	Homo sapiens	330	436	411	423	13	MDEKLNKSSVFSD	76.07
DP02460	Q23985	Protein deltex (Probable E3 ubiquitin-protein ligase deltex) (EC 2.3.2.27) (RING-type E3 ubiquitin transferase deltex)	Drosophila melanogaster (Fruit fly)	212	261	215	235	21	QQANQLKSNSASVSSQYNTLP	80.98
DP02463	Q9NRR4	Ribonuclease 3	Homo sapiens	411	432	417	425	9	HSENYYSSD	78.48
DP02463	Q9NRR4	Ribonuclease 3	Homo sapiens	459	521	498	509	12	DSEVFDVIAEIK	82.16
DP02463	Q9NRR4	Ribonuclease 3	Homo sapiens	712	849	715	737	23	PEEEIANMLQWEELEWQKYAEEC	80.37
DP02463	Q9NRR4	Ribonuclease 3	Homo sapiens	712	849	739	745	7	GMIVTNP	77.26
DP02463	Q9NRR4	Ribonuclease 3	Homo sapiens	712	849	764	801	38	PDVITFPIIVHFGIRPAQLSYAGDPQYQKLWKSYVKLR	83.12
DP02463	Q9NRR4	Ribonuclease 3	Homo sapiens	712	849	824	834	11	ALQKIRQKNTM	86.96
DP02463	Q9NRR4	Ribonuclease 3	Homo sapiens	712	849	838	844	7	VTVELSS	79.93
DP02463	Q9NRR4	Ribonuclease 3	Homo sapiens	930	957	940	950	11	KGINTLINIMS	82.67
DP02463	Q9NRR4	Ribonuclease 3	Homo sapiens	1333	1365	1340	1349	10	QKRFIERKYR	73.91
DP02471	Q96G97	Seipin	Homo sapiens	2	60	8	22	15	PALLWAQEVGQVLAG	77.97
DP02471	Q96G97	Seipin	Homo sapiens	2	60	27	55	29	LLLQFGVLFCTILLLLWVSVFLYGSFYYS	85.27
DP02471	Q96G97	Seipin	Homo sapiens	220	398	221	264	44	TGLRYLLYNFPMTCAFIGVASNFTFLSVIVLFSYMQWVWGGIWP	84.78
DP02471	Q96G97	Seipin	Homo sapiens	220	398	267	276	10	RFSLQVNIRK	90.94
DP02471	Q96G97	Seipin	Homo sapiens	220	398	354	364	11	DAALLTEANLP	80.27
DP02471	Q96G97	Seipin	Homo sapiens	220	398	373	380	8	APVLETLG	75.42
DP02474	Q12000	Translation machinery-associated protein 46 (DRG family-regulatory protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	283	319	299	311	13	QGSAWDLTEFTDA	77.28
DP02475	Q86UE8	Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2)	Homo sapiens (Human)	191	391	197	205	9	SQKQISIQH	84.32
DP02475	Q86UE8	Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2)	Homo sapiens (Human)	191	391	210	224	15	SDLTIEKISALENSK	81.16
DP02475	Q86UE8	Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2)	Homo sapiens (Human)	191	391	271	284	14	KKLLIEKSKQEKMA	75.78
DP02475	Q86UE8	Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2)	Homo sapiens (Human)	191	391	295	302	8	RLGHFTTV	80.69
DP02475	Q86UE8	Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2)	Homo sapiens (Human)	191	391	304	329	26	HGASFTEQWTDGYAFQNLIKQQERIN	85.43
DP02475	Q86UE8	Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2)	Homo sapiens (Human)	191	391	369	375	7	GAENETP	77.26
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	231	12	27	16	GQNKYIEYLLQEETEA	79.74
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	231	68	76	9	ADEGYVRCL	84.95
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	231	78	91	14	GANNENYDAAEYSH	82.01
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	231	122	143	22	EDSKYYCELCDPSLYAHLETSK	78.47
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	231	154	160	7	HDDVYKP	74.58
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	231	168	175	8	DADVFLDE	86.66
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	231	189	195	7	KGIHIKS	77.26
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	74	134	78	91	14	GANNENYDAAEYSH	82.01
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	74	134	122	129	8	EDSKYYCE	78.85
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	134	232	137	143	7	AHLETSK	73.91
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	134	232	154	160	7	HDDVYKP	74.58
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	134	232	168	175	8	DADVFLDE	86.66
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	134	232	189	195	7	KGIHIKS	77.26
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	594	379	387	9	GDELIEDIA	80.49
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	594	391	410	20	EDILYSKDSIRLHNIDSIDS	79.9
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	594	417	460	44	QTHAISKEPSPSTIINEESLNCAFLYPGLGLEFTGYLNYIGASQ	79.77
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	594	465	480	16	DIFKEAIGDGKLYVEG	79.35
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	594	486	534	49	TAAPYLKEISCSRAILVYQLFPSNDSESKTTFADVVDSLENKGRIAGIK	85.17
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	594	552	563	12	EIPEILKDILGS	75.59
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	594	579	589	11	ERTLFAFVVVK	79.2
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	447	379	387	9	GDELIEDIA	80.49
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	447	391	410	20	EDILYSKDSIRLHNIDSIDS	79.9
DP02476	P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	366	447	417	442	26	QTHAISKEPSPSTIINEESLNCAFLY	78.35
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	471	572	488	498	11	EQSNSALSESS	78.47
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	938	949	12	RDDLIASILSEV	77.03
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	984	990	7	KAVTLTR	80.6
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	1030	1047	18	RYQEFQNRQVQSLLELRE	77.41
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	1069	1083	15	REVVLDANTTQFKRL	74.31
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	1093	1099	7	ELQKILD	77.26
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	1102	1108	7	RHNSISE	74.68
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	1118	1137	20	EAELTEINRRHITESVNSIR	80.5
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	1154	1165	12	QQQVLQQLAEEE	77.31
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	1170	1177	8	AQLAQECQ	73.58
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	882	1234	1223	1229	7	ADSESQE	75.82
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	934	1192	938	949	12	RDDLIASILSEV	77.03
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	934	1192	984	990	7	KAVTLTR	80.6
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	934	1192	1030	1047	18	RYQEFQNRQVQSLLELRE	77.41
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	934	1192	1069	1083	15	REVVLDANTTQFKRL	74.31
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	934	1192	1093	1099	7	ELQKILD	77.26
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	934	1192	1102	1108	7	RHNSISE	74.68
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	934	1192	1118	1137	20	EAELTEINRRHITESVNSIR	80.5
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	934	1192	1154	1165	12	QQQVLQQLAEEE	77.31
DP02477	Q01970	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3)	Homo sapiens (Human)	934	1192	1170	1177	8	AQLAQECQ	73.58
DP02478	Q6SJQ7	CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f)	Mus musculus (Mouse)	132	330	144	170	27	STTTIFTVTTTVKETSMFPTLTSYYSD	79.55
DP02478	Q6SJQ7	CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f)	Mus musculus (Mouse)	132	330	186	218	33	GDGFLDLSVLLPVISAVLLLLLLVASLFAWRMV	80.66
DP02478	Q6SJQ7	CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f)	Mus musculus (Mouse)	132	330	232	247	16	AQSLEGDLCYADLSLK	85.79
DP02478	Q6SJQ7	CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f)	Mus musculus (Mouse)	132	330	272	280	9	EEVEYVTMA	81.05
DP02478	Q6SJQ7	CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f)	Mus musculus (Mouse)	132	330	285	295	11	EEVSYAALTLA	83.16
DP02478	Q6SJQ7	CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f)	Mus musculus (Mouse)	132	330	299	311	13	QEPTYGNTGCPIT	75.87
DP02479	O60502	Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT)	Homo sapiens (Human)	335	372	351	363	13	STVSIQIKLENEG	77.85
DP02479	O60502	Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT)	Homo sapiens (Human)	341	371	351	363	13	STVSIQIKLENEG	77.85
DP02479	O60502	Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT)	Homo sapiens (Human)	341	370	351	363	13	STVSIQIKLENEG	77.85
DP02479	O60502	Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT)	Homo sapiens (Human)	348	369	351	363	13	STVSIQIKLENEG	77.85
DP02480	Q12102	Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	423	625	452	459	8	NGNAIIDD	91.39
DP02480	Q12102	Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	423	625	468	479	12	NQDILVENVNGV	76.09
DP02480	Q12102	Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	423	625	498	508	11	NDNLLNLLKDN	81.88
DP02480	Q12102	Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	423	625	521	528	8	PVDIIIQP	94.36
DP02480	Q12102	Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	423	625	535	545	11	KMFPFNPAKIK	80.27
DP02480	Q12102	Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	423	625	551	561	11	TVVDFTMFLPD	80.15
DP02480	Q12102	Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	423	625	564	571	8	DNVNQNSR	75.25
DP02480	Q12102	Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	423	625	611	620	10	RASRYSGFSG	75.99
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	142	10	19	10	PSTNFNFFKG	90.43
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	142	23	44	22	NDNTSANSTVNNSNFFLNSNET	84.48
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	142	47	58	12	SKNVFMVHSTSQ	76.37
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	142	64	75	12	PLQNLSHSPSYT	76.11
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	142	83	102	20	KKYMINDAKTIQLVGPLISS	79
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	142	119	126	8	PRFLINQE	87.29
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	551	557	7	NLASSVY	85.38
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	570	593	24	ADQSFLMENFQNNYNEKLNQNSSV	86.51
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	595	601	7	PQINTSP	75.25
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	609	615	7	NHFPFSQ	78.26
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	624	632	9	SQSHTLSTN	75.92
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	647	654	8	KQQQIKTV	79.39
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	657	699	43	GGSPFVFDQSAQNSTVEASKAHMISTTSNGAYDEKLSSEQEEM	79.79
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	703	709	7	EEQRIEE	75.25
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	722	783	62	DKQVITEQIANDLVKEVVNSSVISIVKREFSEANYRKDFIDTMTRELYDAFLHERLYLIYMD	81.78
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	798	808	11	FFEKWQASYSQ	82.06
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	838	844	7	STCLFRT	80.94
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	848	886	39	GNVNSSFMLSSSDKNLIFSPVNDEFNKFATHLTKISKLW	80.66
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	890	901	12	EMQSIYYDNLTK	81.1
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	910	938	29	PANLFIYAKDWTSLSNRWILSKFNLQTAQ	84.43
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	943	961	19	FSNNIISSRIICIDDEYEP	80.07
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	966	986	21	DLQLLIFNTGVTNPDIFDLEM	83.29
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	992	1057	66	GEELIKLITGISLNTNICFSLLIIYWESAENTLSESTIKHLLKLNRISKNYSSVIERIDLMNLTEE	81.07
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	1066	1085	20	KLSEISHSYVYKLTERGKYD	77.51
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	1121	1143	23	EKNKYQQQIGERNTYAHLESHID	82.13
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	1154	1168	15	PILLSTSHSSQFKTP	74.4
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	1212	1228	17	HSNNIPAASFSGNNTTD	77.41
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	1231	1264	34	SQQLIENQKSTSVYLNNVSERILGNQEICQTPIN	80.38
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	1301	1285	1293	9	LELKILIDS	86.85
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	719	551	557	7	NLASSVY	85.38
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	719	570	593	24	ADQSFLMENFQNNYNEKLNQNSSV	86.51
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	719	595	601	7	PQINTSP	75.25
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	719	609	615	7	NHFPFSQ	78.26
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	719	624	632	9	SQSHTLSTN	75.92
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	719	647	654	8	KQQQIKTV	79.39
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	719	657	699	43	GGSPFVFDQSAQNSTVEASKAHMISTTSNGAYDEKLSSEQEEM	79.79
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	551	719	703	709	7	EEQRIEE	75.25
DP02481	P46674	Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	720	805	722	783	62	DKQVITEQIANDLVKEVVNSSVISIVKREFSEANYRKDFIDTMTRELYDAFLHERLYLIYMD	81.78
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	4	32	29	KKLLIASLLFSSATVYGAEGFVVKDIHFE	80.61
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	40	46	7	GAALLSM	86.05
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	55	91	37	NDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKER	81.21
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	93	101	9	TIASITFSG	87.11
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	111	118	8	KQNLEASG	76
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	136	156	21	GLEDFYYSVGKYSASVKAVVT	82.88
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	163	208	46	VDLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNV	82.01
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	221	246	26	GDLETLRSYYLDRGYARFNIDSTQVS	84.64
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	251	299	49	KKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIENLTKIEPGELYNGT	80.35
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	311	320	10	LLGRYGYAYP	80.8
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	343	356	14	AGNRFYVRKIRFEG	86.77
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	372	379	8	MEGAWLGS	79.93
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	391	399	9	RLGFFETVD	88.81
DP02483	Q8ZRP0	Outer membrane protein assembly factor BamA	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	426	412	418	7	VDVVYKV	79.36
DP02484	P0AD27	Inner membrane protein YejM	Escherichia coli (strain K12)	1	244	14	83	70	QMVSWGHWFALFNILLSLVIGSRYLFIADWPTTLAGRIYSYVSIIGHFSFLVFATYLLILFPLTFIVGSQ	83.38
DP02484	P0AD27	Inner membrane protein YejM	Escherichia coli (strain K12)	1	244	86	131	46	MRFLSVILATAGMTLLLIDSEVFTRFHLHLNPIVWQLVINPDENEM	79.05
DP02484	P0AD27	Inner membrane protein YejM	Escherichia coli (strain K12)	1	244	133	158	26	RDWQLMFISVPVILLLELVFATWSWQ	83.56
DP02484	P0AD27	Inner membrane protein YejM	Escherichia coli (strain K12)	1	244	172	200	29	PLAAFLFIAFIASHVVYIWADANFYRPIT	85.93
DP02484	P0AD27	Inner membrane protein YejM	Escherichia coli (strain K12)	1	244	225	235	11	DAQEYQRRLIE	81.18
DP02485	P40709	Inner membrane protein YejM	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	244	14	83	70	QMVSWGHWFALFNILLATLLGSRYLFVADWPTTLAGRIYSYLSIVGHFSFLVFATYLLILFPLTFIVMSQ	82.51
DP02485	P40709	Inner membrane protein YejM	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	244	86	158	73	MRFLSAILATAGMTLLLIDSEVFTRFHLHLNPIVWELVINPDQNEMARDWQLMFISVPVILLIEMLFATWSWQ	84.12
DP02485	P40709	Inner membrane protein YejM	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	244	172	200	29	PLAAFFFVSFIASHLIYIWADANFYRPIT	86.29
DP02485	P40709	Inner membrane protein YejM	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	244	225	231	7	DAQEYQR	88.29
DP02486	A7ZUK2	"DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)"	Escherichia coli O139:H28 (strain E24377A / ETEC)	931	1134	944	978	35	AAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSR	83.4
DP02486	A7ZUK2	"DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)"	Escherichia coli O139:H28 (strain E24377A / ETEC)	931	1134	981	989	9	ELKLIDEFG	80.38
DP02486	A7ZUK2	"DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)"	Escherichia coli O139:H28 (strain E24377A / ETEC)	931	1134	1016	1022	7	TVANWDP	86.62
DP02486	A7ZUK2	"DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)"	Escherichia coli O139:H28 (strain E24377A / ETEC)	931	1134	1025	1048	24	MPVITEVSGFVRFTDMIDGQTITR	81.74
DP02486	A7ZUK2	"DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)"	Escherichia coli O139:H28 (strain E24377A / ETEC)	931	1134	1050	1067	18	TDELTGLSSLVVLDSAER	77.96
DP02486	A7ZUK2	"DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)"	Escherichia coli O139:H28 (strain E24377A / ETEC)	931	1134	1096	1118	23	PAQYFLPGKAIVQLEDGVQISSG	81.91
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	3	22	20	AIVGLCLLSEKVVLSRSLTD	79.26
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	24	31	8	VSKLYKLN	77.26
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	58	137	80	PVSTIILDYKNEDFIKQNPTYSAMDIIGSPSNTAPQTAFQSIMPSLSALFNTPFIQGAFRHRIISSMGPEISYLVMVIGP	82.07
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	152	175	24	SSVHTVSNADVDLNDIIAINSTMA	78.9
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	180	197	18	LVSASTLQAMLVNDVYDR	75.85
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	201	221	21	LDGILLSQALPFFRNYVNVQS	82.94
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	230	244	15	AACLNTPIKELFSMG	78.51
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	251	257	7	LALEFRK	83.61
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	260	270	11	EGQCIGIVLPK	78.84
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	1	288	274	283	10	GDTLSSRYPA	77.02
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	301	506	310	336	27	AYEKLYSETISKHVSDGSYGNRVIISH	86.6
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	301	506	344	372	29	GGVKIIGRFKISDFNTVKKNLSSRSGEID	84.29
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	301	506	375	383	9	KEQWEALSG	76.48
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	301	506	385	406	22	GLVTDSNISMLHDKILDTITSN	76.21
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	301	506	418	428	11	KSENIVVCFKN	84.01
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	301	506	434	463	30	KHSLLQLTKNGISVVSLDELTDAGILVEST	76.98
DP02487	P22473	Protein P7 (55 kDa core protein)	Rice dwarf virus (isolate O) (RDV)	301	506	475	483	9	LANKLSSFK	78.04
DP02488	O28769	HAMP domain-containing protein	Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)	1	233	6	33	28	QIVLIVVVASLVPLSVLGYLTIAGMTSS	84.9
DP02488	O28769	HAMP domain-containing protein	Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)	1	233	39	56	18	QGVTTVSQEYLTKAGEEA	78.13
DP02488	O28769	HAMP domain-containing protein	Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)	1	233	62	92	31	QDLALAVQTYIEAKMKLENKTMLTTFDLIQD	78.98
DP02488	O28769	HAMP domain-containing protein	Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)	1	233	99	117	19	GAQRWGAKEYTWVGAGNKV	82.57
DP02488	O28769	HAMP domain-containing protein	Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)	1	233	121	165	45	DVAVILTHPAFTGQYEKYLGVDVAMLRWNETMPELYNLLLKITEN	82.71
DP02488	O28769	HAMP domain-containing protein	Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)	1	233	172	180	9	VCGYYHWDD	86.44
DP02488	O28769	HAMP domain-containing protein	Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)	1	233	188	228	41	EIPKYLCHYPTTIKVYDPISKGQLWVVVGTSAYIDGYFQYL	82.05
DP02489	Q9YIJ1	Capsid protein	Adeno-associated virus - 5	1	208	17	25	9	GLREFLGLE	79.19
DP02489	Q9YIJ1	Capsid protein	Adeno-associated virus - 5	1	208	43	53	11	GLVLPGYNYLG	80.63
DP02489	Q9YIJ1	Capsid protein	Adeno-associated virus - 5	1	208	74	93	20	HDISYNEQLEAGDNPYLKYN	85.15
DP02489	Q9YIJ1	Capsid protein	Adeno-associated virus - 5	1	208	95	122	28	ADAEFQEKLADDTSFGGNLGKAVFQAKK	78.32
DP02489	Q9YIJ1	Capsid protein	Adeno-associated virus - 5	1	208	124	134	11	VLEPFGLVEEG	75.74
DP02489	Q9YIJ1	Capsid protein	Adeno-associated virus - 5	1	208	175	190	16	SQQLQIPAQPASSLGA	79.64
DP02490	D1A4G7	ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC)	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)	200	413	202	214	13	LPVAISLRSFARI	81.27
DP02490	D1A4G7	ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC)	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)	200	413	221	238	18	KAVYGMVRALIMQLAAFH	81.53
DP02490	D1A4G7	ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC)	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)	200	413	240	251	12	PDDVRITVCASR	75.56
DP02490	D1A4G7	ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC)	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)	200	413	255	263	9	PQWQWMKWL	79.93
DP02490	D1A4G7	ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC)	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)	200	413	276	293	18	GQVRLLTHSLVELESMLG	77.81
DP02490	D1A4G7	ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC)	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)	200	413	312	331	20	FHLVIVDGGQASYDSQIASD	80.95
DP02490	D1A4G7	ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC)	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)	200	413	335	354	20	GVCVIDLTGSVAETNEATML	76.37
DP02490	D1A4G7	ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC)	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)	200	413	373	379	7	KEVLSSV	82.94
DP02490	D1A4G7	ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC)	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)	200	413	383	394	12	DQASIAEAEALA	78.6
DP02491	Q9WBP8	Capsid protein	Adeno-associated virus - 1	1	216	3	24	22	ADGYLPDWLEDNLSEGIREWWD	75.28
DP02491	Q9WBP8	Capsid protein	Adeno-associated virus - 1	1	216	44	57	14	GLVLPGYKYLGPFN	75.47
DP02491	Q9WBP8	Capsid protein	Adeno-associated virus - 1	1	216	75	94	20	HDKAYDQQLKAGDNPYLRYN	80.3
DP02491	Q9WBP8	Capsid protein	Adeno-associated virus - 1	1	216	96	105	10	ADAEFQERLQ	87.96
DP02491	Q9WBP8	Capsid protein	Adeno-associated virus - 1	1	216	115	123	9	GRAVFQAKK	75.44
DP02491	Q9WBP8	Capsid protein	Adeno-associated virus - 1	1	216	169	181	13	KRLNFGQTGDSES	79.11
DP02492	Q808Y3	Capsid protein	Non-human primate Adeno-associated virus	1	216	3	24	22	ADGYLPDWLEDNLSEGIREWWD	75.28
DP02492	Q808Y3	Capsid protein	Non-human primate Adeno-associated virus	1	216	44	57	14	GLVLPGYKYLGPFN	75.47
DP02492	Q808Y3	Capsid protein	Non-human primate Adeno-associated virus	1	216	75	94	20	HDKAYDQQLKAGDNPYLRYN	80.3
DP02492	Q808Y3	Capsid protein	Non-human primate Adeno-associated virus	1	216	96	105	10	ADAEFQERLQ	87.96
DP02492	Q808Y3	Capsid protein	Non-human primate Adeno-associated virus	1	216	115	123	9	GRAVFQAKK	75.44
DP02492	Q808Y3	Capsid protein	Non-human primate Adeno-associated virus	1	216	169	181	13	KRLNFGQTGDSES	79.11
DP02493	P21401	Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)	Rift valley fever virus (strain ZH-548 M12) (RVFV)	154	370	164	170	7	KGHNYID	90.35
DP02493	P21401	Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)	Rift valley fever virus (strain ZH-548 M12) (RVFV)	154	370	180	197	18	KPVTYAGACSSFDVLLEK	86.23
DP02493	P21401	Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)	Rift valley fever virus (strain ZH-548 M12) (RVFV)	154	370	199	208	10	KFPLFQSYAH	92.31
DP02493	P21401	Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)	Rift valley fever virus (strain ZH-548 M12) (RVFV)	154	370	216	224	9	VHDTIIAKA	89.82
DP02493	P21401	Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)	Rift valley fever virus (strain ZH-548 M12) (RVFV)	154	370	229	236	8	CDLLSAHG	75.25
DP02493	P21401	Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)	Rift valley fever virus (strain ZH-548 M12) (RVFV)	154	370	274	284	11	KYELTEDCNFC	84.49
DP02493	P21401	Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)	Rift valley fever virus (strain ZH-548 M12) (RVFV)	154	370	299	308	10	LQDLFCQSSE	87.29
DP02493	P21401	Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)	Rift valley fever virus (strain ZH-548 M12) (RVFV)	154	370	341	357	17	EVVPFAVFKNSKKVYLD	78.38
DP02493	P21401	Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)	Rift valley fever virus (strain ZH-548 M12) (RVFV)	440	469	441	453	13	GIVQIQVSGVWKK	76.85
DP02494	O56139	Capsid protein VP1	Adeno-associated virus 3B	1	216	3	24	22	ADGYLPDWLEDNLSEGIREWWA	75.8
DP02494	O56139	Capsid protein VP1	Adeno-associated virus 3B	1	216	44	54	11	GLVLPGYKYLG	74.07
DP02494	O56139	Capsid protein VP1	Adeno-associated virus 3B	1	216	75	94	20	HDKAYDQQLKAGDNPYLKYN	82.41
DP02494	O56139	Capsid protein VP1	Adeno-associated virus 3B	1	216	96	105	10	ADAEFQERLQ	87.96
DP02494	O56139	Capsid protein VP1	Adeno-associated virus 3B	1	216	115	123	9	GRAVFQAKK	75.44
DP02494	O56139	Capsid protein VP1	Adeno-associated virus 3B	1	216	130	139	10	GLVEEAAKTA	80.6
DP02494	O56139	Capsid protein VP1	Adeno-associated virus 3B	1	216	169	181	13	KRLNFGQTGDSES	79.11
DP02494	O56139	Capsid protein VP1	Adeno-associated virus 3B	1	216	198	204	7	LGSNTMA	79.93
DP02495	Q928V6	Putative integrase Bacteriophage A118	Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)	133	350	137	145	9	VMGKIKRIE	75.25
DP02495	Q928V6	Putative integrase Bacteriophage A118	Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)	133	350	156	173	18	RTFGYDVIDTKLYINEEE	79.88
DP02495	Q928V6	Putative integrase Bacteriophage A118	Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)	133	350	176	195	20	QLRLIYDIFEEEQSITFLQK	79.25
DP02495	Q928V6	Putative integrase Bacteriophage A118	Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)	133	350	203	227	25	KVRTYNRYNNWLTNDLYCGYVSYKD	87.46
DP02495	Q928V6	Putative integrase Bacteriophage A118	Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)	133	350	235	254	20	HEPIISEEQFYRVQEIFSRM	87.93
DP02495	Q928V6	Putative integrase Bacteriophage A118	Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)	133	350	264	276	13	SASLLNNLVVCSK	79.73
DP02495	Q928V6	Putative integrase Bacteriophage A118	Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)	133	350	295	306	12	YHYRYYSCKTYK	82.3
DP02495	Q928V6	Putative integrase Bacteriophage A118	Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)	133	350	324	343	20	LEELIIDRVNNYSFASRNID	86.49
DP02495	Q928V6	Putative integrase Bacteriophage A118	Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)	400	452	409	447	39	IQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQV	84.3
DP02496	P56926	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)	633	852	682	696	15	QDAEFTRLLGLGASE	76.77
DP02496	P56926	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)	633	852	707	715	9	ALLAFVGGA	97.32
DP02496	P56926	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)	633	852	722	738	17	AQVASWTVNELVAGLRA	78.34
DP02496	P56926	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)	633	852	757	770	14	SGQLSARIAREALA	75.66
DP02496	P56926	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)	633	852	778	785	8	APLTIIER	80.31
DP02496	P56926	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)	633	852	789	808	20	NAGLSAEALQQVVAQVIAAN	80.75
DP02496	P56926	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)	633	852	811	817	7	KAEAYRG	85.28
DP02496	P56926	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)	633	852	820	835	16	TALLGFFTGQVMRATA	77.01
DP02497	P05844	Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3	Infectious pancreatic necrosis virus (strain Jasper) (IPNV)	735	960	741	750	10	LQGLLQATMA	77.16
DP02497	P05844	Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3	Infectious pancreatic necrosis virus (strain Jasper) (IPNV)	735	960	757	771	15	DAEVFKLLKLMSWTR	76.28
DP02497	P05844	Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3	Infectious pancreatic necrosis virus (strain Jasper) (IPNV)	735	960	776	784	9	TDHMYEWSK	79.38
DP02497	P05844	Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3	Infectious pancreatic necrosis virus (strain Jasper) (IPNV)	735	960	788	795	8	DAIKFGRL	80.27
DP02497	P05844	Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3	Infectious pancreatic necrosis virus (strain Jasper) (IPNV)	735	960	829	845	17	AGADFASPEWIAENNYR	85.64
DP02497	P05844	Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3	Infectious pancreatic necrosis virus (strain Jasper) (IPNV)	735	960	850	859	10	GQFKYYMITG	83.95
DP02497	P05844	Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3	Infectious pancreatic necrosis virus (strain Jasper) (IPNV)	735	960	865	872	8	GEEYEDYV	79.26
DP02497	P05844	Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3	Infectious pancreatic necrosis virus (strain Jasper) (IPNV)	735	960	887	895	9	RLANSVYGL	76.11
DP02497	P05844	Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3	Infectious pancreatic necrosis virus (strain Jasper) (IPNV)	735	960	902	916	15	PDDFYQAVVEVFAEN	80.62
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	24	33	10	TAVEQAVPIQ	78.13
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	44	61	18	AAGQINQIDPWIFQNFVQ	90.45
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	63	71	9	PLGEFSISP	77.18
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	74	85	12	TPGEILFDLALG	81.38
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	87	120	34	GLNPYLAHLSAMYTGWVGNMEVQLVLAGNAFTAG	78.32
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	122	131	10	VVVALVPPYF	87.29
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	133	145	13	KGSLTTAQITCFP	76.97
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	153	163	11	TLEPIQLPLLD	75.92
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	165	172	8	RRVLWHAT	75.13
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	182	188	7	VCMLYTP	90.97
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	195	208	14	GDESFVVSGRLLSK	81.58
DP02498	A7YK37	Capsid protein	Murine norovirus GV/CR10/2005/USA	1	227	211	220	10	ADFNFVYLTP	84.31
DP02499	A0KJC7	ImpA-related domain protein	Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)	1	230	9	15	7	ARLLTSL	74.53
DP02499	A0KJC7	ImpA-related domain protein	Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)	1	230	32	65	34	DYVETELVKLGSLAHSQVDLNAVAEACLGLLESR	76.7
DP02499	A0KJC7	ImpA-related domain protein	Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)	1	230	72	78	7	LAQLLRC	77.4
DP02499	A0KJC7	ImpA-related domain protein	Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)	1	230	88	109	22	LGAAISLLEAWIQAYWLLAWPG	84.16
DP02499	A0KJC7	ImpA-related domain protein	Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)	1	230	117	126	10	LMVQIVKRFE	78.9
DP02499	A0KJC7	ImpA-related domain protein	Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)	1	230	141	158	18	LAQLLAQAEQLERVWLAQ	76.18
DP02499	A0KJC7	ImpA-related domain protein	Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)	1	230	179	189	11	QQLAQAEANAA	78.35
DP02499	A0KJC7	ImpA-related domain protein	Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)	1	230	204	211	8	ASVASTAS	79.93
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	2	16	15	HKFRYSLHQHYSKRN	83.12
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	22	36	15	KDSPISQNSNEENDS	77.95
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	51	69	19	LDDIYNNYTLAQGTNNNSV	78.49
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	76	84	9	NNQAINKFI	85.8
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	108	124	17	SLGNTTNETGESIAKSA	78.67
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	143	155	13	AVTNSSLNVLLDT	79.26
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	158	166	9	VSSEFNHLV	81.05
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	174	193	20	SVERFDDSNNTVDNTEEEEN	75.45
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	207	215	9	KQNEENWEK	83.28
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	1	232	218	226	9	AAVKTIKTM	80.01
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	554	567	14	TNSNSNTNNVATAV	80.27
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	587	595	9	SPATINNKS	80.27
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	603	611	9	SVAAYVLNK	81.38
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	614	622	9	TNQNSSTSE	74.8
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	635	652	18	RKLSYSQQDYIPGTNILR	78.35
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	660	668	9	SVGSYVKTT	81.72
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	703	712	10	LEAAWEPYLT	76.66
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	717	726	10	RILRIGPVIA	79.26
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	740	753	14	ASLHISPLDINKEQ	87.29
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	758	777	20	NTSLLTQIVNEVNNNTSELK	79.67
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	782	794	13	ADESLAIIEPQYN	76.33
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	816	835	20	SGSRISKKAIFKKLGFSHLE	75.35
DP02500	Q5A3P6	Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2)	Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)	522	944	852	939	88	QTCTLVVTTHGRALLFIRNDIESNYLLIAEIKLKYPFIHFQELVISQTKFSKLVPSVGVFVISSIDNSLIFEVEKFEVNQWTEALAKS	82.44
DP02501	P00800	Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase)	Bacillus thermoproteolyticus	1	232	6	52	47	KLASFGLAAGLAAQVFLPYNALASTEHVTWNQQFQTPQFISGDLLKV	80.32
DP02501	P00800	Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase)	Bacillus thermoproteolyticus	1	232	58	77	20	EELVYQYVEKNENKFKFHEN	77.42
DP02501	P00800	Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase)	Bacillus thermoproteolyticus	1	232	89	116	28	NDNLGFTFMRFQQTYKGIPVFGAVVTSH	82.3
DP02501	P00800	Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase)	Bacillus thermoproteolyticus	1	232	126	134	9	SGTLIPNLD	75.25
DP02501	P00800	Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase)	Bacillus thermoproteolyticus	1	232	157	171	15	DLVANVTKEVPEYEQ	75.25
DP02501	P00800	Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase)	Bacillus thermoproteolyticus	1	232	173	198	26	KDTEFVVYVNGDEASLAYVVNLNFLT	82.17
DP02501	P00800	Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase)	Bacillus thermoproteolyticus	1	232	200	224	25	EPGNWLYIIDAVDGKILNKFNQLDA	85.5
DP02502	A0R1T8	LAO/AO transport system ATPase (EC 2.7.-.-)	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)	1	238	8	17	10	VPELITVARG	76.25
DP02502	A0R1T8	LAO/AO transport system ATPase (EC 2.7.-.-)	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)	1	238	24	33	10	GRLLTLVESD	78.86
DP02502	A0R1T8	LAO/AO transport system ATPase (EC 2.7.-.-)	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)	1	238	36	43	8	GEVLAALG	76.42
DP02502	A0R1T8	LAO/AO transport system ATPase (EC 2.7.-.-)	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)	1	238	78	84	7	VAVLAVD	80.27
DP02502	A0R1T8	LAO/AO transport system ATPase (EC 2.7.-.-)	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)	1	238	91	115	25	GGALLGDRIRMAAHINDPDVLIRSM	82.86
DP02502	A0R1T8	LAO/AO transport system ATPase (EC 2.7.-.-)	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)	1	238	128	148	21	VPAAIRLLAALSYDLIVLETV	79.52
DP02502	A0R1T8	LAO/AO transport system ATPase (EC 2.7.-.-)	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)	1	238	151	171	21	GQSEIEIAAIADPTVVILNPG	90.94
DP02502	A0R1T8	LAO/AO transport system ATPase (EC 2.7.-.-)	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)	1	238	181	195	15	AGVLEVADLVVVNKA	82.88
DP02502	A0R1T8	LAO/AO transport system ATPase (EC 2.7.-.-)	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)	1	238	226	233	8	LHELIEAI	80.73
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	38	47	10	GQWTRFPKWN	80.6
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	52	61	10	SEMSFQLKTR	75.25
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	65	86	22	GLVLYFDDEGFCDFLELILTRG	85.57
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	88	106	19	RLQLSFSIFCAEPATLLTD	88.96
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	110	120	11	NDGAWHNVRIR	76.07
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	122	143	22	QFRNTTLFIDQVEAKWVEVKSK	76.85
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	146	157	12	DMTVFSGLFVGG	84.36
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	165	174	10	AALKLTLASV	77.06
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	180	197	18	FKGWIRDVRVNSSLALPV	78.3
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	225	236	12	GGVCLNGGVCSV	75.59
DP02503	Q28146	Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha)	Bos taurus (Bovine)	31	280	264	270	7	GLAHLMM	77.26
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	256	1	18	18	MAYTTAQLVTAYTNANLG	81.01
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	256	24	71	48	ATTLTLDAYATQTQTGGLSDAAALTNTLKLVNSTTAVAIQTYQFFTGV	79.54
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	256	76	152	77	AGLDFLVDSTTNTNDLNDAYYSKFAQENRFINFSINLATGAGAGATAFAAAYTGVSYAQTVATAYDKIIGNAVATAA	82.98
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	256	154	179	26	VDVAAAVAFLSRQANIDYLTAFVRAN	80.72
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	256	184	223	40	AAADIDLAVKAALIGTILNAATVSGIGGYATATAAMINDL	80.15
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	256	226	232	7	GALSTDN	73.91
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	256	234	243	10	AGVNLFTAYP	85.18
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	248	1	18	18	MAYTTAQLVTAYTNANLG	81.01
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	248	24	71	48	ATTLTLDAYATQTQTGGLSDAAALTNTLKLVNSTTAVAIQTYQFFTGV	79.54
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	248	76	152	77	AGLDFLVDSTTNTNDLNDAYYSKFAQENRFINFSINLATGAGAGATAFAAAYTGVSYAQTVATAYDKIIGNAVATAA	82.98
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	248	154	179	26	VDVAAAVAFLSRQANIDYLTAFVRAN	80.72
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	248	184	223	40	AAADIDLAVKAALIGTILNAATVSGIGGYATATAAMINDL	80.15
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	248	226	232	7	GALSTDN	73.91
DP02504	P35828	S-layer protein (Paracrystalline surface layer protein)	Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)	1	248	234	243	10	AGVNLFTAYP	85.18
DP02505	O53168	Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	262	25	34	10	LSVALLVCTP	80.23
DP02505	O53168	Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	262	42	56	15	QTDTIAALIADVAKA	77.95
DP02505	O53168	Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	262	69	77	9	AEQESVNKA	79.93
DP02505	O53168	Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	262	88	99	12	AAAAEDDLEVSQ	74.25
DP02505	O53168	Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	262	105	126	22	ANAAIAAAQHRFDTFAAATYMN	82.59
DP02505	O53168	Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	262	128	163	36	PSVSYLSASSPDEIIATVTAAKTLSASSQAVMANLQ	77.65
DP02505	O53168	Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	262	196	204	9	AAVAALTET	77.78
DP02505	O53168	Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	262	233	240	8	RLVAWSSE	79.22
DP02506	Q8A6W3	SusC homolog	Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)	1	235	12	31	20	CSVCFLFAFMSALWGQNITV	85.99
DP02506	Q8A6W3	SusC homolog	Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)	1	235	33	85	53	GNVTSKTDGQPIIGASVVETTATTNGTITDFDGNFTLSVPVNSTLKITYIGYK	78.66
DP02506	Q8A6W3	SusC homolog	Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)	1	235	90	102	13	KAAAIVNVLLEED	77.31
DP02506	Q8A6W3	SusC homolog	Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)	1	235	108	117	10	EVVVTGYTTQ	75.59
DP02506	Q8A6W3	SusC homolog	Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)	1	235	130	136	7	KVDEIQK	76.25
DP02506	Q8A6W3	SusC homolog	Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)	1	235	151	157	7	PGMNITA	80.03
DP02506	Q8A6W3	SusC homolog	Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)	1	235	165	186	22	ATVRIRGIGTLNNNDPLYIIDG	83.19
DP02506	Q8A6W3	SusC homolog	Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)	1	235	199	218	20	NDIESIQVLKDAASASIYGS	82.42
DP02506	Q8A6W3	SusC homolog	Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)	1	235	221	230	10	ANGVIIITTK	81.44
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	21	42	22	TSVVSNCTDQCASYVANVFTTQ	81.73
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	49	66	18	SDFSFNNWFLLTNSSTLV	81.05
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	76	84	9	LLVNCLWPV	76.44
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	90	99	10	AASTFCFEGA	82.37
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	106	126	21	GAVLNNTVDVIRFNLNFTTNV	83.55
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	131	151	21	GATVFSLNTTGGVTLEISCYN	80.9
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	155	171	17	SDSSFSSYGEIPFGVTN	81.7
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	175	192	18	YCYVLYNGTALKYLGTLP	85.21
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	194	229	36	SVKEIAISKWGHFYINGYNFFSTFPIDCISFNLTTG	83.22
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	231	268	38	SDVFWTIAYTSYTEALVQVENTAITNVTYCNSYVNNIK	85.15
DP02507	Q84852	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein)	Porcine respiratory coronavirus	17	299	272	294	23	LTANLNNGFYPVSSSEVGSVNKS	75.21
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	317	335	19	EEERILRYVQQSVSLNLMR	80.51
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	354	372	19	GMYASNRPFINRLMDYLHR	76.98
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	374	387	14	AAVNPEYFTNAILN	78.69
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	407	414	8	NDGFLWDD	80.23
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	416	422	7	DDSVFSP	85.62
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	425	441	17	QTLLELQQREQAEAALR	76.25
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	467	477	11	FPSLIGSLTST	77.62
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	486	497	12	GEEEYLNNSLLQ	79.68
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	522	528	7	RWKTYAQ	74.58
DP02508	P12537	Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	304	585	550	556	7	GLVWEDD	89.97
DP02509	P0DOC6	CRISPR-associated endoribonuclease Cas13a	Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37)	103	174	103	116	14	EEVVLYIEAYGKSE	91.28
DP02509	P0DOC6	CRISPR-associated endoribonuclease Cas13a	Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37)	103	174	119	137	19	KALGITKKKIIDEAIRQGI	80.29
DP02509	P0DOC6	CRISPR-associated endoribonuclease Cas13a	Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37)	103	174	151	169	19	NEEEIEIDIRDEYTNKTLN	82.31
DP02509	P0DOC6	CRISPR-associated endoribonuclease Cas13a	Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37)	914	1005	922	942	21	KKEIFNNYYEDIKNNILTEFK	79.58
DP02509	P0DOC6	CRISPR-associated endoribonuclease Cas13a	Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37)	914	1005	954	962	9	KLEKIVIFD	93.79
DP02509	P0DOC6	CRISPR-associated endoribonuclease Cas13a	Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37)	914	1005	965	977	13	TKFEIDKKSNILQ	80.37
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	371	380	10	EQVKFDATSM	82.21
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	399	411	13	EVQVWRIENLELV	79.7
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	413	471	59	VDSKWLGHFYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYN	86.44
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	487	493	7	HLMSIFK	87.24
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	495	501	7	RMVVYQG	79.12
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	506	512	7	TNNLETG	73.91
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	514	522	9	STRLFQVQG	80.27
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	524	559	36	GANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCG	79.02
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	573	581	9	VADTISRTE	80.6
DP02510	P09327	Villin-1	Homo sapiens (Human)	360	613	583	598	16	QVVVEGQEPANFWMAL	76.28
DP02511	P02640	Villin-1	Gallus gallus (Chicken)	723	763	733	758	26	GDNASIGQLVSGLTSKNEVFTATTTL	76.56
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	42	48	7	GASALTP	79.26
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	53	69	17	QVANEAASDVLFGNESV	81.72
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	104	117	14	RAGLIEHVNFKTLK	81.49
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	119	161	43	GSSLLGQISAITKQDLCITFTDGISGYVNLTHISEEFTSILED	82.81
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	181	188	8	EDAEYESS	76.55
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	203	226	24	NLRRYFHIGQWLRCSVIKNTSLEP	79.06
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	235	241	7	RIELTIE	86.53
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	243	260	18	SSVNIYADEDLVKSTSIQ	86.18
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	262	268	7	AVKSIED	77.26
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	279	286	8	GFTGFIAK	86.58
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	288	296	9	DFGNFEKLL	82.27
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	298	307	10	GAVFLGNITK	78.7
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	309	319	11	SDRSIVVNTDF	84.4
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	322	377	56	KKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFGLVSGVVNVSHLRTFSEED	82.47
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	380	418	39	HKFVIGSSIRCRIIACLENKSGDKVLILSNLPHILKLED	79.08
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	425	441	17	GLDAFPIGYTFESCSIK	76.94
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	443	454	12	RDSEYLYLALDD	81.72
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	464	539	76	RVGEIENSENLSSRVLGYSPVDDIYQLSTDPKYLKLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKASV	77.82
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	547	559	13	TRLVYPERKFKIG	75.56
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	563	572	10	KGRVISVNSR	79.97
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	582	588	7	SLVNIED	82.42
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	593	604	12	LVSTYENAKNIK	86.12
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	610	647	38	TLATIQVFKPNGCIISFFGGLSGFLPNSEISEVFVKRP	84.67
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	654	663	10	GQTVIVKLLD	85.38
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	668	693	26	RRRIIATCKVSNEQAAQQKDTIENIV	80.52
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	695	716	22	GRTIITVHVIEKTKDSVIVEIP	83.25
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	720	757	38	LRGVIYVGHLSDSRIEQNRAQLKKLRIGTELTGLVIDK	81.32
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	760	774	15	RTRVFNMSLKSSLIK	78.46
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	797	826	30	MHAYIKSISDKGLFVAFNGKFIGLVLPSYA	81.74
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	830	848	19	RDIDISKAFYINQSVTVYL	78.28
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	854	864	11	KNQKFLLSLKA	83.98
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	874	880	7	VESNIED	91.97
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	882	903	22	VDSSIKSWDDLSIGSIVKAKIK	83.78
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	908	936	29	NQLNVILAANLHGRVDIAEVFDTYEEITD	79.46
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	947	973	27	DDVIKVKIIGNHDVKSHKFLPITHKIS	79.9
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	975	982	8	ASVLELSM	81.4
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	996	1024	29	SLEEINIGQELTGFVNNSSGNHLWLTISP	84.56
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1029	1051	23	RISLLDLADNDSNFSENIESVFP	82.33
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1056	1064	9	LQVKVASID	78.37
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1068	1074	7	GFVNAIG	88.06
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1076	1086	11	SHVDINMSTIK	81.45
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1094	1107	14	RVLKIAEKYVLLDL	87.67
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1111	1147	37	VTGISFITDALNDFSLTLKEAFEDKINNVIPTTVLSV	81.41
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1175	1187	13	KQGEIVDGIVKNV	82.76
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1189	1204	16	DKGIFVYLSRKVEAFV	84.47
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1210	1250	41	SDSYLKEWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEIN	78.27
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1254	1263	10	KVLKTYSDIK	77.89
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1265	1275	11	GDVFEGTIKSV	80.45
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1277	1300	24	DFGVFVKLDNTVNVTGLAHITEIA	81.72
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1306	1313	8	DLSALFGV	85.24
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1316	1325	10	RVKAIVLKTN	78.46
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1329	1363	35	KQISLSLKASHFSKEAELASTTTTTTTVDQLEKED	78.33
DP02513	Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	1408	1369	1389	21	ADAGFNDSDSESDIGDQNTEV	79.36
DP02514	P36594	DNA-directed RNA polymerase II subunit rpb1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1498	1752	1501	1509	9	DAAAFSPLV	75.07
DP02514	P36594	DNA-directed RNA polymerase II subunit rpb1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1498	1752	1518	1532	15	GFGDYGLLGAASPYK	75.25
DP02514	P36594	DNA-directed RNA polymerase II subunit rpb1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1498	1752	1550	1559	10	GYGLTSPSYS	80.27
DP02514	P36594	DNA-directed RNA polymerase II subunit rpb1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1498	1752	1605	1614	10	SYSATSPSYS	77.93
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	246	256	11	TEQVTIQVLPP	94.28
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	262	268	7	EGDNITL	84.81
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	279	287	9	EEFLFYLPG	87.96
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	294	306	13	SSNTYTLTDVRRN	76.87
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	312	337	26	KCSLIDKKSMIASTAITVHYLDLSLN	80.92
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	352	375	24	VSCTISASRNATVVWMKDNIRLRS	83.49
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	380	402	23	SSLHYQDAGNYVCETALQEVEGL	80.4
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	405	415	11	RESLTLIVEGK	88.23
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	428	435	8	GLSKTIIC	75.67
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	444	477	34	AIQWTITGSGSVINQTEESPYINGRYYSKIIISP	82.88
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	479	507	29	ENVTLTCTAENQLERTVNSLNVSAISIPE	77.32
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	510	516	7	EADEISD	79.89
DP02515	Q13740	CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)	Homo sapiens (Human)	246	583	525	552	28	QAKLIVGIVVGLLLAALVAGVVYWLYMK	87.78
DP02516	P56287	Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	443	678	454	479	26	DEGEFMEASGLIESTNELHLSDSESS	76.96
DP02516	P56287	Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	443	678	487	496	10	EDMEFIPFSA	77.46
DP02516	P56287	Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	443	678	500	543	44	SANTINSEDFDEGDFNKEAQQSLERAFEENHQIDIAALELNTLR	77.8
DP02516	P56287	Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	443	678	546	566	21	MNANYHEVRSAIVLALLRRIM	77.43
DP02516	P56287	Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	443	678	587	596	10	LAKLTFSHEE	83.98
DP02516	P56287	Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	443	678	598	641	44	VDNVLTLQKYCVRLSMTRHFLQLLGYFYQLEIAEENAIQEWYSD	87.21
DP02516	P56287	Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	443	678	659	672	14	QFVDWLNTAESESE	76.33
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	592	602	11	GLGASTAEISA	78.2
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	605	615	11	MQSMFAKNFHV	80.51
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	621	645	25	TSVLLSWEIPENYNSAMPFKILYDD	82.23
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	657	665	9	TQKLIVNLK	88.63
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	668	681	14	KSYSFVLTNRGNSA	90.99
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	700	719	20	KPAFIGKTNLDGMITVQLPD	78.6
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	722	735	14	ANENIKGYYIIIVP	92.74
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	755	763	9	LDELLKEIS	78.93
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	777	793	17	LKPYIAAHFDVLPTEFT	78.12
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	795	805	11	GDDKHYGGFTN	75.89
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	810	823	14	SGQEYVFFVLAVMD	86.14
DP02517	Q64487	Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)	Mus musculus (Mouse)	585	854	828	836	9	KMYATSPYS	76.37
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	224	7	39	33	TLLATMIASALYSHQGLAADLASQCMLGVPSYD	82.65
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	224	50	81	32	LPVTINADNAKGNYPDDAVFTGNVDIMQGNSR	84.22
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	224	108	120	13	GNVHYDDNQVILK	89.71
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	224	124	143	20	GWANLNTKDTNVWEGDYQMV	78.49
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	224	158	173	16	GENRYTILENGSFTSC	79.06
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	224	177	190	14	SDTWSVVGSEVIHD	76.4
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	224	193	204	12	EQVAEIWNARFK	79.99
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	224	206	219	14	GPVPIFYSPYLQLP	77.02
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	24	224	25	39	15	ADLASQCMLGVPSYD	77.66
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	24	224	50	81	32	LPVTINADNAKGNYPDDAVFTGNVDIMQGNSR	84.22
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	24	224	108	120	13	GNVHYDDNQVILK	89.71
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	24	224	124	143	20	GWANLNTKDTNVWEGDYQMV	78.49
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	24	224	158	173	16	GENRYTILENGSFTSC	79.06
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	24	224	177	190	14	SDTWSVVGSEVIHD	76.4
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	24	224	193	204	12	EQVAEIWNARFK	79.99
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	24	224	206	219	14	GPVPIFYSPYLQLP	77.02
DP02518	Q8ZRW0	LPS-assembly protein LptD	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	170	196	177	190	14	SDTWSVVGSEVIHD	76.4
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	137	147	11	AKKAIADLERN	75.92
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	155	165	11	TDSAIDIVDSV	81.94
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	177	184	8	QLDEITSN	76.25
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	189	209	21	PLANIDATDVEQIYPIESIIP	84.46
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	211	225	15	KELQFIRVSSILKEA	82.88
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	230	252	23	KLELFPYQNNSKYVAKKLDSLTQ	83.82
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	258	274	17	KLQLLYYLSLLLGVYEN	85.34
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	295	306	12	VDGILSRFTVIK	77.93
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	314	322	9	KDRSYFIDP	84.24
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	324	348	25	NEDKILCYILAIIMHLDNFIVEITP	86.77
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	359	385	27	KVVSLFRVLGAIVKGATVAQAEAFGIP	81.3
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	115	415	388	397	10	TAASYKIATM	85.62
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	137	147	11	AKKAIADLERN	75.92
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	155	165	11	TDSAIDIVDSV	81.94
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	177	184	8	QLDEITSN	76.25
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	189	209	21	PLANIDATDVEQIYPIESIIP	84.46
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	211	225	15	KELQFIRVSSILKEA	82.88
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	230	252	23	KLELFPYQNNSKYVAKKLDSLTQ	83.82
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	258	274	17	KLQLLYYLSLLLGVYEN	85.34
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	295	306	12	VDGILSRFTVIK	77.93
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	314	322	9	KDRSYFIDP	84.24
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	324	348	25	NEDKILCYILAIIMHLDNFIVEITP	86.77
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	359	385	27	KVVSLFRVLGAIVKGATVAQAEAFGIP	81.3
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	116	415	388	397	10	TAASYKIATM	85.62
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	182	403	189	209	21	PLANIDATDVEQIYPIESIIP	84.46
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	182	403	211	225	15	KELQFIRVSSILKEA	82.88
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	182	403	230	252	23	KLELFPYQNNSKYVAKKLDSLTQ	83.82
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	182	403	258	274	17	KLQLLYYLSLLLGVYEN	85.34
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	182	403	295	306	12	VDGILSRFTVIK	77.93
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	182	403	314	322	9	KDRSYFIDP	84.24
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	182	403	324	348	25	NEDKILCYILAIIMHLDNFIVEITP	86.77
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	182	403	359	385	27	KVVSLFRVLGAIVKGATVAQAEAFGIP	81.3
DP02519	Q01080	DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	182	403	388	397	10	TAASYKIATM	85.62
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	27	39	13	LPAHFIGGNRLEN	75.2
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	47	75	29	DFVAEHGGHTVITNVLIANNGIAAVKEIR	78.99
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	78	95	18	RKWAYETFGDERAIKFTV	83.87
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	104	116	13	ANADYIRMADHYV	80.09
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	121	137	17	GTNNHNYANVELIVDVA	85.4
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	142	149	8	VHAVWAGW	75.08
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	167	174	8	KKIVFIGP	95.15
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	186	204	19	ISSTIVAQHANVPTIPWSG	87.29
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	208	236	29	SEVHIDENGIVTVPEEVYLKGCVNSWEEG	79.51
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	239	250	12	KAREIGFPVMIK	76.09
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	267	291	25	DQFEELYKAAAAEIPGSPIFIMKLA	84.71
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	297	314	18	LEVQLLADQYGNNISLFG	84.75
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	322	335	14	RHQKIIEEAPVTIA	84.09
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	346	379	34	AAVRLGKLVGYVSAGTVEYLYSHADDKFYFLELN	82.78
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	393	407	15	SGVNLPAAQLQIAMG	76.81
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	415	422	8	DIRLLYGV	85.2
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	426	436	11	AATEIDFEFKN	86.23
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	453	459	7	TACRITS	76.54
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	472	492	21	MLQELNFRSSSNVWGYFSVGT	83.18
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	495	512	18	GIHSFSDSQFGHIFAYGE	87.96
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	521	566	46	MIVALKELSIRGDFRTTVEYLIKLLETQAFEENTITTGWLDELISK	82.33
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	575	587	13	TNLAIICGAVIRA	88.4
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	611	647	37	DILKTVSSVDFIYEGLRYKFTVTRSSVDTYRLFINGS	78.17
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	660	667	8	GLLVLLGG	86.37
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1	699	669	694	26	SHNVYWKDEATGTRISIDGKTCLLEQ	76.11
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1114	1185	1125	1136	12	RPYFIDWDFALR	80.16
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1114	1185	1140	1147	8	ANQTESSM	74.25
DP02520	G0S3L5	Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2)	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	1114	1185	1167	1178	12	RIHSISDMTYLA	81.83
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	185	270	185	191	7	GDFTLTA	78.4
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	185	270	206	213	8	IYKEFKMS	74.58
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	185	270	220	247	28	RLFEESVKFNAYESERWNTNLVKIREYT	81.45
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	185	270	251	265	15	YSEHISKSAKNIFLA	80.27
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	1759	1826	68	SEQNIAFECFKLITHFADSFIDSLSRSAFLQLIIDEFSYKDVKVSKLYDIIKNGYNRTDFIPLLFRTG	83.14
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	1843	1853	11	ERVTWNDWQTS	79.14
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	1857	1876	20	DMGSINLTITGYNRSITIIG	81.44
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	1879	1890	12	NKLTYAELCLTR	77.17
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	1892	1900	9	TPENITISG	77.59
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	1908	1929	22	HGLKFENMSKIQTYPGNYYITY	85.15
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	1935	1949	15	HQFVYQIHSHESITR	78.86
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	1958	1967	10	RTRIYNEITP	88.7
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	1978	2001	24	GDQRILIRSLDYLNNDIFSLSRIK	77.95
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	2003	2023	21	GLDEFATIKKAHFSKMVSFEG	78.48
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	2031	2037	7	LDLTELM	76.25
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	2039	2063	25	SQDLLNLNYDNIRNSNLISFSKLIC	79.97
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	2066	2102	37	GSDNINDGLEFLSDDPMNFTEGEAIHSTPIFNIYYSK	81.04
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	2110	2139	30	YRNAIKLLIERETKIFEEAFTFSENGFISP	77.76
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	2142	2175	34	LGCLEAVVSLIKLLKTNEWSTVIDKCIHICLIKN	82.94
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	2197	2212	16	RDINWVMFREFINSLP	81.04
DP02521	A5HC98	RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase)	Bunyavirus La Crosse	1751	2263	2229	2251	23	KCIALINSKFETQRDFSEFTKLM	83.25
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	808	822	15	RDSLLIIQWNIRAFM	87.89
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	825	837	13	KNWPWMKLYFKIK	84.31
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	845	857	13	TEKEIALMKEEFG	75.74
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	876	900	25	KMVSLLQEKNDLQLQVQAEQDNLAD	77.03
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	905	922	18	CDQLIKNKIQLEAKVKEM	79.93
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	956	962	7	DLELTLA	79.93
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	984	993	10	GLDEIIAKLT	95.62
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1003	1021	19	HQQALDDLQAEEDKVNTLT	78.42
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1057	1071	15	GDLKLTQESIMDLEN	85.73
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1083	1102	20	KDFELNALNARIEDEQALGS	76.52
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1111	1124	14	LQARIEELEEELEA	80.27
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1142	1148	7	ELEEISE	78.36
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1157	1164	8	TSVQIEMN	77.26
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1178	1194	17	LEEATLQHEATAAALRK	75.49
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1200	1211	12	VAELSEQIDNLQ	75.75
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1222	1247	26	SEFKLELDDVTSNMEQIIKAKANLEK	84.59
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1279	1289	11	KLQTENGELSR	79.93
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1294	1315	22	KEALISQLTRGKLTYTQQLEDL	80.09
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1368	1389	22	VAQWRTKYETDAIQRTEELEEA	74.6
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1420	1427	8	RLQNEIED	89.59
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1445	1470	26	KQRNFDKILAEWKQKYEESQSELESS	77.73
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1478	1499	22	STELFKLKNAYEESLEHLETFK	81.27
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1504	1518	15	NLQEEISDLTEQLGS	78.1
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1540	1572	33	LQSALEEAEASLEQEEGKILRAQLEFNQIKAEM	79.82
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1596	1606	11	SLQTSLDAETR	77.26
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1620	1639	20	GDLNEMEIQLSHANRLAAEA	75.97
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1641	1659	19	KQVKSLQSLLKDTQIQLDD	79.62
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1667	1697	31	LKENIAIVERRNNLLQAELEELRAVVEQTER	80.28
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1702	1711	10	AEQELIETSE	77.69
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1713	1726	14	VQLLHSQNTSLINQ	86.57
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1736	1744	9	QLQTEVEEA	78.15
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1755	1770	16	AKKAITDAAMMAEELK	74.25
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1799	1807	9	EAEQIALKG	76.37
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1811	1833	23	QLQKLEARVRELENELEAEQKRN	74.65
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1848	1856	9	KELTYQTEE	80.27
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1870	1879	10	KLQLKVKAYK	75.18
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1887	1897	11	EQANTNLSKFR	80.91
DP02522	Q9BE39	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta)	Bos taurus (Bovine)	807	1935	1910	1920	11	ADIAESQVNKL	77.26
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	20	41	22	NAAASASAAAASAAASAACASP	76.68
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	48	66	19	GAAASSASAAAASAAAAPN	77.72
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	134	146	13	GMLVWSPNQNLSE	82.92
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	148	159	12	KLDEYIAIAKEK	91.86
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	164	182	19	MEQALGMLFWHKHNIEKSL	76.59
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	199	238	40	DKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKK	78.81
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	328	340	13	SANATAATTVLRQ	76.18
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	351	363	13	QIQNIKQTNSALK	82.17
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	369	402	34	GIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYG	78.7
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	485	404	443	40	DFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAE	85.73
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	307	20	41	22	NAAASASAAAASAAASAACASP	76.68
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	307	48	66	19	GAAASSASAAAASAAAAPN	77.72
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	307	134	146	13	GMLVWSPNQNLSE	82.92
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	307	148	159	12	KLDEYIAIAKEK	91.86
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	307	164	182	19	MEQALGMLFWHKHNIEKSL	76.59
DP02523	Q9UKL0	REST corepressor 1 (Protein CoREST)	Homo sapiens (Human)	1	307	199	238	40	DKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKK	78.81
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1842	1568	1578	11	QLAVYEEFARN	89.72
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1842	1599	1627	29	MKQAWATDDVAQIYDKCITELEQHLHAIP	81.39
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1842	1636	1651	16	AQALRSLLEVVVLSRN	78.01
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1842	1655	1675	21	AIAALGLLQKAVEGLLDATSG	77.99
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1842	1678	1702	25	ADLLLRYRECHLLVLKALQDGRAYG	78.57
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1842	1711	1717	7	TRCLIEC	82.94
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1842	1719	1798	80	DEYKYNVEAVELLIRNHLVNMQQYDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHS	80.47
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1842	1813	1822	10	VRSNYEAMID	82.74
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1832	1568	1578	11	QLAVYEEFARN	89.72
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1832	1599	1627	29	MKQAWATDDVAQIYDKCITELEQHLHAIP	81.39
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1832	1636	1651	16	AQALRSLLEVVVLSRN	78.01
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1832	1655	1675	21	AIAALGLLQKAVEGLLDATSG	77.99
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1832	1678	1702	25	ADLLLRYRECHLLVLKALQDGRAYG	78.57
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1832	1711	1717	7	TRCLIEC	82.94
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1832	1719	1798	80	DEYKYNVEAVELLIRNHLVNMQQYDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHS	80.47
DP02524	A5YKK6	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1)	Homo sapiens (Human)	1565	1832	1813	1822	10	VRSNYEAMID	82.74
DP02525	P9WGI1	RNA polymerase sigma factor SigA (Sigma-A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	224	141	150	10	ADLNLDDLED	83.61
DP02525	P9WGI1	RNA polymerase sigma factor SigA (Sigma-A)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	224	200	206	7	GDFVWDE	81.13
DP02526	C4R4Y0	DNA-directed RNA polymerase subunit (EC 2.7.7.6)	Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris)	1454	1743	1481	1500	20	NNAQYDDEFNHDDVADVMFS	84.15
DP02526	C4R4Y0	DNA-directed RNA polymerase subunit (EC 2.7.7.6)	Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris)	1454	1743	1514	1526	13	GLTEYAGIQSPYQ	79.98
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1446	1733	1449	1464	16	SLVKYMPEQKITEIED	85.66
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1446	1733	1487	1496	10	KDELMFSPLV	79.77
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1446	1733	1505	1527	23	AGGFTAYGGADYGEATSPFGAYG	85.12
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1446	1733	1552	1564	13	TSPAYSPTSPSYS	73.91
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1446	1733	1657	1669	13	TSPAYSPTSPSYS	73.91
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1455	1733	1455	1464	10	PEQKITEIED	79.26
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1455	1733	1487	1496	10	KDELMFSPLV	79.77
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1455	1733	1505	1527	23	AGGFTAYGGADYGEATSPFGAYG	85.12
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1455	1733	1552	1564	13	TSPAYSPTSPSYS	73.91
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1455	1733	1657	1669	13	TSPAYSPTSPSYS	73.91
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1456	1733	1458	1464	7	KITEIED	80.27
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1456	1733	1487	1496	10	KDELMFSPLV	79.77
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1456	1733	1505	1527	23	AGGFTAYGGADYGEATSPFGAYG	85.12
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1456	1733	1552	1564	13	TSPAYSPTSPSYS	73.91
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1456	1733	1657	1669	13	TSPAYSPTSPSYS	73.91
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1549	1716	1552	1564	13	TSPAYSPTSPSYS	73.91
DP02527	P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1549	1716	1657	1669	13	TSPAYSPTSPSYS	73.91
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	926	936	11	AGFVEICVAVC	77.84
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	944	956	13	SSQLYYFMTLTLA	81.22
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	969	989	21	TQVTITGTNLNAGSNVVVMFG	94.36
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	999	1016	18	SPSYIICNTTSSEEVLDM	76.96
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	1029	1071	43	QDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQ	82.66
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	1078	1095	18	GKEHINICEVLNATEMTC	77.52
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	1115	1148	34	EEFGFILDNVQSLLILNKTNFTYYPNPVFEAFSP	86.2
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	1157	1169	13	GTPIILKGKNLIP	80.45
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	1174	1185	12	GNVKLNYTVLVG	85.84
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	1194	1207	14	SDVQLLCESPNLIG	77.93
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	920	1229	1216	1224	9	GGMEYSPGM	84.36
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	1004	1229	1004	1016	13	ICNTTSSEEVLDM	75.59
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	1004	1229	1029	1071	43	QDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQ	82.66
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	1004	1229	1078	1095	18	GKEHINICEVLNATEMTC	77.52
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	1004	1229	1115	1148	34	EEFGFILDNVQSLLILNKTNFTYYPNPVFEAFSP	86.2
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	1004	1229	1157	1169	13	GTPIILKGKNLIP	80.45
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	1004	1229	1174	1185	12	GNVKLNYTVLVG	85.84
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	1004	1229	1194	1207	14	SDVQLLCESPNLIG	77.93
DP02528	Q80UG2	Plexin-A4	Mus musculus (Mouse)	1004	1229	1216	1224	9	GGMEYSPGM	84.36
DP02529	Q92558	Wiskott-Aldrich syndrome protein family member 1	Homo sapiens	185	494	216	243	28	DDANLLHKHIEVANGPASHFETRPQTYV	77.47
DP02529	Q92558	Wiskott-Aldrich syndrome protein family member 1	Homo sapiens	185	494	246	267	22	MDGSYSLSALPFSQMSELLTRA	76.07
DP02529	Q92558	Wiskott-Aldrich syndrome protein family member 1	Homo sapiens	185	494	300	306	7	ATGLIEN	81.13
DP02529	Q92558	Wiskott-Aldrich syndrome protein family member 1	Homo sapiens	185	494	334	344	11	ALSTSSLRASM	79.93
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	2	15	14	GIELLCLFFLFLGR	86.26
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	32	51	20	EDCLLIGPQCAWCAQENFTH	87.47
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	69	87	19	GCQLNFIENPVSQVEILKN	83.45
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	97	114	18	NSSDIVQIAPQSLILKLR	87.85
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	117	126	10	GAQTLQVHVR	74.52
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	132	145	14	PVDLYYLMDLSASM	79.93
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	147	155	9	DDLNTIKEL	84.69
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	166	180	15	LTSNFRLGFGSFVEK	87.78
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	184	194	11	PFVKTTPEEIA	77.2
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	199	238	40	SIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDT	84.7
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	242	251	10	GFDAIMQAAV	75.99
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	255	289	35	KIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPN	80.32
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	291	346	56	GLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIP	81.38
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	356	382	27	DSGNILQLIISAYEELRSEVELEVLGD	83.55
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	384	404	21	EGLNLSFTAICNNGTLFQHQK	83.72
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	413	424	12	DTASFSVTVNIP	85.79
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	430	437	8	SRHIIIKP	80.48
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	441	449	9	GDALELLVS	84.99
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	525	544	20	HLSPYGNIYGPYCQCDNFSC	79.97
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	569	578	10	WTGEYCNCTT	80.94
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	651	663	13	LAGATISEEEDFS	86.26
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	676	687	12	NECLITFLITTD	82.16
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	692	698	7	TIIHSIN	84.42
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	707	738	32	NIPMIMLGVSLAILLIGVVLLCIWKLLVSFHD	81.71
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	741	749	9	EVAKFEAER	79.93
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	1	788	765	775	11	STSTFKNVTYK	84.31
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	492	788	525	544	20	HLSPYGNIYGPYCQCDNFSC	79.97
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	492	788	569	578	10	WTGEYCNCTT	80.94
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	492	788	651	663	13	LAGATISEEEDFS	86.26
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	492	788	676	687	12	NECLITFLITTD	82.16
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	492	788	692	698	7	TIIHSIN	84.42
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	492	788	707	738	32	NIPMIMLGVSLAILLIGVVLLCIWKLLVSFHD	81.71
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	492	788	741	749	9	EVAKFEAER	79.93
DP02530	P18564	Integrin beta-6	Homo sapiens (Human)	492	788	765	775	11	STSTFKNVTYK	84.31
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	268	274	7	DTLMISR	80.27
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	290	306	17	PEVKFNWYVDGVEVHNA	78.06
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	311	339	29	REEQYNSTYRVVSVLTVLHQDWLNGKEYK	78.53
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	364	371	8	EPQVYTLP	83.7
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	380	386	7	NQVSLTC	80.12
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	388	403	16	VKGFYPSDIAVEWESN	80
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	406	413	8	PENNYKTT	79.93
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	419	431	13	SDGSFFLYSKLTV	79.96
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	438	446	9	QGNVFSCSV	77.15
DP02531	S6B291	IgG H chain	Homo sapiens	240	465	451	460	10	LHNHYTQKSL	86.62
DP02533	P56696	Potassium voltage-gated channel subfamily KQT member 4	Homo sapiens	550	593	559	571	13	KDVIEQYSAGHLD	81.89
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	30	62	34	42	9	GVVNIAGIP	82.39
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	74	348	80	94	15	DLNGYITGQVGLIGT	82.99
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	74	348	98	107	10	PFSLFQELEA	82.84
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	74	348	122	128	7	NDIVIPE	84.62
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	74	348	147	161	15	ADARIQEGSIQVLSD	83.05
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	74	348	172	185	14	SQELSNVLNELGIE	79.17
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	74	348	193	205	13	LRAVFADGVLFEP	86.11
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	74	348	208	238	31	LELDIDEYRSDIQAAAGRAFNLSVNADYPTA	82.07
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	74	348	257	263	7	LQAAIED	78.5
DP02536	P15825	50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	74	348	281	287	7	LASQIDD	80.6
DP02539	Q16611	Bcl-2 homologous antagonist/killer	Homo sapiens	64	98	76	83	8	RQLAIIGD	92.81
DP02541	P0ACN7	HTH-type transcriptional repressor CytR	Escherichia coli (strain K12)	1	67	49	55	7	REVGYLP	80.27
DP02545	P07948	Tyrosine-protein kinase Lyn (EC 2.7.10.2) (Lck/Yes-related novel protein tyrosine kinase) (V-yes-1 Yamaguchi sarcoma viral related oncogene homolog) (p53Lyn) (p56Lyn)	Homo sapiens (Human)	1	62	27	35	9	TERTIYVRD	80.49
DP02547	Q9Y6G9	Cytoplasmic dynein 1 light intermediate chain 1	Homo sapiens	388	523	415	424	10	SNVASVSPIP	79.93
DP02547	Q9Y6G9	Cytoplasmic dynein 1 light intermediate chain 1	Homo sapiens	388	523	443	454	12	VLANFFNSLLSK	81.63
DP02548	P0AES9	Acid stress chaperone HdeA	Escherichia coli (strain K12)	22	110	34	64	31	VNSWTCEDFLAVDESFQPTAVGFAEALNNKD	79.25
DP02548	P0AES9	Acid stress chaperone HdeA	Escherichia coli (strain K12)	22	110	68	89	22	DAVLDVQGIATVTPAIVQACTQ	77.39
DP02548	P0AES9	Acid stress chaperone HdeA	Escherichia coli (strain K12)	22	110	91	97	7	KQANFKD	87.96
DP02551	Q8NBP7	Proprotein convertase subtilisin/kexin type 9	Homo sapiens	31	60	36	47	12	GDYEELVLALRS	75.78
DP02551	Q8NBP7	Proprotein convertase subtilisin/kexin type 9	Homo sapiens	31	53	36	47	12	GDYEELVLALRS	75.78
DP02552	P43629	Killer cell immunoglobulin-like receptor 3DL1	Homo sapiens	361	444	394	412	19	EEVTYAQLDHCVFTQRKIT	87.78
DP02552	P43629	Killer cell immunoglobulin-like receptor 3DL1	Homo sapiens	361	444	423	433	11	TDTILYTELPN	78.44
DP02554	Q6P5W5	Zinc transporter ZIP4	Homo sapiens	424	498	449	457	9	GVSLQLAPS	74.58
DP02554	Q6P5W5	Zinc transporter ZIP4	Homo sapiens	424	498	472	483	12	DLVAEESPELLN	76.59
DP02555	Q15109	Advanced glycosylation end product-specific receptor	Homo sapiens	364	404	386	394	9	AELNQSEEP	74.58
DP02561	P60880	Synaptosomal-associated protein 25	Homo sapiens	83	141	125	136	12	EQMAISGGFIRR	81.3
DP02561	P60880	Synaptosomal-associated protein 25	Homo sapiens	111	141	125	136	12	EQMAISGGFIRR	81.3
DP02568	P04616	Protein Rev (ART/TRS) (Anti-repression transactivator) (Regulator of expression of viral proteins)	Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1)	66	116	99	111	13	SPQILVESPTVLE	74.14
DP02576	P56777	Photosystem II CP47 reaction center protein	Arabidopsis thaliana	480	508	488	499	12	AQVEFGAFQKLG	86.04
DP02577	P23321	Oxygen-evolving enhancer protein 1-1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (Manganese-stabilizing protein 1) (MSP-1) (OEC 33 kDa subunit)	Arabidopsis thaliana (Mouse-ear cress)	240	281	255	261	7	NAVALPA	79.93
DP02577	P23321	Oxygen-evolving enhancer protein 1-1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (Manganese-stabilizing protein 1) (MSP-1) (OEC 33 kDa subunit)	Arabidopsis thaliana (Mouse-ear cress)	240	281	269	276	8	ELVKENVK	76
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	25	42	18	GGCLFDEPYSTCGYSQSE	78.78
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	44	55	12	DDFNWEQVNTLT	80.16
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	66	75	10	GSFMLVNASG	75.25
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	82	92	11	AHLLLPQLKEN	73.91
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	97	108	12	IDFHYFVSSKSN	81.72
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	112	121	10	GLLNVYVKVN	81.17
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	126	134	9	GNPIWNISG	92.08
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	143	174	32	AELAISTFWPNFYQVIFEVITSGHQGYLAIDE	87.35
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	187	213	27	HFLRIQNVEVNAGQFATFQCSAIGRTV	84.05
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	215	225	11	GDRLWLQGIDV	79.72
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	238	252	15	SRRFIASFNVVNTTK	83.77
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	254	263	10	DAGKYRCMIR	75.25
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	266	278	13	GGVGISNYAELVV	81.53
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	292	314	23	SVGATYLWIQLNANSINGDGPIV	83.23
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	316	328	13	REVEYCTASGSWN	83.48
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	333	344	12	VDSTSYKIGHLD	79.26
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	347	357	11	TEYEISVLLTR	77.74
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	386	423	38	LEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQV	80.67
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	431	437	7	EEVSWDT	79.93
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	442	463	22	PQHTITNLSPYTNVSVKLILMN	78.87
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	470	478	9	SQELIVQTD	83.95
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	491	536	46	QGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQS	80.5
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	544	567	24	NETHFLFFGLYPGTTYSFTIRAST	86.71
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	575	585	11	ATNQFTTKISA	77.62
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	590	596	7	AYELETP	80.6
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	617	627	11	PVSVYQIVVEE	77.87
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	635	691	57	KTTEILKCYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTIGDNKTYNGYWNTP	80.94
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	696	707	12	KSYRIYFQAASR	79.35
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	21	742	710	722	13	GETKIDCVQVATK	79.73
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	589	742	590	596	7	AYELETP	80.6
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	589	742	617	627	11	PVSVYQIVVEE	77.87
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	589	742	635	691	57	KTTEILKCYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTIGDNKTYNGYWNTP	80.94
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	589	742	696	707	12	KSYRIYFQAASR	79.35
DP02580	P28827	Receptor-type tyrosine-protein phosphatase mu	Homo sapiens	589	742	710	722	13	GETKIDCVQVATK	79.73
DP02583	F1RAX4	Receptor for retinol uptake stra6 (Stimulated by retinoic acid gene 6 protein homolog)	Danio rerio (Zebrafish) (Brachydanio rerio)	575	597	577	592	16	SAQRIRDAEEGIQLVQ	75.88
DP02584	F1QGH7	Catenin beta-1 (Beta-catenin)	Danio rerio (Zebrafish) (Brachydanio rerio)	1	126	7	13	7	LMELEMA	76.92
DP02584	F1QGH7	Catenin beta-1 (Beta-catenin)	Danio rerio (Zebrafish) (Brachydanio rerio)	1	126	21	48	28	AVSHWQQQSYLDSGIHSGATTTAPSLSG	85.2
DP02584	F1QGH7	Catenin beta-1 (Beta-catenin)	Danio rerio (Zebrafish) (Brachydanio rerio)	1	126	59	88	30	NQVLYEWEQGFNQSFNQEQVADIDGQYAMT	77.94
DP02584	F1QGH7	Catenin beta-1 (Beta-catenin)	Danio rerio (Zebrafish) (Brachydanio rerio)	680	780	687	693	7	MTWNETG	80.27
DP02584	F1QGH7	Catenin beta-1 (Beta-catenin)	Danio rerio (Zebrafish) (Brachydanio rerio)	680	780	758	764	7	TQDLIDG	87.29
DP02584	F1QGH7	Catenin beta-1 (Beta-catenin)	Danio rerio (Zebrafish) (Brachydanio rerio)	680	780	768	775	8	GDSNQLAW	79.89
DP02588	P47273	Uncharacterized protein MG027	Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)	78	99	82	94	13	NQLEIQTKYNKIS	84.77
DP02589	Q05080	Cytokinesis protein 2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	276	300	281	295	15	GDMNSSANWAQMSSI	77.28
DP02590	P47523	Uncharacterized protein MG281	Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)	37	74	38	51	14	NLVNQSGYALVASG	81.39
DP02590	P47523	Uncharacterized protein MG281	Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)	37	74	56	65	10	LGFKLFSTQS	80.37
DP02590	P47523	Uncharacterized protein MG281	Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)	469	556	469	498	30	AEQNGVTFDENIKRITASGKYSVQFQKLEN	80.03
DP02590	P47523	Uncharacterized protein MG281	Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)	469	556	513	551	39	GLVTVIGEEKFETVDITGVSSDTNEVKSLAKELKTNALG	77.15
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	1	80	45	51	7	PEEEILG	74.39
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	1	80	69	75	7	HPVKIGD	80.36
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	233	241	9	AAEATEWQK	77.26
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	279	295	17	QAELLEKRLQEIEELER	78.67
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	297	309	13	AERKIIEENITSA	80.09
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	333	339	7	AAEAETA	75.87
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	355	361	7	EKENIEK	79.26
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	366	380	15	VDQELANIDPTWIES	80.27
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	383	389	7	TNGHIEN	78.6
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	410	417	8	NPEEYNLD	77.42
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	421	437	17	AESDYTYSSSYEQFNGE	83.97
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	449	462	14	QFPEFSTSLFSGSL	85.31
DP02591	P78362	SRSF protein kinase 2	Homo sapiens	231	511	492	499	8	TVSASSTG	75.92
DP02592	Q9H8Y8	Golgi reassembly-stacking protein 2	Homo sapiens	209	452	229	239	11	DGFTEVQLSSV	77.87
DP02592	Q9H8Y8	Golgi reassembly-stacking protein 2	Homo sapiens	209	452	253	263	11	EQSLTGLSISS	81.88
DP02592	Q9H8Y8	Golgi reassembly-stacking protein 2	Homo sapiens	209	452	269	276	8	SSVLSTGV	79.6
DP02592	Q9H8Y8	Golgi reassembly-stacking protein 2	Homo sapiens	209	452	287	293	7	NQSLTSV	86.96
DP02592	Q9H8Y8	Golgi reassembly-stacking protein 2	Homo sapiens	209	452	317	328	12	NLNLNLPAPHIM	75.25
DP02592	Q9H8Y8	Golgi reassembly-stacking protein 2	Homo sapiens	209	452	360	367	8	LPSEFLPS	78.26
DP02592	Q9H8Y8	Golgi reassembly-stacking protein 2	Homo sapiens	209	452	380	388	9	SGELLSSLP	79.56
DP02592	Q9H8Y8	Golgi reassembly-stacking protein 2	Homo sapiens	209	452	404	412	9	ADAASSLTV	78.97
DP02593	Q9ESJ0	Exportin-4	Mus musculus	507	530	514	525	12	HQQQFLASPGSS	80.43
DP02596	Q04866	Chain length determinant protein	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	206	249	208	233	26	DEAKITQPQIQQTQDVTQDTMFLLGS	78.76
DP02596	Q04866	Chain length determinant protein	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	206	249	236	244	9	LKSMIQNEA	80.16
DP02597	O49195	Vegetative storage protein 1	Arabidopsis thaliana	16	48	25	43	19	VPGLIELLESNTIFGNEAE	78.96
DP02599	Q86VN1	Vacuolar protein-sorting-associated protein 36	Homo sapiens	149	169	152	161	10	RAVGIVGIER	85.89
DP02602	P70280	Vesicle-associated membrane protein 7	Mus musculus	164	188	167	179	13	SSVTFKTTSRNLA	77.39
DP02605	P02533	Keratin; type I cytoskeletal 14 (Cytokeratin-14) (CK-14) (Keratin-14) (K14)	Homo sapiens (Human)	295	331	301	326	26	DAEEWFFTKTEELNREVATNSELVQS	80.61
DP02607	Q9UNA0	A disintegrin and metalloproteinase with thrombospondin motifs 5	Homo sapiens	557	628	558	578	21	KKKYYSTSSHGNWGSWGSWGQ	76.09
DP02607	Q9UNA0	A disintegrin and metalloproteinase with thrombospondin motifs 5	Homo sapiens	557	628	585	593	9	GGVQFAYRH	93.42
DP02607	Q9UNA0	A disintegrin and metalloproteinase with thrombospondin motifs 5	Homo sapiens	557	628	608	616	9	GKRAIYRSC	79.49
DP02608	Q8IUQ4	E3 ubiquitin-protein ligase SIAH1	Homo sapiens	90	124	91	101	11	ANSVLFPCKYA	83.4
DP02608	Q8IUQ4	E3 ubiquitin-protein ligase SIAH1	Homo sapiens	90	124	103	109	7	SGCEITL	80.84
DP02609	Q96PY5	Formin-like protein 2 (Formin homology 2 domain-containing protein 2)	Homo sapiens (Human)	150	204	156	162	7	STVESSV	74.58
DP02614	Q3MIT2	Putative tRNA pseudouridine synthase Pus10	Homo sapiens	76	106	76	85	10	LEDSIDNLSQ	77.53
DP02615	O75817	Ribonuclease P protein subunit p20	Homo sapiens	1	28	10	23	14	AVEAELDPVEYTLR	79.12
DP02619	Q0WYX8	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	Gallus gallus (Chicken)	736	920	745	758	14	NTCRFEDEKICGFV	78.48
DP02619	Q0WYX8	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	Gallus gallus (Chicken)	736	920	761	776	16	KMDNFDWTRQNALTQN	75.21
DP02619	Q0WYX8	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	Gallus gallus (Chicken)	736	920	793	802	10	PEGYYMFIEA	86.92
DP02619	Q0WYX8	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	Gallus gallus (Chicken)	736	920	811	848	38	KARLISPLYNITAKYYCVSFYYHMYGKHIGSLNLLVRV	83.79
DP02619	Q0WYX8	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	Gallus gallus (Chicken)	736	920	855	863	9	DTQVWSLSG	81.12
DP02619	Q0WYX8	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	Gallus gallus (Chicken)	736	920	869	875	7	WQQAHVP	81.65
DP02619	Q0WYX8	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	Gallus gallus (Chicken)	736	920	880	889	10	GPFQIIFEGV	80.13
DP02619	Q0WYX8	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	Gallus gallus (Chicken)	736	920	891	906	16	GTSYEGDIAIDDVTLK	80.31
DP02620	Q14194	Dihydropyrimidinase-related protein 1	Homo sapiens	497	572	535	548	14	HQSNFSLSGAQIDD	81.82
DP02623	P42003	Protein mothers against dpp	Drosophila melanogaster (Fruit fly)	215	256	239	245	7	GGQLLDA	76.49
DP02626	Q9QUG2	DNA polymerase kappa	Mus musculus	546	616	588	597	10	GQQALQILEP	79.3
DP02626	Q9QUG2	DNA polymerase kappa	Mus musculus	546	616	603	611	9	KLSESFETS	75.62
DP02632	P31321	cAMP-dependent protein kinase type I-beta regulatory subunit	Homo sapiens (Human)	59	81	62	74	13	NRQILARQKSNSQ	77.26
DP02633	P22605	Retinoic acid receptor beta	Mus musculus	454	481	454	462	9	SSGNIAEHS	85.28
DP02635	Q9ERE3	Serine/threonine-protein kinase Sgk3 (EC 2.7.11.1) (Cytokine-independent survival kinase) (Serum/glucocorticoid-regulated kinase 3) (Serum/glucocorticoid-regulated kinase-like)	Mus musculus (Mouse)	126	160	143	149	7	TSRNINL	85.28
DP02641	Q8GY88	Shikimate kinase 2; chloroplastic	Arabidopsis thaliana	55	81	65	76	12	SALLETGSLLHS	77.26
DP02642	P53780	Cystathionine beta-lyase; chloroplastic	Arabidopsis thaliana	57	84	68	79	12	TVNNTTDSLNTM	78.93
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	103	113	11	KKVTIFFGTQT	78.17
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	134	145	12	TRFKIVDLDDYA	87.29
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	147	153	7	DDDEYEE	74.1
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	158	169	12	EDVAFFFLATYG	90.75
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	176	187	12	NAARFYKWFTEG	80.8
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	191	216	26	GEWLKNLKYGVFGLGNRQYEHFNKVA	82.97
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	219	237	19	VDDILVEQGAQRLVQVGLG	75.92
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	239	263	25	DDQCIEDDFTAWREALWPELDTILR	77.63
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	268	287	20	TAVATPYTAAVLEYRVSIHD	78.34
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	73	303	289	298	10	EDAKFNDINM	81.54
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	263	303	268	287	20	TAVATPYTAAVLEYRVSIHD	78.34
DP02644	Q9SUM3	NADPH--cytochrome P450 reductase 2	Arabidopsis thaliana	263	303	289	298	10	EDAKFNDINM	81.54
DP02652	Q96FQ6	Protein S100-A16	Homo sapiens	51	71	59	66	8	ADKLIQNL	86.91
DP02653	P61765	Syntaxin-binding protein 1 (N-Sec1) (Protein unc-18 homolog 1) (Unc18-1) (Protein unc-18 homolog A) (Unc-18A) (p67) (rbSec1)	Rattus norvegicus (Rat)	295	358	336	353	18	QYQKELSKYSTHLHLAED	84.06
DP02656	P08294	Extracellular superoxide dismutase Cu-Zn	Homo sapiens	19	54	31	49	19	SAEWIRDMYAKVTEIWQEV	79.79
DP02657	O88483	Pyruvate dehydrogenase acetyl-transferring-phosphatase 1; mitochondrial	Rattus norvegicus	445	475	459	465	7	HGLLTER	75.59
DP02660	Q9SKB2	Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1	Arabidopsis thaliana	225	270	225	235	11	VMSSIKLQTSP	79.93
DP02660	Q9SKB2	Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1	Arabidopsis thaliana	225	270	237	246	10	QTRHILAETP	77.26
DP02669	Q57530	6b protein	Rhizobium radiobacter	164	184	169	179	11	NEGIENEEEEE	79.93
DP02673	P11926	Ornithine decarboxylase (ODC) (EC 4.1.1.17)	Homo sapiens (Human)	422	461	439	446	8	VSCAWESG	77.26
DP02679	Q8R464	Cell adhesion molecule 4	Mus musculus	25	120	26	44	19	EVQTENVTVAEGGVAEITC	77.8
DP02679	Q8R464	Cell adhesion molecule 4	Mus musculus	25	120	49	69	21	YDGSIVVIQNPARQTLFFNGT	83.52
DP02679	Q8R464	Cell adhesion molecule 4	Mus musculus	25	120	73	82	10	KDERFQLEEF	82.58
DP02679	Q8R464	Cell adhesion molecule 4	Mus musculus	25	120	99	110	12	EGGYFCQLYTED	78.79
DP02683	Q9DBG5	Perilipin-3	Mus musculus	289	320	301	311	11	LHQMWLSWNQK	77.26
DP02690	F4JL28	Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS)	Arabidopsis thaliana (Mouse-ear cress)	197	234	203	210	8	SQNGFTSS	79.43
DP02690	F4JL28	Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS)	Arabidopsis thaliana (Mouse-ear cress)	197	234	218	229	12	RLSLFSHLLYRC	81.74
DP02690	F4JL28	Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS)	Arabidopsis thaliana (Mouse-ear cress)	200	234	203	210	8	SQNGFTSS	79.43
DP02690	F4JL28	Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS)	Arabidopsis thaliana (Mouse-ear cress)	200	234	218	229	12	RLSLFSHLLYRC	81.74
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	1	15	15	MAFLDNPTIILAHIR	80.16
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	50	58	9	SGSEIQGSN	80.27
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	60	81	22	ETQGYVYAQSVDITSSWDFGIR	78.61
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	97	111	15	RQNQIKCKNIQWKER	75.88
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	117	125	9	AQELKSLFE	79.26
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	137	148	12	GKQSILSVRLEQ	78.15
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	153	164	12	LNNPFNEYSKFD	81.66
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	168	182	15	HVGTTATKKIDVYLP	77.79
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	193	217	25	MTVVTMASARVQDLIGLICWQYTSE	82.35
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	224	237	14	NDNVSAYCLHIAED	88.25
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	256	270	15	KFGFSTLALVEKYSS	82.61
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	276	284	9	KESLFVRIN	95.21
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	288	308	21	GFSLIQVDNTKVTMKEILLKA	87.9
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	337	357	21	LDSTLESQSAWEFCLVRENSS	78.34
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	359	412	54	ADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEID	77.23
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	421	441	21	TKFWIKQKPISIDSDLLCACD	78.36
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	449	489	41	SHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESR	82.01
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	494	506	13	RADYFAQKQRKLN	74.25
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	1	522	509	517	9	TSFSFQKEK	86.29
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	248	522	256	270	15	KFGFSTLALVEKYSS	82.61
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	248	522	276	284	9	KESLFVRIN	95.21
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	248	522	288	308	21	GFSLIQVDNTKVTMKEILLKA	87.9
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	248	522	337	357	21	LDSTLESQSAWEFCLVRENSS	78.34
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	248	522	359	412	54	ADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEID	77.23
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	248	522	421	441	21	TKFWIKQKPISIDSDLLCACD	78.36
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	248	522	449	489	41	SHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESR	82.01
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	248	522	494	506	13	RADYFAQKQRKLN	74.25
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	248	522	509	517	9	TSFSFQKEK	86.29
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	360	522	361	412	52	GVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEID	76.92
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	360	522	421	441	21	TKFWIKQKPISIDSDLLCACD	78.36
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	360	522	449	489	41	SHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESR	82.01
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	360	522	494	506	13	RADYFAQKQRKLN	74.25
DP02693	Q9BPZ7	Target of rapamycin complex 2 subunit MAPKAP1	Homo sapiens	360	522	509	517	9	TSFSFQKEK	86.29
DP02700	P0A8S9	Flagellar transcriptional regulator FlhD	Escherichia coli (strain K12)	83	116	86	107	22	DLQQIHTGIMLSTRLLNDVNQP	78.2
DP02703	O00411	DNA-directed RNA polymerase; mitochondrial	Homo sapiens	105	217	121	127	7	RWAKILE	75.92
DP02703	O00411	DNA-directed RNA polymerase; mitochondrial	Homo sapiens	1086	1108	1094	1103	10	GIQSITYTHN	87.76
DP02704	P41214	Eukaryotic translation initiation factor 2D	Homo sapiens	348	373	351	359	9	RITSFVIPE	77.07
DP02709	P04035	3-hydroxy-3-methylglutaryl-coenzyme A reductase	Homo sapiens	861	888	870	878	9	NRSKINLQD	80.6
DP02711	Q9V6K1	Tripeptidyl-peptidase 2	Drosophila melanogaster	1027	1098	1033	1055	23	LTLDFYENYNQCIVGGRKYVSSP	85.59
DP02711	Q9V6K1	Tripeptidyl-peptidase 2	Drosophila melanogaster	1027	1098	1060	1074	15	TRVLYIAPITQERLT	83.43
DP02711	Q9V6K1	Tripeptidyl-peptidase 2	Drosophila melanogaster	1027	1098	1080	1093	14	AQCAWLSGNLVFPQ	77.5
DP02712	Q9H3P2	Negative elongation factor A	Homo sapiens	189	528	255	263	9	KLLDISELD	79.93
DP02712	Q9H3P2	Negative elongation factor A	Homo sapiens	189	528	290	298	9	ETVVENATP	74.58
DP02712	Q9H3P2	Negative elongation factor A	Homo sapiens	189	528	333	339	7	PASSYIP	85.86
DP02712	Q9H3P2	Negative elongation factor A	Homo sapiens	189	528	430	448	19	NLSLTREQMFAAQEMFKTA	78.08
DP02712	Q9H3P2	Negative elongation factor A	Homo sapiens	189	528	455	464	10	EKALILGFMA	82.88
DP02712	Q9H3P2	Negative elongation factor A	Homo sapiens	189	528	475	484	10	GDVIQIKLSE	76.35
DP02712	Q9H3P2	Negative elongation factor A	Homo sapiens	189	528	495	522	28	QGSTTMLVDTVFEMNYATGQWTRFKKYK	79.46
DP02713	P18615	Negative elongation factor E (NELF-E) (RNA-binding protein RD)	Homo sapiens (Human)	139	363	166	174	9	FDWGYEERS	86.62
DP02713	P18615	Negative elongation factor E (NELF-E) (RNA-binding protein RD)	Homo sapiens (Human)	139	363	261	269	9	GNTLYVYGE	83.35
DP02713	P18615	Negative elongation factor E (NELF-E) (RNA-binding protein RD)	Homo sapiens (Human)	139	363	276	289	14	LRGAFSPFGNIIDL	80.67
DP02713	P18615	Negative elongation factor E (NELF-E) (RNA-binding protein RD)	Homo sapiens (Human)	139	363	295	304	10	RNCAFVTYEK	93.58
DP02713	P18615	Negative elongation factor E (NELF-E) (RNA-binding protein RD)	Homo sapiens (Human)	139	363	310	330	21	QAVAELNGTQVESVQLKVNIA	85.91
DP02713	P18615	Negative elongation factor E (NELF-E) (RNA-binding protein RD)	Homo sapiens (Human)	139	363	336	352	17	LDAATGKSVWGSLAVQN	74.96
DP02722	P33334	Pre-mRNA-splicing factor 8	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	2087	2147	2098	2104	7	MAELEAA	79.93
DP02722	P33334	Pre-mRNA-splicing factor 8	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	2087	2147	2114	2142	29	AAGASTVMKTKTINAQGEEIVVVASADYE	80.27
DP02726	Q42521	Glutamate decarboxylase 1	Arabidopsis thaliana	1	57	5	27	23	HAVSESDVSVHSTFASRYVRTSL	81.85
DP02726	Q42521	Glutamate decarboxylase 1	Arabidopsis thaliana	1	57	39	52	14	KEAAYQIINDELML	80.1
DP02726	Q42521	Glutamate decarboxylase 1	Arabidopsis thaliana	449	502	451	473	23	VIHKISLGQEKSESNSDNLMVTV	79.09
DP02726	Q42521	Glutamate decarboxylase 1	Arabidopsis thaliana	449	502	481	495	15	QRDIITGWKKFVADR	75.23
DP02726	Q42521	Glutamate decarboxylase 1	Arabidopsis thaliana	449	470	451	465	15	VIHKISLGQEKSESN	81.27
DP02726	Q42521	Glutamate decarboxylase 1	Arabidopsis thaliana	471	502	481	495	15	QRDIITGWKKFVADR	75.23
DP02730	Q6P1M3	LLGL scribble cell polarity complex component 2	Homo sapiens	631	708	632	638	7	DQLALEG	75.39
DP02730	Q6P1M3	LLGL scribble cell polarity complex component 2	Homo sapiens	631	708	687	693	7	GLQNMEL	76.92
DP02730	Q6P1M3	LLGL scribble cell polarity complex component 2	Homo sapiens	631	708	696	703	8	VQRKIEAR	80.27
DP02735	P07355	Annexin A2 (Annexin II) (Annexin-2) (Calpactin I heavy chain) (Calpactin-1 heavy chain) (Chromobindin-8) (Lipocortin II) (Placental anticoagulant protein IV) (PAP-IV) (Protein I) (p36)	Homo sapiens (Human)	2	33	3	15	13	TVHEILCKLSLEG	76
DP02736	Q04049	DNA polymerase eta	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	510	632	510	529	20	DLQKTVVDMFGNQVHTFKSS	76.04
DP02736	Q04049	DNA polymerase eta	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	510	632	551	579	29	ECCKYQVTFTDQKALQEHADYHLALKLSE	87.63
DP02736	Q04049	DNA polymerase eta	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	510	632	583	601	19	GAEESSKNLSFGEKRLLFS	78.95
DP02736	Q04049	DNA polymerase eta	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	510	632	616	627	12	KQVTSSKNILSF	81.88
DP02741	P09951	Synapsin-1	Rattus norvegicus	2	111	9	24	16	SDSNFMANLPNGYMTD	93.31
DP02741	P09951	Synapsin-1	Rattus norvegicus	2	111	46	56	11	SAAASAERAST	73.91
DP02741	P09951	Synapsin-1	Rattus norvegicus	2	111	73	99	27	GGGFFSSLSNAVKQTTAAAAATFSEQV	78.25
DP02742	P06756	Integrin alpha-V	Homo sapiens	868	897	883	892	10	RDHLITKRDL	81.67
DP02744	Q92574	Hamartin	Homo sapiens	939	992	941	967	27	LQAAESRYEAQKRITQVFELEILDLYG	81.12
DP02746	Q14565	Meiotic recombination protein DMC1/LIM15 homolog	Homo sapiens (Human)	1	82	17	29	13	EESLFQDIDLLQK	83.92
DP02746	Q14565	Meiotic recombination protein DMC1/LIM15 homolog	Homo sapiens (Human)	1	82	41	56	16	KSVGICTIKGIQMTTR	81.9
DP02756	P21447	ATP-dependent translocase ABCB1	Mus musculus	627	686	627	637	11	AGNEIELGNEA	76.8
DP02756	P21447	ATP-dependent translocase ABCB1	Mus musculus	627	683	627	637	11	AGNEIELGNEA	76.8
DP02761	P25299	"mRNA 3-end-processing protein RNA15"	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	127	232	131	146	16	DFQNSGNANFLSQKFP	80.14
DP02761	P25299	"mRNA 3-end-processing protein RNA15"	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	127	232	152	160	9	IDVNINMTT	83.05
DP02761	P25299	"mRNA 3-end-processing protein RNA15"	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	127	232	162	170	9	AMMISSELA	75.25
DP02761	P25299	"mRNA 3-end-processing protein RNA15"	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	127	232	176	190	15	VQLKFLQKFQEWTRA	83.1
DP02761	P25299	"mRNA 3-end-processing protein RNA15"	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	127	232	194	219	26	DAVSLLELCPQLSFVTAELLLTNGIC	77.01
DP02761	P25299	"mRNA 3-end-processing protein RNA15"	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	127	232	221	227	7	VDDLIPL	79.93
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	3	11	9	ALPLLAATT	76.03
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	23	32	10	LPLLLFLLPA	78.36
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	34	41	8	AVQGWETE	75.96
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	49	62	14	EECHFYAGGQVYPG	81.92
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	90	123	34	GTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFV	83.24
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	125	162	38	PTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINT	81.13
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	187	194	8	DYGVYLED	81.19
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	199	207	9	LRGLFIIDD	79.67
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	210	217	8	ILRQITLN	78.8
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	271	231	239	9	LVQAFQYTD	89.97
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	75	3	11	9	ALPLLAATT	76.03
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	75	23	32	10	LPLLLFLLPA	78.36
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	75	34	41	8	AVQGWETE	75.96
DP02764	Q13162	Peroxiredoxin-4	Homo sapiens	1	75	49	62	14	EECHFYAGGQVYPG	81.92
DP02768	P09950	5-aminolevulinate synthase; mitochondrial	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	83	113	88	104	17	KSYRYFNNINRLAKEFP	95.34
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	26	1	21	21	MFVFLVLLPLVSSQCVNLTTR	80.39
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	144	164	153	159	7	MESEFRV	80.36
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	319	541	322	356	35	PTESIVRFPNITNLCPFGEVFNATRFASVYAWNRK	77.99
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	319	541	362	381	20	VADYSVLYNSASFSTFKCYG	81.19
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	319	541	388	404	17	NDLCFTNVYADSFVIRG	79.15
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	319	541	414	425	12	QTGKIADYNYKL	89.16
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	319	541	430	442	13	TGCVIAWNSNNLD	80.29
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	319	541	445	460	16	VGGNYNYLYRLFRKSN	84.72
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	319	541	468	477	10	ISTEIYQAGS	76.22
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	319	541	482	520	39	GVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHA	78.84
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	437	508	445	460	16	VGGNYNYLYRLFRKSN	84.72
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	437	508	468	477	10	ISTEIYQAGS	76.22
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	437	508	482	503	22	GVEGFNCYFPLQSYGFQPTNGV	80.15
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	455	490	468	477	10	ISTEIYQAGS	76.22
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	828	853	829	848	20	ADAGFIKQYGDCLGDIAARD	75.42
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	829	852	829	847	19	ADAGFIKQYGDCLGDIAAR	75.32
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1147	1208	1151	1160	10	ELDKYFKNHT	80.47
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1147	1208	1168	1203	36	DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL	83.84
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1148	1273	1151	1160	10	ELDKYFKNHT	80.47
DP02772	P0DTC2	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1148	1273	1168	1239	72	DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTS	86.4
DP02782	Q9NPI8	Fanconi anemia group F protein	Homo sapiens	156	357	165	175	11	TQAELLLERLQ	80.27
DP02782	Q9NPI8	Fanconi anemia group F protein	Homo sapiens	156	357	186	212	27	ARFLSSLWERLPQNNFLKVIAVALLQP	80.96
DP02782	Q9NPI8	Fanconi anemia group F protein	Homo sapiens	156	357	233	254	22	GSQVLVHWLLGNSEVFAAFCRA	83.28
DP02782	Q9NPI8	Fanconi anemia group F protein	Homo sapiens	156	357	257	266	10	AGLLTLVTSR	78.16
DP02782	Q9NPI8	Fanconi anemia group F protein	Homo sapiens	156	357	271	280	10	SPVYLGLLTD	76.62
DP02782	Q9NPI8	Fanconi anemia group F protein	Homo sapiens	156	357	290	316	27	QKGIWVGTESQDVPWEELHNRFQSLCQ	75.13
DP02782	Q9NPI8	Fanconi anemia group F protein	Homo sapiens	156	357	323	332	10	DKVLTALETC	75.65
DP02782	Q9NPI8	Fanconi anemia group F protein	Homo sapiens	156	357	343	352	10	GLSIWTDLLL	79
DP02787	P45523	FKBP-type peptidyl-prolyl cis-trans isomerase FkpA	Escherichia coli (strain K12)	15	114	15	28	14	AVALHAPITFAAEA	79.14
DP02787	P45523	FKBP-type peptidyl-prolyl cis-trans isomerase FkpA	Escherichia coli (strain K12)	15	114	46	64	19	QKSAYALGASLGRYMENSL	77.64
DP02787	P45523	FKBP-type peptidyl-prolyl cis-trans isomerase FkpA	Escherichia coli (strain K12)	15	114	76	88	13	KDQLIAGVQDAFA	92.2
DP02787	P45523	FKBP-type peptidyl-prolyl cis-trans isomerase FkpA	Escherichia coli (strain K12)	15	114	94	109	16	SDQEIEQTLQAFEARV	78.55
DP02790	Q8BTI9	Phosphatidylinositol 4;5-bisphosphate 3-kinase catalytic subunit beta isoform	Mus musculus	402	431	410	423	14	STKTINPSKYQTIR	82.66
DP02791	O08908	Phosphatidylinositol 3-kinase regulatory subunit beta (PI3-kinase regulatory subunit beta) (PI3K regulatory subunit beta) (PtdIns-3-kinase regulatory subunit beta) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta) (PI3-kinase subunit p85-beta) (PtdIns-3-kinase regulatory subunit p85-beta)	Mus musculus (Mouse)	576	607	581	602	22	RQRKINEWLGIKNETEDQYSLM	77.12
DP02795	Q9NV23	S-acyl fatty acid synthase thioesterase; medium chain (EC 3.1.2.14) (Augmented in rheumatoid arthritis 1) (AURA1) (Oleoyl-ACP hydrolase) (Thioesterase 2) (TE2) (Thioesterase II) (Thioesterase domain-containing protein 1)	Homo sapiens (Human)	1	24	11	19	9	RNENIFNCL	83.95
DP02796	Q56026	Cell invasion protein SipD (Salmonella invasion protein D)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	110	132	113	121	9	TSALFSASP	76.96
DP02799	P34257	Transposable element Tc3 transposase	Caenorhabditis elegans	104	135	124	130	7	KRLEFAK	76.11
DP02800	P63028	Translationally-controlled tumor protein (TCTP) (21 kDa polypeptide) (p21) (p23)	Mus musculus (Mouse)	39	66	39	56	18	TEGAIDDSLIGGNASAEG	81.81
DP02801	P05452	Tetranectin	Homo sapiens	1	49	1	22	22	MELWGAYLLLCLFSLLTQVTTE	81.77
DP02801	P05452	Tetranectin	Homo sapiens	1	49	37	44	8	DVVNTKMF	77.68
DP02803	Q96Q11	CCA tRNA nucleotidyltransferase 1; mitochondrial	Homo sapiens	384	434	395	418	24	KVGISSGKEIGALLQQLREQWKKS	75.32
DP02805	Q91WA6	Sharpin	Mus musculus	301	341	305	312	8	GQSLQNSK	76.51
DP02806	P0CY08	Mating-type protein ALPHA2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	103	132	112	127	16	DGLVFNVVTQDMINKS	77.36
DP02808	P53927	Ribosome biogenesis protein 15	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	1	87	29	36	8	ELALETSS	78.85
DP02808	P53927	Ribosome biogenesis protein 15	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	1	80	29	36	8	ELALETSS	78.85
DP02815	P62330	ADP-ribosylation factor 6	Homo sapiens	34	56	36	51	16	GQSVTTIPTVGFNVET	77.84
DP02817	Q64373	Bcl-2-like protein 1	Mus musculus	28	81	28	35	8	SDVEENRT	79.93
DP02817	Q64373	Bcl-2-like protein 1	Mus musculus	28	81	47	60	14	TPSAINGNPSWHLA	84.95
DP02820	Q62264	Thyroid hormone-inducible hepatic protein	Mus musculus	1	150	10	34	25	KNCLLTVMDRYSAVVRNMEQVVMIP	80.36
DP02820	Q62264	Thyroid hormone-inducible hepatic protein	Mus musculus	1	150	53	70	18	APDLYTYFTMLKSICVEV	78.84
DP02820	Q62264	Thyroid hormone-inducible hepatic protein	Mus musculus	1	150	84	132	49	VAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLT	76.27
DP02820	Q62264	Thyroid hormone-inducible hepatic protein	Mus musculus	1	150	138	145	8	VTRKYQEM	76.25
DP02820	Q62264	Thyroid hormone-inducible hepatic protein	Mus musculus	77	104	84	99	16	VAGNETSEAENDAAET	73.91
DP02822	Q8IVH8	Mitogen-activated protein kinase kinase kinase kinase 3	Homo sapiens	315	380	327	339	13	TRSEITFGQVKFD	88.53
DP02822	Q8IVH8	Mitogen-activated protein kinase kinase kinase kinase 3	Homo sapiens	315	380	355	375	21	SDGFLDSSEEIYYTARSNLDL	83.26
DP02826	P40344	Autophagy-related protein 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	84	162	103	113	11	DDVLEYIGSET	93.83
DP02826	P40344	Autophagy-related protein 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	84	162	132	142	11	IDELIQDMEIK	85.5
DP02826	P40344	Autophagy-related protein 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	84	162	149	155	7	DTEEFNA	84.62
DP02826	P40344	Autophagy-related protein 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	84	128	103	113	11	DDVLEYIGSET	93.83
DP02826	P40344	Autophagy-related protein 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	142	162	149	155	7	DTEEFNA	84.62
DP02831	Q13164	Mitogen-activated protein kinase 7 (MAP kinase 7) (MAPK 7) (EC 2.7.11.24) (Big MAP kinase 1) (BMK-1) (Extracellular signal-regulated kinase 5) (ERK-5)	Homo sapiens (Human)	1	46	33	41	9	AAKNLALLK	76.03
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	409	426	18	QQRKFQYGNYCKYYGYRN	81.87
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	455	466	12	GHLTLSIACKWG	79.54
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	483	497	15	ARQNIRHYLSEELRL	79.46
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	545	564	20	DTSVFPNNVVFVTGNYVLDR	84.21
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	575	593	19	YDVVLCLSLTKWVHLNWGD	79.23
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	599	605	7	MFRRIYR	75.06
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	611	617	7	GILVLEP	79.65
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	629	642	14	LTETIYKNYYRIQL	85.71
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	645	651	7	EQFSSYL	78.55
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	653	667	15	SPDVGFSSYELVATP	76.14
DP02832	Q7L2J0	7SK snRNA methylphosphate capping enzyme	Homo sapiens	400	689	676	684	9	RPVYLFHKA	79.56
DP02833	Q9Y4F1	FERM; ARHGEF and pleckstrin domain-containing protein 1	Homo sapiens	862	909	885	897	13	ADQESEDDLSASR	75.59
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1	142	1	21	21	MDIKSFLYQFCAKSQIEPKFD	78.17
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1	142	29	37	9	NRQRFLCEV	73.91
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1	142	40	52	13	EPNTYIGVGNSTN	76.54
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1	142	63	77	15	DFVNYLVRVGKLNTN	83.86
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1	104	1	21	21	MDIKSFLYQFCAKSQIEPKFD	78.17
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1	104	29	37	9	NRQRFLCEV	73.91
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1	104	40	52	13	EPNTYIGVGNSTN	76.54
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1	104	63	77	15	DFVNYLVRVGKLNTN	83.86
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	81	164	133	144	12	GGNRYSVIDRIQ	78.43
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	81	164	151	159	9	EAEAFDVNA	82.61
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1159	1293	1197	1248	52	NGRTFGGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGGYRN	78.53
DP02836	P24785	Dosage compensation regulator	Drosophila melanogaster	1159	1293	1268	1274	7	GDSFESN	75.35
DP02838	P20807	Calpain-3	Homo sapiens	269	320	283	290	8	MGELIARM	91.64
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	330	553	337	348	12	IQKNIVDDLFSV	85.09
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	330	553	363	373	11	TLENLSIMDFV	76.56
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	330	553	384	398	15	EGYLSNQSNNGSAQN	74.52
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	330	553	429	439	11	TKVEYVSYNSV	81.21
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	330	553	459	469	11	KANAEVDSLPS	75.59
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	330	553	471	484	14	NVQESEDDKAFEEN	76.73
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	330	553	491	500	10	GSVEYIRIMS	83.44
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	330	553	510	525	16	HTSKYYSGRKNFKKFQ	82.19
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	330	553	533	542	10	PLQAFLSLSE	81.47
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	474	531	477	484	8	DDKAFEEN	78.85
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	474	531	491	500	10	GSVEYIRIMS	83.44
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	474	531	510	525	16	HTSKYYSGRKNFKKFQ	82.19
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	477	526	477	484	8	DDKAFEEN	78.85
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	477	526	491	500	10	GSVEYIRIMS	83.44
DP02839	O43070	DNA repair and telomere maintenance protein nbs1	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	477	526	510	521	12	HTSKYYSGRKNF	82.83
DP02847	P47110	DNA polymerase delta subunit 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	117	350	119	125	7	ESSKIIE	77.11
DP02847	P47110	DNA polymerase delta subunit 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	117	350	165	172	8	STALLAKM	75.92
DP02847	P47110	DNA polymerase delta subunit 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	117	350	191	202	12	KEENLQKINKQN	89.97
DP02847	P47110	DNA polymerase delta subunit 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	117	350	211	220	10	ELNNLFVEDD	82.71
DP02847	P47110	DNA polymerase delta subunit 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	117	350	251	258	8	EDLLETTA	78.68
DP02847	P47110	DNA polymerase delta subunit 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	117	350	288	302	15	PSSFIDEDGYIVTKR	86.09
DP02847	P47110	DNA polymerase delta subunit 3	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	117	350	339	345	7	GTLESFF	85.48
DP02848	P15436	DNA polymerase delta catalytic subunit	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	1007	1051	1031	1042	12	SGELYIKALYDV	85.23
DP02850	O60239	SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK)	Homo sapiens (Human)	266	452	295	326	32	ISVASEAFEDDSCSNFVSEDDSETQSVSSFSS	80.54
DP02850	O60239	SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK)	Homo sapiens (Human)	266	452	354	363	10	SLSEFGMMFP	85.28
DP02850	O60239	SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK)	Homo sapiens (Human)	266	452	387	395	9	AEGAENKTS	74.8
DP02850	O60239	SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK)	Homo sapiens (Human)	266	452	424	437	14	GQALENRMKQLSLQ	76.59
DP02853	Q99P68	Sclerostin	Mus musculus (Mouse)	1	51	6	42	37	APCLICLLVHAAFCAVEGQGWQAFRNDATEVIPGLGE	80.74
DP02854	Q9BYF1	Angiotensin-converting enzyme 2 (EC 3.4.17.23) (Angiotensin-converting enzyme homolog) (ACEH) (Angiotensin-converting enzyme-related carboxypeptidase) (ACE-related carboxypeptidase) (EC 3.4.17.-) (Metalloprotease MPROT15) Cleaved into: Processed angiotensin-converting enzyme 2	Homo sapiens (Human)	769	805	777	787	11	GENPYASIDIS	76.65
DP02854	Q9BYF1	Angiotensin-converting enzyme 2 (EC 3.4.17.23) (Angiotensin-converting enzyme homolog) (ACEH) (Angiotensin-converting enzyme-related carboxypeptidase) (ACE-related carboxypeptidase) (EC 3.4.17.-) (Metalloprotease MPROT15) Cleaved into: Processed angiotensin-converting enzyme 2	Homo sapiens (Human)	769	805	794	800	7	GFQNTDD	85.71
DP02855	P11166	Solute carrier family 2; facilitated glucose transporter member 1	Homo sapiens	456	492	456	468	13	KGRTFDEIASGFR	82.66
DP02860	P55211	Caspase-9	Homo sapiens	289	334	296	303	8	FEVASTSP	80.27
DP02860	P55211	Caspase-9	Homo sapiens	289	334	322	329	8	GLRTFDQL	82.19
DP02862	P08670	Vimentin	Homo sapiens (Human)	99	144	106	139	34	ELQELNDRFANYIDKVRFLEQQNKILLAELEQLK	81.04
DP02863	P62558	Protein SopB (Plasmid partition protein B)	Escherichia coli (strain K12)	272	323	285	291	7	ATVLYKG	97.32
DP02863	P62558	Protein SopB (Plasmid partition protein B)	Escherichia coli (strain K12)	272	323	293	299	7	KMVLNLD	79.41
DP02863	P62558	Protein SopB (Plasmid partition protein B)	Escherichia coli (strain K12)	272	323	307	318	12	CIEKIEAILKEL	78.6
DP02863	P62558	Protein SopB (Plasmid partition protein B)	Escherichia coli (strain K12)	275	323	285	291	7	ATVLYKG	97.32
DP02863	P62558	Protein SopB (Plasmid partition protein B)	Escherichia coli (strain K12)	275	323	293	299	7	KMVLNLD	79.41
DP02863	P62558	Protein SopB (Plasmid partition protein B)	Escherichia coli (strain K12)	275	323	307	318	12	CIEKIEAILKEL	78.6
DP02869	Q16630	Cleavage and polyadenylation specificity factor subunit 6	Homo sapiens	13	80	14	25	12	VGEEFNQEAEYG	85.37
DP02869	Q16630	Cleavage and polyadenylation specificity factor subunit 6	Homo sapiens	13	80	29	39	11	QIDLYDDVISP	82.61
DP02869	Q16630	Cleavage and polyadenylation specificity factor subunit 6	Homo sapiens	481	551	517	523	7	HDDYYRE	80.6
DP02871	Q5D1E7	Endoribonuclease ZC3H12A	Mus musculus	296	339	310	322	13	KKCTYGIKCRFFH	76.02
DP02871	Q5D1E7	Endoribonuclease ZC3H12A	Mus musculus	301	326	310	321	12	KKCTYGIKCRFF	76.14
DP02878	Q8XAD5	Uncharacterized protein	Escherichia coli O157:H7	1	63	8	34	27	MVSEFETIEQENSYNEWLRAKVATSLA	82.15
DP02878	Q8XAD5	Uncharacterized protein	Escherichia coli O157:H7	5	49	8	34	27	MVSEFETIEQENSYNEWLRAKVATSLA	82.15
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1	260	1	13	13	MFIFLLFLTLTSG	81.94
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1	260	26	96	71	QAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSN	80.17
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1	260	99	108	10	RGWVFGSTMN	77.79
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1	260	111	142	32	SQSVIIINNSTNVVIRACNFELCDNPFFAVSK	79.37
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1	260	148	208	61	THTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRD	81.07
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1	260	211	221	11	SGFNTLKPIFK	77.53
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1	260	224	255	32	LGINITNFRAILTAFSPAQDIWGTSAAAYFVG	84.93
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	810	830	811	825	15	ADAGFMKQYGECLGD	80.27
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1059	1196	1059	1122	64	TAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDP	81.08
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1059	1196	1133	1142	10	ELDKYFKNHT	80.47
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1059	1196	1150	1191	42	DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQY	83.72
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1105	1193	1108	1122	15	CDVVIGIINNTVYDP	83.01
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1105	1193	1133	1142	10	ELDKYFKNHT	80.47
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1105	1193	1150	1188	39	DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKY	83.9
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1120	1196	1133	1142	10	ELDKYFKNHT	80.47
DP02879	P59594	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Severe acute respiratory syndrome coronavirus (SARS-CoV)	1120	1196	1150	1191	42	DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQY	83.72
DP02880	K9N5Q8	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1)	1207	1294	1207	1218	12	PQVTYQNISTNL	88.43
DP02880	K9N5Q8	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1)	1207	1294	1222	1232	11	LLGNSTGIDFQ	76.25
DP02880	K9N5Q8	"Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2"	Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1)	1207	1294	1234	1289	56	ELDEFFKNVSTSIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNY	82.08
DP02888	Q70627	Protein Nef	Human immunodeficiency virus type 1 group M subtype B (isolate LW123)	149	180	158	166	9	KGENTSLLH	75.7
DP02889	P03407	Protein Nef	Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2)	45	71	45	66	22	GAITSSNTAATNADCAWLEAQE	77.79
DP02889	P03407	Protein Nef	Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2)	45	69	45	64	20	GAITSSNTAATNADCAWLEA	78.14
DP02889	P03407	Protein Nef	Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2)	150	176	163	170	8	GENNSLLH	79.93
DP02889	P03407	Protein Nef	Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2)	155	181	163	170	8	GENNSLLH	79.93
DP02889	P03407	Protein Nef	Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2)	155	179	163	170	8	GENNSLLH	79.93
DP02889	P03407	Protein Nef	Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2)	157	179	163	170	8	GENNSLLH	79.93
DP02892	Q3UND0	Src kinase-associated phosphoprotein 2 (Pyk2/RAFTK-associated protein) (SKAP55 homolog) (SKAP-HOM) (Src family-associated phosphoprotein 2) (Src kinase-associated phosphoprotein 55-related protein) (Src-associated adapter protein with PH and SH3 domains)	Mus musculus (Mouse)	65	105	83	93	11	ADTISLASERY	76.16
DP02894	Q9BZZ5-2	Isoform 2 of Apoptosis inhibitor 5	Homo sapiens	455	504	491	499	9	NLGNFNYER	85.47
DP02897	Q90VU7	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus 1	27	56	39	51	13	KHGAITSSNTAAN	76.41
DP02900	P0A968	Cold shock-like protein CspD (CSP-D)	Escherichia coli (strain K12)	1	74	4	18	15	GTVKWFNNAKGFGFI	91.59
DP02900	P0A968	Cold shock-like protein CspD (CSP-D)	Escherichia coli (strain K12)	1	74	23	35	13	GGEDIFAHYSTIQ	86
DP02900	P0A968	Cold shock-like protein CspD (CSP-D)	Escherichia coli (strain K12)	1	74	46	54	9	QSVQFDVHQ	80.27
DP02900	P0A968	Cold shock-like protein CspD (CSP-D)	Escherichia coli (strain K12)	1	74	60	66	7	HASVIVP	91.97
DP02901	J7QA90	DUF1778 domain-containing protein (Hypothetical protein) (Toxin-antitoxin system antitoxin component) (Toxin-antitoxin system protein) (Toxin-antitoxin system; antitoxin component) (Toxin-antitoxin system; antitoxin component; ribbon-helix-helix fold protein) (Uncharacterized protein conserved in bacteria;Protein of uncharacterized function (DUF1778)) (Ybl13)	Escherichia coli	44	88	44	50	7	AAEVIEQ	87.15
DP02901	J7QA90	DUF1778 domain-containing protein (Hypothetical protein) (Toxin-antitoxin system antitoxin component) (Toxin-antitoxin system protein) (Toxin-antitoxin system; antitoxin component) (Toxin-antitoxin system; antitoxin component; ribbon-helix-helix fold protein) (Uncharacterized protein conserved in bacteria;Protein of uncharacterized function (DUF1778)) (Ybl13)	Escherichia coli	44	88	52	70	19	RRVILNEESWTRVMDALSN	77.66
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	2	10	9	KEQEFSYRE	86.18
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	20	29	10	GLENSFLSSP	82.07
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	33	55	23	KTPLFFEGNSNETSGYDQTKNFT	77.11
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	62	99	38	SLGNLSELNVATDLLESLDLRSMYMHGYGHLDSSFSSQ	81.03
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	110	118	9	STSVFKRIN	78.82
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	126	143	18	PSLTYSAGTMNSTSSSTA	75.2
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	150	169	20	IVADYETFNPDQNLAELSFD	84.18
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	179	187	9	VEVAEFSRA	82.39
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	191	202	12	SPLEYTVQHPYQ	75.39
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	204	210	7	HNELSTN	75.92
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	236	243	8	HLSASSTV	76.92
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	305	313	9	DDSDISTES	74.14
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	329	348	20	SGSSYASTLRKVYDFSELSL	77.73
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	355	365	11	YDELYLQSSRN	81.51
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	369	393	25	EISTIINDSLQQENMDEDISATSIP	80.94
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	402	425	24	GSVTYHEVPRYNLTSASVGYSISS	83.03
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	452	432	447	16	SSSTIDNLSAILSSED	78.32
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	2	10	9	KEQEFSYRE	86.18
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	20	29	10	GLENSFLSSP	82.07
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	33	55	23	KTPLFFEGNSNETSGYDQTKNFT	77.11
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	62	99	38	SLGNLSELNVATDLLESLDLRSMYMHGYGHLDSSFSSQ	81.03
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	110	118	9	STSVFKRIN	78.82
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	126	143	18	PSLTYSAGTMNSTSSSTA	75.2
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	150	169	20	IVADYETFNPDQNLAELSFD	84.18
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	179	187	9	VEVAEFSRA	82.39
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	191	202	12	SPLEYTVQHPYQ	75.39
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	204	210	7	HNELSTN	75.92
DP02903	P78953	Division mal foutue 1 protein	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	1	308	236	243	8	HLSASSTV	76.92
DP02910	P28023	Dynactin subunit 1	Rattus norvegicus	108	191	175	181	7	AGELSSS	77.26
DP02913	P04004	Vitronectin	Homo sapiens	1	130	5	24	20	RPLLILALLAWVALADQESC	79.38
DP02913	P04004	Vitronectin	Homo sapiens	1	130	42	48	7	ELCSYYQ	95.32
DP02913	P04004	Vitronectin	Homo sapiens	1	130	65	80	16	GDVFTMPEDEYTVYDD	82.88
DP02913	P04004	Vitronectin	Homo sapiens	1	130	84	92	9	KNNATVHEQ	75.47
DP02913	P04004	Vitronectin	Homo sapiens	1	71	5	24	20	RPLLILALLAWVALADQESC	79.38
DP02913	P04004	Vitronectin	Homo sapiens	1	71	42	48	7	ELCSYYQ	95.32
DP02913	P04004	Vitronectin	Homo sapiens	22	58	42	48	7	ELCSYYQ	95.32
DP02913	P04004	Vitronectin	Homo sapiens	48	130	65	80	16	GDVFTMPEDEYTVYDD	82.88
DP02913	P04004	Vitronectin	Homo sapiens	48	130	84	92	9	KNNATVHEQ	75.47
DP02915	P48443	Retinoic acid receptor RXR-gamma	Homo sapiens	2	127	4	12	9	NYSHFMKFP	82.61
DP02915	P48443	Retinoic acid receptor RXR-gamma	Homo sapiens	2	127	30	36	7	SAALSTG	74.2
DP02915	P48443	Retinoic acid receptor RXR-gamma	Homo sapiens	2	127	70	76	7	YRVITSA	80.27
DP02915	P48443	Retinoic acid receptor RXR-gamma	Homo sapiens	2	127	98	109	12	SQLNVVNSVSSS	86.29
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	10	185	29	45	17	KANLFDWDDAETASLSH	81.35
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	10	185	47	60	14	PQSKIKIQSIDKFD	77.97
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	10	185	70	77	8	KLVIKLSE	74.92
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	10	185	87	118	32	PLVEYVTEKEYNEVPVEEFGDALLRGMGWESD	77.36
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	10	185	152	174	23	LNKAINVEEASFMPVVKIDKITG	78.67
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	10	150	29	45	17	KANLFDWDDAETASLSH	81.35
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	10	150	47	60	14	PQSKIKIQSIDKFD	77.97
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	10	150	70	77	8	KLVIKLSE	74.92
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	10	150	87	118	32	PLVEYVTEKEYNEVPVEEFGDALLRGMGWESD	77.36
DP02917	Q02521	Pre-mRNA-splicing factor SPP2	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	100	150	101	118	18	PVEEFGDALLRGMGWESD	74.88
DP02919	Q9SQK3	Ankyrin repeat domain-containing protein EMB506; chloroplastic	Arabidopsis thaliana	40	112	80	86	7	SENEYEG	85.95
DP02920	Q05753	Ankyrin repeat domain-containing protein; chloroplastic	Arabidopsis thaliana	37	231	37	48	12	SLSYSSQTSILP	80.27
DP02920	Q05753	Ankyrin repeat domain-containing protein; chloroplastic	Arabidopsis thaliana	37	231	51	69	19	GDDFIVGDCLVYEDGVFED	81.48
DP02920	Q05753	Ankyrin repeat domain-containing protein; chloroplastic	Arabidopsis thaliana	37	231	74	82	9	KEVTQVAKQ	74.36
DP02920	Q05753	Ankyrin repeat domain-containing protein; chloroplastic	Arabidopsis thaliana	37	231	96	106	11	DESEIEPENLV	80.6
DP02920	Q05753	Ankyrin repeat domain-containing protein; chloroplastic	Arabidopsis thaliana	37	231	112	119	8	DIQAEVNL	77.72
DP02920	Q05753	Ankyrin repeat domain-containing protein; chloroplastic	Arabidopsis thaliana	37	231	128	134	7	AQEMEFG	76.97
DP02920	Q05753	Ankyrin repeat domain-containing protein; chloroplastic	Arabidopsis thaliana	37	231	151	171	21	DLNDFLTYKEAKLAQLRPVIL	89.52
DP02920	Q05753	Ankyrin repeat domain-containing protein; chloroplastic	Arabidopsis thaliana	37	231	204	210	7	RWAVYGK	73.91
DP02920	Q05753	Ankyrin repeat domain-containing protein; chloroplastic	Arabidopsis thaliana	37	231	214	225	12	HVAKFFNSDKYD	87.37
DP02922	P01215	Glycoprotein hormones alpha chain	Homo sapiens	33	57	37	44	8	QENPFFSQ	75.42
DP02924	P0C6X7	Replicase polyprotein 1ab	Human SARS coronavirus	129	179	132	144	13	GGHSYGIDLKSYD	74.5
DP02924	P0C6X7	Replicase polyprotein 1ab	Human SARS coronavirus	129	179	157	164	8	YEQNWNTK	80.81
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	148	13	26	14	HVQLSLPVLQVRDV	80.94
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	148	36	42	7	EEVLSEA	79.93
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	148	64	74	11	LEQPYVFIKRS	85.56
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	148	84	99	16	VMVELVAELEGIQYGR	76.46
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	148	110	124	15	HVGEIPVAYRKVLLR	80.25
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	148	132	143	12	GGHSYGADLKSF	75.59
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	147	13	26	14	HVQLSLPVLQVRDV	80.94
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	147	36	42	7	EEVLSEA	79.93
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	147	64	74	11	LEQPYVFIKRS	85.56
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	147	84	99	16	VMVELVAELEGIQYGR	76.46
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	147	110	124	15	HVGEIPVAYRKVLLR	80.25
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	147	132	142	11	GGHSYGADLKS	75.43
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	127	13	26	14	HVQLSLPVLQVRDV	80.94
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	127	36	42	7	EEVLSEA	79.93
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	127	64	74	11	LEQPYVFIKRS	85.56
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	127	84	99	16	VMVELVAELEGIQYGR	76.46
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	127	110	122	13	HVGEIPVAYRKVL	80.19
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	3943	4020	3943	3979	37	AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKK	78.79
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	3943	4020	4005	4015	11	ADQAMTQMYKQ	78.47
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	3948	4020	3950	3979	30	SLPSYAAFATAQEAYEQAVANGDSEVVLKK	79.39
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	3948	4020	4005	4015	11	ADQAMTQMYKQ	78.47
DP02925	P0DTD1	"Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)"	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	3995	4020	4005	4015	11	ADQAMTQMYKQ	78.47
DP02928	A0A220GHA5	AcrIIA5	Streptococcus phage D4276	1	22	4	12	9	GKSRYNSYR	79.04
DP02929	P0A2N1	MAPK phosphothreonine lyase	Salmonella enteritidis	1	26	8	21	14	LNLNIPPLNIVAAY	86
DP02936	A0A3S5Y0Q5	Virulence associated protein VapG	Rhodococcus hoagii (strain 103S) (Rhodococcus equi)	27	66	30	39	10	MVSTTAASSV	78.6
DP02936	A0A3S5Y0Q5	Virulence associated protein VapG	Rhodococcus hoagii (strain 103S) (Rhodococcus equi)	27	66	41	58	18	HAANTYDFAEAKSGSSIP	83.07
DP02946	Q2VL32	Aip56	Photobacterium damsela subsp. piscicida (Pasteurella piscicida)	278	314	279	285	7	SEGISSF	78.93
DP02946	Q2VL32	Aip56	Photobacterium damsela subsp. piscicida (Pasteurella piscicida)	278	314	297	306	10	GGGAFFLPSA	81.71
DP02949	O25555	Uncharacterized protein	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)	96	125	100	115	16	ETDLIVEDFSSYSNER	79.37
DP02950	P0C079	Antitoxin RelB	Escherichia coli (strain K12)	43	79	47	53	7	KQTLLSD	75.92
DP02950	P0C079	Antitoxin RelB	Escherichia coli (strain K12)	43	79	57	65	9	ELVEIVKER	96.32
DP02950	P0C079	Antitoxin RelB	Escherichia coli (strain K12)	43	65	47	53	7	KQTLLSD	75.92
DP02950	P0C079	Antitoxin RelB	Escherichia coli (strain K12)	47	79	47	53	7	KQTLLSD	75.92
DP02950	P0C079	Antitoxin RelB	Escherichia coli (strain K12)	47	79	57	65	9	ELVEIVKER	96.32
DP02950	P0C079	Antitoxin RelB	Escherichia coli (strain K12)	52	79	57	65	9	ELVEIVKER	96.32
DP02957	P47992	Lymphotactin (ATAC) (C motif chemokine 1) (Cytokine SCM-1) (Lymphotaxin) (SCM-1-alpha) (Small-inducible cytokine C1) (XC chemokine ligand 1)	Homo sapiens (Human)	82	114	102	109	8	TQQSTNTA	79.89
DP02957	P47992	Lymphotactin (ATAC) (C motif chemokine 1) (Cytokine SCM-1) (Lymphotaxin) (SCM-1-alpha) (Small-inducible cytokine C1) (XC chemokine ligand 1)	Homo sapiens (Human)	90	114	102	109	8	TQQSTNTA	79.89
DP02960	P00880	Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit) (EC 4.1.1.39)	Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)	410	472	417	425	9	NRVALEACV	74.32
DP02960	P00880	Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit) (EC 4.1.1.39)	Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)	410	472	452	467	16	LAAALDLWKEIKFEFE	78.01
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	172	355	208	218	11	GAGGYTLQAAV	74.43
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	172	355	226	245	20	KIPSISELLNDYSLAQLFDD	76.84
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	172	355	267	279	13	SQFHVNSSGNNMS	79.5
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	172	355	319	325	7	AAAVTNK	79.93
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	172	355	328	349	22	NSSCFGATTFQVGNNTLQGSLG	76.53
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	172	250	208	218	11	GAGGYTLQAAV	74.43
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	172	250	226	245	20	KIPSISELLNDYSLAQLFDD	76.84
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	173	355	208	218	11	GAGGYTLQAAV	74.43
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	173	355	226	245	20	KIPSISELLNDYSLAQLFDD	76.84
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	173	355	267	279	13	SQFHVNSSGNNMS	79.5
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	173	355	319	325	7	AAAVTNK	79.93
DP02964	M0Y2D5	NAC domain-containing protein	Hordeum vulgare subsp. vulgare (Domesticated barley)	173	355	328	349	22	NSSCFGATTFQVGNNTLQGSLG	76.53
DP02965	F6IAY2	NAC transcription factor	Hordeum vulgare subsp. vulgare (Domesticated barley)	177	346	195	209	15	RVSSFGFISDHFLDA	80.38
DP02965	F6IAY2	NAC transcription factor	Hordeum vulgare subsp. vulgare (Domesticated barley)	177	346	224	239	16	VDQVIDFNSNSAYATG	80.16
DP02965	F6IAY2	NAC transcription factor	Hordeum vulgare subsp. vulgare (Domesticated barley)	177	346	260	269	10	YSSPYFSLPA	74.45
DP02965	F6IAY2	NAC transcription factor	Hordeum vulgare subsp. vulgare (Domesticated barley)	177	346	311	318	8	GCAEISSA	87.29
DP02965	F6IAY2	NAC transcription factor	Hordeum vulgare subsp. vulgare (Domesticated barley)	177	346	324	341	18	HNQDFLDHLDEYPALNLA	74.67
DP02965	F6IAY2	NAC transcription factor	Hordeum vulgare subsp. vulgare (Domesticated barley)	250	346	260	269	10	YSSPYFSLPA	74.45
DP02965	F6IAY2	NAC transcription factor	Hordeum vulgare subsp. vulgare (Domesticated barley)	250	346	311	318	8	GCAEISSA	87.29
DP02965	F6IAY2	NAC transcription factor	Hordeum vulgare subsp. vulgare (Domesticated barley)	250	346	324	341	18	HNQDFLDHLDEYPALNLA	74.67
DP02982	O01479	Tropomodulin (Tmod-like protein) (cTmd1) (Uncoordinated protein 94)	Caenorhabditis elegans	196	221	198	214	17	TGTTFNGIMQSYVPRIV	86.13
DP02985	P0A6Y8	Chaperone protein DnaK (HSP70) (Heat shock 70 kDa protein) (Heat shock protein 70)	Escherichia coli (strain K12)	606	638	607	621	15	AQQQTAGADASANNA	77.26
DP02985	P0A6Y8	Chaperone protein DnaK (HSP70) (Heat shock 70 kDa protein) (Heat shock protein 70)	Escherichia coli (strain K12)	606	638	627	633	7	VDAEFEE	82.13
DP02987	Q22942	Choline kinase A2 (EC 2.7.1.32) (Ethanolamine kinase) (EC 2.7.1.82)	Caenorhabditis elegans	1	31	14	26	13	DELASAANMSLVA	75.1
DP02987	Q22942	Choline kinase A2 (EC 2.7.1.32) (Ethanolamine kinase) (EC 2.7.1.82)	Caenorhabditis elegans	265	296	267	278	12	SSGNIRMPSLSD	77.26
DP02987	Q22942	Choline kinase A2 (EC 2.7.1.32) (Ethanolamine kinase) (EC 2.7.1.82)	Caenorhabditis elegans	265	296	280	291	12	TQALGNSLSAFN	85.23
DP02989	Q03611	Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4)	Caenorhabditis elegans	1	105	34	45	12	AATKFSILTKFL	81.74
DP02989	Q03611	Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4)	Caenorhabditis elegans	1	105	49	66	18	NQVHTTTAQQNEFMQKYM	88.46
DP02989	Q03611	Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4)	Caenorhabditis elegans	1	103	34	45	12	AATKFSILTKFL	81.74
DP02989	Q03611	Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4)	Caenorhabditis elegans	1	103	49	66	18	NQVHTTTAQQNEFMQKYM	88.46
DP02989	Q03611	Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4)	Caenorhabditis elegans	620	733	633	661	29	TVEEIAEHLNNAVKVLQTRMARLIVEHSS	78.87
DP02989	Q03611	Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4)	Caenorhabditis elegans	620	733	691	697	7	HGVSIDG	86.96
DP02989	Q03611	Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4)	Caenorhabditis elegans	621	733	633	661	29	TVEEIAEHLNNAVKVLQTRMARLIVEHSS	78.87
DP02989	Q03611	Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4)	Caenorhabditis elegans	621	733	691	697	7	HGVSIDG	86.96
DP02990	Q9U489	Protein lin-41 (Abnormal cell lineage protein 41)	Caenorhabditis elegans	730	757	738	744	7	TSQALLP	74.53
DP03003	P0DTC3	ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1)	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	41	3	21	19	LFMRIFTIGTVTLKQGEIK	83.05
DP03003	P0DTC3	ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1)	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	1	39	3	21	19	LFMRIFTIGTVTLKQGEIK	83.05
DP03003	P0DTC3	ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1)	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	239	275	243	250	8	HVQIHTID	84.16
DP03003	P0DTC3	ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1)	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)	239	275	254	265	12	GVVNPVMEPIYD	78.71
DP03005	Q53TN4	Plasma membrane ascorbate-dependent reductase CYBRD1 (EC 7.2.1.3) (Cytochrome b reductase 1) (Duodenal cytochrome b) (Ferric-chelate reductase 3)	Homo sapiens (Human)	231	286	260	268	9	SDSELNSEV	74.95
DP03018	P10565	Binary larvicide subunit BinB (63 kDa toxin crystal protein) (Binary paracrystalline larvicide subunit BinB) (Larvicidal toxin 51.4 kDa protein)	Lysinibacillus sphaericus (Bacillus sphaericus)	1	34	17	26	10	KFTNYPLNTT	86.62
DP03019	P30996	Botulinum neurotoxin type F (BoNT/F) (Bontoxilysin-F) Cleaved into: Botulinum neurotoxin F light chain (LC) (EC 3.4.24.69); Botulinum neurotoxin F heavy chain (HC)	Clostridium botulinum	416	439	421	432	12	LVEKIVKFCKSV	83.44
DP03021	F2WK69	Toxin CdiA	Escherichia coli O157:H7	88	164	89	95	7	NQSLTFD	85.09
DP03021	F2WK69	Toxin CdiA	Escherichia coli O157:H7	88	164	107	120	14	NCQDIIDKWEKISD	79.96
DP03021	F2WK69	Toxin CdiA	Escherichia coli O157:H7	88	164	122	131	10	QSAEIDQKLK	79.93
DP03021	F2WK69	Toxin CdiA	Escherichia coli O157:H7	88	164	136	142	7	EAQVIDK	78.64
DP03022	I1WVY3	tRNA nuclease CdiA-2 (tRNase CdiA-2) (EC 3.1.-.-) (CdiA-Bp1026b) (Toxin CdiA-2) (Toxin CdiA-II)	Burkholderia pseudomallei (strain 1026b)	2948	2987	2955	2970	16	PSNAILSNSNSDNNST	80.31
DP03026	A0A384E149	Catalytic domain of botulinum neurotoxin X	Clostridium botulinum	414	439	415	423	9	ALRAFIKIC	89.15
DP03026	A0A384E149	Catalytic domain of botulinum neurotoxin X	Clostridium botulinum	414	439	426	434	9	NGLLYNAIY	84.36
DP03034	Q48245	Vacuolating cytotoxin autotransporter Cleaved into: Vacuolating cytotoxin; Vacuolating cytotoxin translocator	Helicobacter pylori (Campylobacter pylori)	333	367	352	362	11	SQNNSNTQVIN	79.39
DP03092	O00308	NEDD4-like E3 ubiquitin-protein ligase WWP2	Homo sapiens	662	702	667	685	19	GLELYFIQDMEILGKVTTH	85.65
DP03092	O00308	NEDD4-like E3 ubiquitin-protein ligase WWP2	Homo sapiens	662	702	690	697	8	GGESIRVT	75.25
DP03100	Q14258	E3 ubiquitin/ISG15 ligase TRIM25	Homo sapiens	361	433	417	428	12	QAGLEAAAKATS	75.59
DP03121	P11686	Pulmonary surfactant-associated protein C	Homo sapiens	59	89	66	74	9	EMVLEMSIG	78.26
DP03121	P11686	Pulmonary surfactant-associated protein C	Homo sapiens	59	89	78	84	7	AQQRLAL	75.92
DP03240	P0A8Q6	ATP-dependent Clp protease adapter protein ClpS	Escherichia coli (strain K12)	1	22	5	16	12	NDWLDFDQLAEE	80.27
DP03254	P52848	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1	Homo sapiens	558	578	566	573	8	LAQKYFQI	87.42
DP03294	P02760	Protein AMBP	Homo sapiens	206	229	218	224	7	GQLVTEV	83.85
DP03299	P00734	Prothrombin	Homo sapiens	187	211	188	196	9	QDQVTVAMT	75.55
DP03310	Q3U4G3	Xyloside xylosyltransferase 1	Mus musculus	43	87	44	51	8	GRETFSSA	80.27
DP03311	P00740	Coagulation factor IX	Homo sapiens	47	93	51	61	11	KLEEFVQGNLE	83.89
DP03311	P00740	Coagulation factor IX	Homo sapiens	47	93	74	82	9	AREVFENTE	81.49
DP03312	P10619	Lysosomal protective protein	Homo sapiens	288	327	300	308	9	DLGNIFTRL	83.95
DP03312	P10619	Lysosomal protective protein	Homo sapiens	288	327	314	322	9	WHQALLRSG	76.14
DP03335	P42573	Cell death protein 3	Caenorhabditis elegans	370	406	388	397	10	DGPLFNFLGC	82.27
DP03338	Q9A8N4	PopZ	Caulobacter vibrioides (strain ATCC 19089 / CB15)	1	133	9	22	14	TMEEILASIRRIIS	80.17
DP03338	Q9A8N4	PopZ	Caulobacter vibrioides (strain ATCC 19089 / CB15)	1	133	45	58	14	EPVSFDDEVLELTD	78.55
DP03338	Q9A8N4	PopZ	Caulobacter vibrioides (strain ATCC 19089 / CB15)	1	133	74	80	7	DIDVYSP	80.22
DP03338	Q9A8N4	PopZ	Caulobacter vibrioides (strain ATCC 19089 / CB15)	1	133	101	128	28	DEVAEQLVGVSAASAAASAFGSLSSALL	76.73
DP03345	O00214	Galectin-8	Homo sapiens	154	175	162	170	9	ASSLELTEI	78.6
DP03347	P10824	Guanine nucleotide-binding protein G(i) subunit alpha-1	Rattus norvegicus	2	32	2	9	8	GCTLSAED	73.83
DP03350	P03316	Structural polyprotein	Sindbis virus	1	113	2	10	9	NRGFFNMLG	87.18
DP03350	P03316	Structural polyprotein	Sindbis virus	1	113	38	57	20	LASQIQQLTTAVSALVIGQA	81.59
DP03353	P05546	Heparin cofactor 2	Homo sapiens	20	79	42	52	11	WEQLNNKNLSM	74
DP03353	P05546	Heparin cofactor 2	Homo sapiens	20	79	66	72	7	TNDWIPE	75.68
DP03353	P05546	Heparin cofactor 2	Homo sapiens	91	113	91	101	11	DYIDIVDSLSV	81.57
DP03354	P63144	Voltage-gated potassium channel subunit beta-1	Rattus norvegicus	1	62	1	7	7	MQVSIAC	96.32
DP03354	P63144	Voltage-gated potassium channel subunit beta-1	Rattus norvegicus	1	62	31	57	27	NVVNAARAKFRTVAIIARSLGTFTPQH	81.22
DP03356	A0A1L8HX71	XPA_C domain-containing protein	Xenopus laevis	1	84	12	26	15	EEEKILSAAVRAKIE	77.86
DP03356	A0A1L8HX71	XPA_C domain-containing protein	Xenopus laevis	1	84	64	74	11	GGGFFIEEEEA	78.63
DP03356	A0A1L8HX71	XPA_C domain-containing protein	Xenopus laevis	181	265	182	195	14	SLEVWGSEEALEEA	79.74
DP03356	A0A1L8HX71	XPA_C domain-containing protein	Xenopus laevis	181	265	251	260	10	KTCITCGYEM	79.43
DP03357	Q5SHN5	Elongation factor G	Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)	40	67	43	57	15	GEVHEGAATMDFMEQ	74.31
DP03359	P9WJD9	ESX-1 secretion-associated protein EspB	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	86	126	99	107	9	TVQAESAGA	76.22
DP03359	P9WJD9	ESX-1 secretion-associated protein EspB	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	290	460	292	300	9	EQGLIPGFL	85.95
DP03359	P9WJD9	ESX-1 secretion-associated protein EspB	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	290	460	336	342	7	AAQLTSA	84.42
DP03359	P9WJD9	ESX-1 secretion-associated protein EspB	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	290	460	346	362	17	AAALSGDVAVKAASLGG	79.93
DP03359	P9WJD9	ESX-1 secretion-associated protein EspB	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	290	460	373	383	11	LGSAIGGAESV	85.28
DP03359	P9WJD9	ESX-1 secretion-associated protein EspB	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	290	460	387	394	8	GAGDIAGL	75.92
DP03359	P9WJD9	ESX-1 secretion-associated protein EspB	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	290	460	432	450	19	EDEALYTEDRAWTEAVIGN	78.88