CARs-DB

Waltz threshold =73.5

Waltz thresholds: 85 80

DisProt ID	UniProt Acc	Protein	Organism	Start (IDR)	End (IDR)	Start (CAR)	End (CAR)	CAR Length	Sequence	Waltz Score
DP00003	P03265	DNA-binding protein (DBP) (Early 2A protein) (Early E2A DNA-binding protein)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	294	334	294	304	11	EHVIEMDVTSE	79.93
DP00004	P49913	Cathelicidin antimicrobial peptide (18 kDa cationic antimicrobial protein) (CAP-18) (hCAP-18) Cleaved into: Antibacterial peptide FALL-39 (FALL-39 peptide antibiotic); Antibacterial peptide LL-37	Homo sapiens (Human)	134	170	134	141	8	LLGDFFRK	76.25
DP00004	P49913	Cathelicidin antimicrobial peptide (18 kDa cationic antimicrobial protein) (CAP-18) (hCAP-18) Cleaved into: Antibacterial peptide FALL-39 (FALL-39 peptide antibiotic); Antibacterial peptide LL-37	Homo sapiens (Human)	134	170	149	165	17	EFKRIVQRIKDFLRNLV	76.79
DP00005	P03045	Antitermination protein N (Regulatory protein N) (PN)	Escherichia phage lambda (Bacteriophage lambda)	1	107	15	30	16	QAQWKAANPLLVGVSA	77.17
DP00005	P03045	Antitermination protein N (Regulatory protein N) (PN)	Escherichia phage lambda (Bacteriophage lambda)	1	107	48	76	29	VESALNPIDLTVLAEYHKQIESNLQRIER	80.83
DP00005	P03045	Antitermination protein N (Regulatory protein N) (PN)	Escherichia phage lambda (Bacteriophage lambda)	1	36	15	30	16	QAQWKAANPLLVGVSA	77.17
DP00006	P00004	Cytochrome c	Equus caballus (Horse)	1	104	7	21	15	GKKIFVQKCAQCHTV	80.6
DP00006	P00004	Cytochrome c	Equus caballus (Horse)	1	104	45	76	32	PGFTYTDANKNKGITWKEETLMEYLENPKKYI	80.04
DP00006	P00004	Cytochrome c	Equus caballus (Horse)	1	104	78	87	10	GTKMIFAGIK	76.22
DP00006	P00004	Cytochrome c	Equus caballus (Horse)	1	104	92	99	8	REDLIAYL	81.52
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	48	54	7	TAVVLPH	75.25
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	56	63	8	PLATYSTV	76.05
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	84	90	7	CAGWLSQ	84.33
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	104	124	21	PYTEYVSHEAVSCPYSTDMYV	77.26
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	137	150	14	SSVLTYASPPLITN	91.81
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	189	195	7	SSLQYQP	76.25
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	206	213	8	VQLPISIP	80.6
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	256	226	251	26	AISSLTIDKLLLEEEESNTYELNHTL	78.69
DP00008	Q64693	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)	Mus musculus (Mouse)	1	65	48	54	7	TAVVLPH	75.25
DP00011	P0DMM9	Sulfotransferase 1A3 (ST1A3) (EC 2.8.2.1) (Aryl sulfotransferase 1A3/1A4) (Catecholamine-sulfating phenol sulfotransferase) (HAST3) (M-PST) (Monoamine-sulfating phenol sulfotransferase) (Placental estrogen sulfotransferase) (Sulfotransferase 1A3/1A4) (Sulfotransferase; monoamine-preferring) (Thermolabile phenol sulfotransferase) (TL-PST)	Homo sapiens (Human)	215	260	223	232	10	MVQHTSFKEM	74.75
DP00011	P0DMM9	Sulfotransferase 1A3 (ST1A3) (EC 2.8.2.1) (Aryl sulfotransferase 1A3/1A4) (Catecholamine-sulfating phenol sulfotransferase) (HAST3) (M-PST) (Monoamine-sulfating phenol sulfotransferase) (Placental estrogen sulfotransferase) (Sulfotransferase 1A3/1A4) (Sulfotransferase; monoamine-preferring) (Thermolabile phenol sulfotransferase) (TL-PST)	Homo sapiens (Human)	215	260	236	255	20	PMTNYTTVPQELMDHSISPF	78.04
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	659	673	15	NSILTETLHRFSLEG	75.18
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	675	682	8	APVSWTET	76.25
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	698	718	21	KNSILNPINSIRKFSIVQKTP	77.51
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	744	758	15	QGEAILPRISVISTG	78.64
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	766	774	9	RQSVLNLMT	77.52
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	779	785	7	QGQNIHR	84.62
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	799	810	12	QANLTELDIYSR	77.17
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	654	838	816	833	18	TGLEISEEINEEDLKECF	85.01
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	709	718	10	RKFSIVQKTP	74.55
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	744	758	15	QGEAILPRISVISTG	78.64
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	766	774	9	RQSVLNLMT	77.52
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	779	785	7	QGQNIHR	84.62
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	799	810	12	QANLTELDIYSR	77.17
DP00012	P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	Homo sapiens (Human)	708	831	816	826	11	TGLEISEEINE	84.68
DP00014	P05371	Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain	Rattus norvegicus (Rat)	66	97	68	76	9	SLLNSLEEA	80.27
DP00014	P05371	Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain	Rattus norvegicus (Rat)	386	447	403	409	7	VVVKLFD	84.71
DP00014	P05371	Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain	Rattus norvegicus (Rat)	386	447	436	442	7	ALQEYRR	90.64
DP00015	P61926	cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform)	Oryctolagus cuniculus (Rabbit)	1	76	2	15	14	TDVETTYADFIASG	79.34
DP00015	P61926	cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform)	Oryctolagus cuniculus (Rabbit)	1	76	22	51	30	AIHDILVSSASGNSNELALKLAGLDINKTE	77.65
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	38	44	7	MAGCIQE	79.93
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	47	57	11	ERWNFDFVTET	81.57
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	61	68	8	GDFAWERV	77.55
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	111	120	10	VDLSLSCTLV	74.88
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	164	147	159	13	MTDFYHSKRRLIF	80.86
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	94	38	44	7	MAGCIQE	79.93
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	94	47	57	11	ERWNFDFVTET	81.57
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	1	94	61	68	8	GDFAWERV	77.55
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	9	84	38	44	7	MAGCIQE	79.93
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	9	84	47	57	11	ERWNFDFVTET	81.57
DP00016	P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	Homo sapiens (Human)	9	84	61	68	8	GDFAWERV	77.55
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	23	35	13	VLVRTSACRSLFG	75.61
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	49	66	18	RLAELNAEDQNRWDYDFQ	75.4
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	76	82	7	RLQWTEV	86.62
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	86	95	10	SVPAFYRETV	78.09
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	109	117	9	VAVAVAVSP	74.73
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	173	181	9	VAVAVLAPA	77.03
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	239	248	10	ADQLHSGISG	74.98
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	1	316	254	278	25	TAAASANGAAIKKLSGPLISDFFAK	78.13
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	27	97	49	66	18	RLAELNAEDQNRWDYDFQ	75.4
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	27	97	76	82	7	RLQWTEV	86.62
DP00017	P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	Homo sapiens (Human)	27	97	86	92	7	SVPAFYR	78.02
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	1	198	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	1	198	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	1	198	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	1	50	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	105	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	105	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	105	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	97	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	97	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	22	97	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	25	93	28	34	7	ACRNLFG	75.35
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	25	93	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	25	93	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	55	95	56	68	13	SQRKWNFDFQNHK	80.55
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	55	95	70	81	12	LEGKYEWQEVEK	75.42
DP00018	P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	Homo sapiens (Human)	66	88	70	81	12	LEGKYEWQEVEK	75.42
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	5	15	11	DDFETAPAEYV	81.57
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	40	60	21	AEVKANQNEENTGATAAETSE	75.94
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	78	88	11	VGVTTTTPSIA	79.93
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	92	106	15	ATANIASTSGASVTE	77.12
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	229	238	10	GVDNSNSNSD	74.98
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	246	264	19	KTEIISTNTNGATEDSTSE	76.98
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	279	296	18	QAQLLRQHVSSTASITSG	80.49
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	300	306	7	DLVQIEQ	81.08
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	313	320	8	NNNNSNVN	79.93
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	359	339	351	13	GNASFQAQRSMIS	75.3
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	594	674	598	604	7	RARNYSS	76.64
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	594	674	612	634	23	ANAASANAAAAAAAAASNSYAIP	77.74
DP00020	P11938	DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	594	674	642	669	28	DTMNFISSLKNDLSNISNSLPFEYPHEI	80.76
DP00021	P13551	Elongation factor G (EF-G)	Thermus thermophilus	40	67	43	57	15	GEVHEGAATMDFMEQ	74.31
DP00021	P13551	Elongation factor G (EF-G)	Thermus thermophilus	40	64	43	57	15	GEVHEGAATMDFMEQ	74.31
DP00024	P03129	Protein E7	Human papillomavirus type 16	1	40	7	14	8	TLHEYMLD	86.96
DP00024	P03129	Protein E7	Human papillomavirus type 16	1	40	19	35	17	TTDLYCYEQLNDSSEEE	80.17
DP00024	P03129	Protein E7	Human papillomavirus type 16	16	40	19	35	17	TTDLYCYEQLNDSSEEE	80.17
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	749	756	8	GNQSFEED	80.02
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	766	778	13	QGGNIVDIDFDSV	80.73
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	787	794	8	GNQSFEED	80.02
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	804	816	13	HGGNIIDIDFDSV	79.42
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	818	832	15	HIHGFNKHTEIIEED	76.77
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	745	874	846	853	8	NSVDFEED	76.92
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	749	756	8	GNQSFEED	80.02
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	766	778	13	QGGNIVDIDFDSV	80.73
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	787	794	8	GNQSFEED	80.02
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	804	816	13	HGGNIIDIDFDSV	79.42
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	818	832	15	HIHGFNKHTEIIEED	76.77
DP00025	P14738	Fibronectin-binding protein A (FnbpA)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	746	858	846	853	8	NSVDFEED	76.92
DP00026	P06179	Flagellin (Phase 1-I flagellin)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	65	1	41	41	MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSA	80.89
DP00026	P06179	Flagellin (Phase 1-I flagellin)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	65	46	60	15	AGQAIANRFTANIKG	83.21
DP00026	P06179	Flagellin (Phase 1-I flagellin)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	455	494	455	489	35	EDSDYATEVSNMSRAQILQQAGTSVLAQANQVPQN	76.88
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	97	36	51	16	ATSASVTLSDAQAKLM	79.35
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	97	54	61	8	GVSDINME	80.94
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	1	97	78	92	15	DTGKIADSLIREAQS	85.95
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	41	97	54	61	8	GVSDINME	80.94
DP00027	P26477	Negative regulator of flagellin synthesis (Anti-sigma-28 factor)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	41	97	78	92	15	DTGKIADSLIREAQS	85.95
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	1	118	32	47	16	GDYSTTPGGTLFSTTP	76.02
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	1	118	49	62	14	GTRIIYDRKFLMEC	82.68
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	1	55	32	47	16	GDYSTTPGGTLFSTTP	76.02
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	5	118	32	47	16	GDYSTTPGGTLFSTTP	76.02
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	5	118	49	62	14	GTRIIYDRKFLMEC	82.68
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	49	83	49	62	14	GTRIIYDRKFLMEC	82.68
DP00028	Q13541	Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)	Homo sapiens (Human)	50	84	50	62	13	TRIIYDRKFLMEC	82.3
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	80	91	12	KAVSLSMGLYMG	88.04
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	106	114	9	QQGQISLSS	81.05
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	117	135	19	TDLKLLEESIANLNRSTSV	82.47
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	179	202	24	GNVKLYTTDQSTFDILQDLEFSSG	78.34
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	215	227	13	SDLLIDENCLLSP	83.33
DP00030	P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	Homo sapiens (Human)	77	262	232	244	13	DDSFLLEGNSNED	77.98
DP00032	P56206	Glycine--tRNA ligase (EC 6.1.1.14) (Glycyl-tRNA synthetase) (GlyRS)	Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)	85	170	119	134	16	MEVEEENLHALVQAMM	75.08
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	271	299	29	IIFGIFGLTVMLFVFLFSKQQRIKMLILP	84.02
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	320	330	11	EEVNTILAIHD	87.35
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	341	351	11	SWVEFIELDID	78.9
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	362	369	8	TDRLLSSD	73.91
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	393	407	15	DILETDFNANDIHEG	78.93
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	421	428	8	ADLLCLDQ	77.26
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	445	453	9	QPSVIQAEK	75.25
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	469	494	26	QAAHIQLSNPSSLSNIDFYAQVSDIT	83.32
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	497	503	7	GSVVLSP	78.93
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	524	539	16	CQENFLMDNAYFCEAD	82.48
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	561	575	15	NQEDIYITTESLTTA	80.91
DP00033	P10912	Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)	Homo sapiens (Human)	270	620	596	613	18	TSIHIVQSPQGLILNATA	83.02
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	5	22	18	DSVETMDEISNPNNILLP	82.72
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	30	41	12	ATGISGSQEPYG	74.58
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	58	69	12	DEPLIEDIVNPS	80.52
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	89	101	13	LQQPISLDHVITR	78.29
DP00036	P22121	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)	1	195	105	136	32	AGGVYSIGNSSTSSAAKLSDGDLTNATDPLLN	76.41
DP00037	Q9Y9L0	Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin)	Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)	197	250	207	216	10	CLDWWFCWDT	81.81
DP00037	Q9Y9L0	Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin)	Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)	197	250	221	230	10	DDVEEARRYL	76.25
DP00037	Q9Y9L0	Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin)	Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)	197	250	238	245	8	AKLLYEEA	77.97
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	11	22	12	KMSSYAYFVQTR	81.1
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	33	41	9	ASVNFSEFS	89.37
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	97	107	11	PSSAFFIFCAD	82.7
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	128	144	17	LGEKWNNLTAEDKVPYE	79.58
DP00041	P07746	High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1)	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)	1	204	157	163	7	DITAYRN	79.93
DP00043	P02929	Protein TonB	Escherichia coli (strain K12)	103	151	138	146	9	ATAATSKPV	75.59
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	8	20	13	QRSKYLASASTMD	77.46
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	38	46	9	SLGRFFGSD	79.04
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	84	93	10	PVVHFFKNIV	86.76
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	107	117	11	GLSLSRFSWGA	76.28
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	169	145	156	12	AQGTLSKIFKLG	79.68
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	109	8	20	13	QRSKYLASASTMD	77.46
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	109	38	46	9	SLGRFFGSD	79.04
DP00047	P02687	Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein)	Bos taurus (Bovine)	1	109	84	93	10	PVVHFFKNIV	86.76
DP00048	P03406	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) (HIV-1)	149	178	158	166	9	KGENTSLLH	75.7
DP00048	P03406	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) (HIV-1)	149	177	158	166	9	KGENTSLLH	75.7
DP00049	P70475	Myelin transcription factor 1-like protein	Rattus norvegicus	487	606	558	565	8	GHVNSNRN	86.62
DP00051	P07805	Ornithine decarboxylase (ODC) (EC 4.1.1.17)	Trypanosoma brucei brucei	1	35	9	21	13	LSCRFLEGFNTRD	78.72
DP00051	P07805	Ornithine decarboxylase (ODC) (EC 4.1.1.17)	Trypanosoma brucei brucei	1	35	23	30	8	LCKKISMN	76.25
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	22	39	18	TEVAEEIVEEETVVEETG	79.08
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	47	69	23	VQVEMGEFEDGAEETVEEVVADN	75.24
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	103	128	26	PIGEFEKVCSNDNKTFDSSCHFFATK	78.52
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	140	152	13	LHLDYIGPCKYIA	80.65
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	155	163	9	LDSELTEFP	74.21
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	167	180	14	RDWLKNVLVTLYER	83.09
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	183	190	8	GNNLLTEK	78.18
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	219	250	32	FEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTE	81.52
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	265	273	9	TTRFFETCD	79.52
DP00052	P07214	SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)	Mus musculus (Mouse)	18	302	276	297	22	NDKYIALEEWAGCFGIKEQDIN	81.73
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	101	2	20	19	LEEALAAIQNARDLEELKA	77.29
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	101	29	35	7	KGLLTQE	75.92
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	101	51	69	19	GQELNAIKAALEAALEARE	78.17
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	84	2	20	19	LEEALAAIQNARDLEELKA	77.29
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	84	29	35	7	KGLLTQE	75.92
DP00053	P27001	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	Thermus thermophilus	1	84	51	69	19	GQELNAIKAALEAALEARE	78.17
DP00054	P78356	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta)	Homo sapiens (Human)	1	33	9	18	10	TAVAVAPLSA	74.58
DP00054	P78356	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta)	Homo sapiens (Human)	304	342	313	322	10	GGNLLCSYGT	83.95
DP00054	P78356	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta)	Homo sapiens (Human)	304	342	328	337	10	GNLLSFPRFF	80.87
DP00055	P10688	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1)	Rattus norvegicus (Rat)	130	202	140	147	8	KLQHWIHS	79.06
DP00055	P10688	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1)	Rattus norvegicus (Rat)	130	202	158	165	8	NKMNFKEL	74.25
DP00055	P10688	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1)	Rattus norvegicus (Rat)	130	202	170	188	19	KELNIQVDDGYARKIFREC	78.51
DP00055	P10688	1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1)	Rattus norvegicus (Rat)	445	482	463	470	8	VEAAEMED	73.91
DP00061	P27694	Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) Cleaved into: Replication protein A 70 kDa DNA-binding subunit; N-terminally processed	Homo sapiens (Human)	105	180	108	119	12	VGVKIGNPVPYN	83.61
DP00061	P27694	Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) Cleaved into: Replication protein A 70 kDa DNA-binding subunit; N-terminally processed	Homo sapiens (Human)	105	180	155	166	12	VSKAYGASKTFG	75.14
DP00061	P27694	Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) Cleaved into: Replication protein A 70 kDa DNA-binding subunit; N-terminally processed	Homo sapiens (Human)	109	168	155	163	9	VSKAYGASK	75.33
DP00062	P19793	Retinoic acid receptor RXR-alpha (Nuclear receptor subfamily 2 group B member 1) (Retinoid X receptor alpha)	Homo sapiens (Human)	1	130	9	21	13	LDFSTQVNSSLTS	80.63
DP00062	P19793	Retinoic acid receptor RXR-alpha (Nuclear receptor subfamily 2 group B member 1) (Retinoid X receptor alpha)	Homo sapiens (Human)	1	130	84	96	13	TLGFSTGSPQLSS	75.59
DP00063	P49799	Regulator of G-protein signaling 4 (RGP4) (RGS4)	Rattus norvegicus (Rat)	1	50	22	31	10	RLGFLLQKSD	74.98
DP00064	P03607	Capsid protein (Coat protein)	Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea))	1	64	1	8	8	MSGLFHHR	77.26
DP00064	P03607	Capsid protein (Coat protein)	Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea))	1	64	13	25	13	EIRAFVMATRLTK	76.79
DP00064	P03607	Capsid protein (Coat protein)	Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea))	1	64	28	36	9	LAQAIQNTL	87.55
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	571	580	10	KIGNYVWEDT	90.77
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	584	590	7	GVQELGE	75.25
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	593	606	14	VGNVTVTVFDNNTN	79.77
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	616	624	9	EDGSYLIPN	84.76
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	630	638	9	YRVEFSNLP	77
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	659	666	8	LSSVITVN	84.95
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	668	692	25	KDNLSADLGIYKPKYNLGDYVWEDT	84.78
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	708	735	28	VTVTLKDENGNVLKTVTTDADGKYKFTD	77.26
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	737	752	16	DNGNYKVEFTTPEGYT	77.63
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	754	763	10	TTVTSGSDIE	75.59
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	767	803	37	NGLTTTGVINGADNMTLDSGFYKTPKYNLGNYVWEDT	82.3
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	819	835	17	VTVTLKNENGEVLQTTK	76.35
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	838	863	26	KDGKYQFTGLENGTYKVEFETPSGYT	75.89
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	871	888	18	TDEGIDSNGTSTTGVIKD	75.92
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	894	913	20	IDSGFYKPTYNLGDYVWEDT	80.55
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	939	973	35	KVLKTVTTDENGKYQFTDLNNGTYKVEFETPSGYT	76.29
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	988	1023	36	NGLTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYD	78.2
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	1040	1056	17	VKVTLLNEKGEVIGTTK	76.08
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	1059	1079	21	ENGKYCFDNLDSGKYKVIFEK	80.97
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	1102	1108	7	VDVTITD	97.32
DP00065	O86488	Serine-aspartate repeat-containing protein D	Staphylococcus aureus (strain Newman)	569	1123	1110	1118	9	DDFTLDNGY	78.93
DP00066	P27285	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus)	1	113	2	10	9	NRGFFNMLG	87.18
DP00066	P27285	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus)	1	113	38	57	20	LASQIQQLTTAVSALVIGQA	81.59
DP00067	Q57733	Small heat shock protein HSP16.5	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	1	32	7	27	21	FDSLFERMFKEFFATPMTGTT	83.9
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	18	28	11	ADQLADESLES	74.03
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	33	51	19	LQLVEESKDAGIRTLVMLD	78.31
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	56	70	15	QLERIEEGMDQINKD	76.72
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	80	89	10	DLGKFCGLCV	79.93
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	125	136	12	EQMAISGGFIRR	81.3
DP00068	P60881	Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)	Rattus norvegicus (Rat)	1	206	146	161	16	MDENLEQVSGIIGNLR	82.32
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	14	29	16	GVVAAAEKTKQGVAEA	76.42
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	35	41	7	EGVLYVG	97.32
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	50	66	17	HGVATVAEKTKEQVTNV	76.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	84	98	15	GAGSIAAATGFVKKD	79.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	109	116	8	QEGILEDM	74.92
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	121	127	7	DNEAYEM	80.12
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	140	129	135	7	SEEGYQD	78.02
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	14	29	16	GVVAAAEKTKQGVAEA	76.42
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	35	41	7	EGVLYVG	97.32
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	50	66	17	HGVATVAEKTKEQVTNV	76.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	103	84	98	15	GAGSIAAATGFVKKD	79.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	14	29	16	GVVAAAEKTKQGVAEA	76.42
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	35	41	7	EGVLYVG	97.32
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	50	66	17	HGVATVAEKTKEQVTNV	76.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	1	102	84	97	14	GAGSIAAATGFVKK	79.84
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	42	92	50	66	17	HGVATVAEKTKEQVTNV	76.53
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	42	92	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	61	95	68	82	15	GAVVTGVTAVAQKTV	78.51
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	61	95	84	90	7	GAGSIAA	84.42
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	101	140	109	116	8	QEGILEDM	74.92
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	101	140	121	127	7	DNEAYEM	80.12
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	101	140	129	135	7	SEEGYQD	78.02
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	103	140	109	116	8	QEGILEDM	74.92
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	103	140	121	127	7	DNEAYEM	80.12
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	103	140	129	135	7	SEEGYQD	78.02
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	104	140	109	116	8	QEGILEDM	74.92
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	104	140	121	127	7	DNEAYEM	80.12
DP00070	P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	Homo sapiens (Human)	104	140	129	135	7	SEEGYQD	78.02
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	12	25	14	SVSDILSPLEESYK	77.78
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	37	43	7	PLAAYRQ	76.92
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	62	72	11	GAVTAAYHMTA	75.83
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	77	95	19	QLSHSAVGGYCNGNLGNMS	75.04
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	1	156	121	129	9	RFPAISRFM	84.84
DP00071	P23441	Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1)	Rattus norvegicus (Rat)	58	78	62	72	11	GAVTAAYHMTA	75.83
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	9951	9960	10	APEIIDVSSK	86.96
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	9962	9970	9	EEVKIMTIT	88.52
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	9979	9985	7	KEAVYEK	78.6
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	9993	10023	31	KRVFIESFEEPYDELEVEPYTEPFEQPYYEE	80.65
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10027	10033	7	DYEEIKV	80.6
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10039	10061	23	VHEEWEEDFEEGQEYYEREEGYD	87.97
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10063	10088	26	GEEEWEEAYQEREVIQVQKEVYEESH	80.98
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10112	10120	9	VIEKIEKTS	78.37
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10151	10159	9	QEEVIEVKV	83.02
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10166	10188	23	KMVISEEKMFFASHTEEEVSVTV	78.1
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10191	10208	18	VQKEIVTEEKIHVAISKR	78.3
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10305	10318	14	GVVTEEKITIVTQR	80.72
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10394	10405	12	RFVAEEKLSFAV	76.42
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10418	10438	21	AEEEWSYSEEEEGVSISVYRE	87.69
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10447	10474	28	AEVTEYEVMEEPEEYVVEEKLHIISKRV	81.63
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10479	10492	14	AEVTERQEKKIVLK	76.97
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10567	10582	16	HMQITQEEKVLVAVTK	78.07
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10617	10623	7	AKVTEFR	75.25
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10630	10636	7	EKVSIEA	79.55
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10653	10666	14	KERAYTLEEEAVSV	80.27
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10668	10715	48	REEEYEEYEEYDYKEFEEYEPTEEYDQYEEYEEREYERYEEHEEYITE	79.87
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10774	10784	11	FEEKIRISITK	76.65
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	10833	10875	43	EEVAFEEEVVTHVEEYLVEEEEEYIHEEEEFITEEEVVPVIPV	81.43
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11032	11041	10	EEVLFEEEIV	86.92
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11124	11130	7	KKVVIPK	77.26
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11271	11283	13	RTVLEEKVSVAFR	80.65
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11291	11336	46	RLELEVVEAEVEEIPEEEEFHEVEEYFEEGEFHEVEEFIKLEQHRV	80.6
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11345	11360	16	VHRVIEVFEAEEVEVF	78.11
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11402	11408	7	KIVVEEK	77.26
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11597	11603	7	EEVALEE	76.25
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11606	11612	7	AEVVEEP	76.25
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11733	11744	12	EPEEIAPEEEIA	76.59
DP00072	Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	Homo sapiens (Human)	9880	12031	11820	11830	11	VKEKIFQLKAI	77.77
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	12	25	14	MALLHQIQGNELEP	75.92
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	39	46	8	LGEVYLDS	87.5
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	48	75	28	KPAVYNYPEGAAYEFNAAAAANAQVYGQ	83.25
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	85	92	8	EAAAFGSN	77.01
DP00074	P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	Homo sapiens (Human)	1	184	126	136	11	QQVPYYLENEP	78.84
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	1	206	8	19	12	NDSQIEADFRLN	77.45
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	1	206	106	112	7	KENGFSS	73.91
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	1	174	8	19	12	NDSQIEADFRLN	77.45
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	1	174	106	112	7	KENGFSS	73.91
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	175	214	201	209	9	QKWKWWEEE	77.18
DP00075	P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	Homo sapiens (Human)	636	712	639	652	14	TFEKSMMNLQTKID	78.12
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	631	651	638	644	7	IDLAFSK	91.97
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	634	681	638	644	7	IDLAFSK	91.97
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	634	681	651	658	8	KEWLRQYE	75.33
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	634	681	666	676	11	TLKEIPISDFI	76.95
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1070	1105	1075	1085	11	IAEQINDVKGA	75.55
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1071	1105	1075	1085	11	IAEQINDVKGA	75.55
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1222	1239	18	EDKNFERILLEQKLVTKS	77.16
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1269	1277	9	SSSSIFDIK	81.53
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1285	1301	17	ELSKISNKFKKISTIFD	81.43
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1318	1329	12	DDVATKKNQTTA	75.25
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1348	1354	7	KVVELSG	77.64
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1356	1366	11	SDLEILDSYTD	81.39
DP00076	P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1203	1428	1397	1417	21	SYVETLELSDDSFIEDDEEEN	77.66
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	216	225	10	MSVASLDLTG	77.26
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	235	245	11	SEEAFTLPLLN	75.13
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	270	278	9	DDFLFPASS	91.97
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	294	306	13	LSGSFYAADWEPL	77.18
DP00078	P01100	Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7)	Homo sapiens (Human)	216	380	333	346	14	SCTAYTSSFVFTYP	87.03
DP00079	Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	Homo sapiens (Human)	1	103	12	24	13	SPSSYNCSQSILP	78.06
DP00079	Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	Homo sapiens (Human)	1	103	26	37	12	EHGSIYIPSSYV	83
DP00079	Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	Homo sapiens (Human)	1	103	44	67	24	PAMTFYSPAVMNYSIPSNVTNLEG	77.66
DP00081	P51123	Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230)	Drosophila melanogaster (Fruit fly)	11	77	20	29	10	LTGILFGNID	88.96
DP00081	P51123	Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230)	Drosophila melanogaster (Fruit fly)	11	77	52	63	12	LRENIGSLSKLG	80.94
DP00081	P51123	Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230)	Drosophila melanogaster (Fruit fly)	11	77	66	72	7	SMLLEVI	78.26
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	393	401	9	LEAEIETTT	76.33
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	410	420	11	TVSHILNVLKD	75.8
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	424	434	11	IEDVFSFNYPE	88.08
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	446	462	17	EHVKYTYGPTFLLQFKD	80.01
DP00082	P39935	Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	393	490	468	481	14	ADAEWVQSTASKIV	83.42
DP00083	P03069	General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	101	134	106	115	10	PMFEYENLED	78.86
DP00083	P03069	General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	101	134	118	129	12	KEWTSLFDNDIP	89.19
DP00083	P03069	General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	225	281	257	274	18	VEELLSKNYHLENEVARL	77
DP00084	P61244	Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X)	Homo sapiens (Human)	2	110	60	75	16	RAQILDKATEYIQYMR	79.58
DP00084	P61244	Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X)	Homo sapiens (Human)	2	110	90	101	12	RQNALLEQQVRA	79.77
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	437	447	11	SEALLQLQFDD	82.67
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	451	458	8	GALLGNST	76.17
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	460	484	25	PAVFTDLASVDNSEFQQLLNQGIPV	77.79
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	492	507	16	MLMEYPEAITRLVTGA	80.18
DP00085	Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	Homo sapiens (Human)	428	551	525	546	22	NGLLSGDEDFSSIADMDFSALL	79.45
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	93	14	26	13	LSQETFSDLWKLL	84.56
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	93	49	56	8	DIEQWFTE	78.6
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	73	14	26	13	LSQETFSDLWKLL	84.56
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	73	49	56	8	DIEQWFTE	78.6
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	1	39	14	26	13	LSQETFSDLWKLL	84.56
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	14	60	14	26	13	LSQETFSDLWKLL	84.56
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	14	60	49	55	7	DIEQWFT	79.31
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	20	73	49	56	8	DIEQWFTE	78.6
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	41	62	49	56	8	DIEQWFTE	78.6
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	320	393	323	352	30	LDGEYFTLQIRGRERFEMFRELNEALELKD	76.74
DP00086	P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	Homo sapiens (Human)	325	356	325	351	27	GEYFTLQIRGRERFEMFRELNEALELK	75.86
DP00087	P68336	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)	350	394	367	380	14	TRNNYGSTIEGLLD	80.65
DP00087	P68336	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)	413	490	417	432	16	TDVSLGDELRLDGEEV	75.92
DP00087	P68336	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)	413	490	461	469	9	DPVSYGALD	77.26
DP00087	P68336	Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65)	Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)	413	490	471	485	15	DDFEFEQMFTDAMGI	76.32
DP00088	P0ABI8	Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1)	Escherichia coli (strain K12)	1	51	17	46	30	VMVTIAGIILGGLALVGLITYFGKWTYLWK	83.99
DP00088	P0ABI8	Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1)	Escherichia coli (strain K12)	553	663	561	568	8	RDAFWEMK	80.85
DP00088	P0ABI8	Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1)	Escherichia coli (strain K12)	553	663	579	585	7	HYEEIHM	75.49
DP00088	P0ABI8	Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1)	Escherichia coli (strain K12)	553	663	591	658	68	AGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPVAEIEKLENQHFDEITKAG	83.22
DP00089	P0ABJ1	Cytochrome bo(3) ubiquinol oxidase subunit 2 (Cytochrome b562-o complex subunit II) (Cytochrome o ubiquinol oxidase subunit 2) (Cytochrome o subunit 2) (Oxidase bo(3) subunit 2) (Ubiquinol oxidase chain B) (Ubiquinol oxidase polypeptide II) (Ubiquinol oxidase subunit 2)	Escherichia coli (strain K12)	1	26	2	21	20	RLRKYNKSLGWLSLFAGTVL	86.07
DP00090	Q14722	Voltage-gated potassium channel subunit beta-1 (EC 1.1.1.-) (K(+) channel subunit beta-1) (Kv-beta-1)	Homo sapiens (Human)	1	62	9	19	11	AGSQISEENTK	77.26
DP00090	Q14722	Voltage-gated potassium channel subunit beta-1 (EC 1.1.1.-) (K(+) channel subunit beta-1) (Kv-beta-1)	Homo sapiens (Human)	1	62	22	28	7	RQSGFSV	75.59
DP00091	P27088	DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog)	Xenopus laevis (African clawed frog)	1	84	14	28	15	EEEKILSAAVRAKIE	77.86
DP00091	P27088	DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog)	Xenopus laevis (African clawed frog)	1	84	66	76	11	GGGFFIEEEEA	78.63
DP00091	P27088	DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog)	Xenopus laevis (African clawed frog)	181	265	184	197	14	SLEVWGSEEALEEA	79.74
DP00091	P27088	DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog)	Xenopus laevis (African clawed frog)	181	265	253	260	8	KTCITCGY	77.38
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	521	393	424	32	KEVIRNKIRAIGKMARVFSVLREESESVLTLK	80.19
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	521	444	462	19	LQSATVEAIEADEAIKGFS	84.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	521	466	473	8	KITSFEEA	74.25
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	521	492	508	17	SDANLNSINKALTSETN	83.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	468	393	424	32	KEVIRNKIRAIGKMARVFSVLREESESVLTLK	80.19
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	468	444	462	19	LQSATVEAIEADEAIKGFS	84.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	466	393	424	32	KEVIRNKIRAIGKMARVFSVLREESESVLTLK	80.19
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	373	466	444	461	18	LQSATVEAIEADEAIKGF	84.82
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	374	468	393	424	32	KEVIRNKIRAIGKMARVFSVLREESESVLTLK	80.19
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	374	468	444	462	19	LQSATVEAIEADEAIKGFS	84.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	390	414	393	409	17	KEVIRNKIRAIGKMARV	80.27
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	467	521	492	508	17	SDANLNSINKALTSETN	83.99
DP00092	Q08209	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform)	Homo sapiens (Human)	487	521	492	508	17	SDANLNSINKALTSETN	83.99
DP00094	P04177	Tyrosine 3-monooxygenase (EC 1.14.16.2) (Tyrosine 3-hydroxylase) (TH)	Rattus norvegicus (Rat)	1	71	26	36	11	AEAVTSPRFIG	74.58
DP00094	P04177	Tyrosine 3-monooxygenase (EC 1.14.16.2) (Tyrosine 3-hydroxylase) (TH)	Rattus norvegicus (Rat)	1	71	38	44	7	RQSLIED	91.97
DP00097	P10922	"Histone H1.0 (Histone H1) (Histone H1(0)) (MyD196) Cleaved into: Histone H1.0; N-terminally processed"	Mus musculus (Mouse)	1	30	1	8	8	MTENSTSA	73.91
DP00097	P10922	"Histone H1.0 (Histone H1) (Histone H1(0)) (MyD196) Cleaved into: Histone H1.0; N-terminally processed"	Mus musculus (Mouse)	96	193	103	110	8	RSVAFKKT	80.6
DP00099	P50440	Glycine amidinotransferase; mitochondrial (EC 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase)	Homo sapiens (Human)	38	63	39	46	8	TQAATASS	80.27
DP00100	P0A6H5	ATP-dependent protease ATPase subunit HslU (Heat shock protein HslU) (Unfoldase HslU)	Escherichia coli (strain K12)	175	209	182	188	7	MGVEIMA	81.37
DP00103	P09372	Protein GrpE (HSP-70 cofactor) (HSP24) (Heat shock protein B25.3)	Escherichia coli (strain K12)	1	32	13	27	15	APEEIIMDQHEEIEA	82.16
DP00104	P32773	Transcription initiation factor IIA large subunit (TFIIA large subunit) (TFIIA 32 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	210	240	227	234	8	DDYLISEG	81.73
DP00107	P69924	Ribonucleoside-diphosphate reductase 1 subunit beta (EC 1.17.4.1) (Protein B2) (Protein R2) (Ribonucleotide reductase 1)	Escherichia coli (strain K12)	342	376	352	364	13	VEVSSYLVGQIDS	79.21
DP00110	P40881	Carbonic anhydrase (EC 4.2.1.1)	Methanosarcina thermophila	1	37	4	27	24	NKQIFTILILSLSLALAGSGCISE	79.29
DP00111	P27577	Protein C-ets-1 (p54)	Mus musculus (Mouse)	244	301	248	260	13	GQDSFESVESYDS	79.52
DP00111	P27577	Protein C-ets-1 (p54)	Mus musculus (Mouse)	244	301	264	278	15	LTQSWSSQSSFNSLQ	81.34
DP00111	P27577	Protein C-ets-1 (p54)	Mus musculus (Mouse)	244	301	282	292	11	SYDSFDYEDYP	74.46
DP00112	P22239	Desiccation-related protein clone PCC6-19 (CDET6-19)	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	155	13	22	10	HTDEYGNPIQ	73.91
DP00112	P22239	Desiccation-related protein clone PCC6-19 (CDET6-19)	Craterostigma plantagineum (Blue gem) (Torenia plantagineum)	1	155	121	128	8	DQQQYGTA	76.46
DP00113	P31109	Synaptobrevin homolog 1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	93	32	51	20	LQAEIDDTVGIMRDNINKVA	82.84
DP00113	P31109	Synaptobrevin homolog 1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	93	64	75	12	ADNLAVSAQGFK	75.59
DP00116	P81455	Osteocalcin (Bone Gla protein) (BGP) (Gamma-carboxyglutamic acid-containing protein)	Canis lupus familiaris (Dog) (Canis familiaris)	1	49	32	44	13	LADHIGFQEAYQR	84.05
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	4	24	21	AAVLALLLCAGQVIALPVNSP	83.09
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	32	44	13	VMKCIVEVISDTL	82.76
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	62	85	24	GDERILSILRHQNLLKELQDLALQ	77.76
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	96	110	15	KHSSYEDELSEVLEK	77.93
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	118	126	9	KEVTEEVSS	74.58
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	306	312	7	PQVLFRG	87.96
DP00118	P05059	Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor	Bos taurus (Bovine)	1	449	423	444	22	DQELESLSAIEAELEKVAHQLE	78.46
DP00119	P10163	Basic salivary proline-rich protein 4 (Salivary proline-rich protein Po) (Parotid o protein) (Salivary proline-rich protein II-1) Cleaved into: Protein N1; Glycosylated protein A; Peptide P-D (Proline-rich peptide IB-5)	Homo sapiens (Human)	17	310	24	34	11	SQEESLFLISG	85.74
DP00120	P12957	Caldesmon (CDM)	Gallus gallus (Chicken)	636	771	636	647	12	RLEQYTSAVVGN	78.15
DP00120	P12957	Caldesmon (CDM)	Gallus gallus (Chicken)	636	771	700	710	11	VSSRINEWLTK	82.73
DP00120	P12957	Caldesmon (CDM)	Gallus gallus (Chicken)	636	771	733	744	12	KRNLWEKQSVEK	75.92
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	1	135	16	22	7	SASLTEA	77.26
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	1	135	63	69	7	SQGTYSD	90.64
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	1	135	71	108	38	KENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKG	79.04
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	136	297	146	156	11	TAALEEDLLTA	77.68
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	136	297	226	256	31	FAQTFGTNLEDIKQITEPSITVPSIGLSAEP	78.03
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	136	297	262	270	9	QKDWFIEMP	81.46
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	298	467	318	325	8	HGGSFTLP	77.01
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	298	467	337	349	13	GSQPFAPVFFQSD	78.42
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	298	467	386	410	25	SEATTVLGDVHSPAVEGFVGENISG	76.84
DP00122	P15146	Microtubule-associated protein 2 (MAP-2)	Rattus norvegicus (Rat)	298	467	441	454	14	KLEETSKVSIEETV	75.97
DP00123	P01730	T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4)	Homo sapiens (Human)	398	458	398	421	24	ALIVLGGVAGLLLFIGLGIFFCVR	83.4
DP00125	P63292	Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH)	Bos taurus (Bovine)	30	60	31	41	11	YADAIFTNSYR	81.06
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	403	414	12	GYKTFEEIQKEE	89.05
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	425	436	12	AVDEIKQEIKFT	80.16
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	439	448	10	SSVASTRNTL	74.25
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	457	463	7	AGMNTLG	73.91
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	470	480	11	EQLNNVEGNLD	74.58
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	499	513	15	LNRSILAVHVSNPFN	74.72
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	540	568	29	SQQLSQSTQRIEGAMNANNNISEVRERYQ	77.33
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	570	585	16	KNVLEKAKRYQFENDE	74.46
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	590	608	19	MELEIDRNLDQIQQVSNRL	81.83
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	610	616	7	KMALTTG	75.54
DP00128	P40357	Protein transport protein SEC9	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	401	651	625	645	21	RLNNIEESTDDLDINLHMNTN	76.25
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	9	21	13	ARVALLLLLVLGS	80.27
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	40	67	28	VDRVINVNAKNYKNVFKKYEVLALLYHE	80.84
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	81	106	26	MEELILELAAQVLEDKGVGFGLVDSE	80.06
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	114	160	47	KLGLTEEDSIYVFKEDEVIEYDGEFSADTLVEFLLDVLEDPVELIEG	82.04
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	163	209	47	ELQAFENIEDEIKLIGYFKNKDSEHYKAFKEAAEEFHPYIPFFATFD	83.35
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	216	237	22	LTLKLNEIDFYEAFMEEPVTIP	83.9
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	242	253	12	SEEEIVNFVEEH	84.36
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	266	272	7	MYETWED	82.61
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	275	286	12	DGIHIVAFAEEA	83.86
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	289	317	29	DGYEFLEILKSVAQDNTDNPDLSIIWIDP	78.06
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	322	355	34	LLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEM	76.8
DP00132	P07221	Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein)	Oryctolagus cuniculus (Rabbit)	1	395	364	383	20	AEELEDWLEDVLEGEINTED	80.27
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	12	18	7	GLECIRA	79.93
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	25	41	17	GSLAIEEAMAAWSEISD	76.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	64	72	9	CLSAIGSTE	81.94
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	99	115	17	NLQASSTGLQCYYVYDH	85.58
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	125	131	7	DADSIMV	79.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	161	167	7	EGYAITD	83.18
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	235	253	19	RLASFGTEIASLLTGGATQ	77.28
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	300	278	287	10	NAALIQEWTP	81.34
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	12	18	7	GLECIRA	79.93
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	25	41	17	GSLAIEEAMAAWSEISD	76.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	64	72	9	CLSAIGSTE	81.94
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	99	115	17	NLQASSTGLQCYYVYDH	85.58
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	125	131	7	DADSIMV	79.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	230	161	167	7	EGYAITD	83.18
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	12	18	7	GLECIRA	79.93
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	25	41	17	GSLAIEEAMAAWSEISD	76.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	64	72	9	CLSAIGSTE	81.94
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	99	115	17	NLQASSTGLQCYYVYDH	85.58
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	125	131	7	DADSIMV	79.84
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	229	161	167	7	EGYAITD	83.18
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	50	12	18	7	GLECIRA	79.93
DP00133	P03422	Phosphoprotein (Protein P)	Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)	1	50	25	41	17	GSLAIEEAMAAWSEISD	76.84
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	282	288	7	AEDVIQV	79.93
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	300	309	10	NGKLIQEIVD	91.84
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	314	325	12	VRVRIEAENEKN	75.5
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	356	366	11	LDIKENSTHFS	75.13
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	376	388	13	VLVASSVVAGESQ	85.62
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	281	422	397	417	21	GMVPFVFVGTKDSIANATVLL	82.18
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	457	465	9	KEKSYVTDD	77.26
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	493	504	12	NSEASNASETES	73.91
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	507	516	10	RDELSDWSLA	77.39
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	577	587	11	SLQIRVDCNNE	76.25
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	444	632	594	600	7	TLQNTSS	80.7
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	457	465	9	KEKSYVTDD	77.26
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	493	504	12	NSEASNASETES	73.91
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	507	516	10	RDELSDWSLA	77.39
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	577	587	11	SLQIRVDCNNE	76.25
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	445	632	594	600	7	TLQNTSS	80.7
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	516	632	577	587	11	SLQIRVDCNNE	76.25
DP00134	Q06787	Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1)	Homo sapiens (Human)	516	632	594	600	7	TLQNTSS	80.7
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	3	16	14	NAANTGTTNESNVS	75.44
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	31	45	15	DIEKILQPNDIFTTD	84.3
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	48	62	15	DASTTSSTAIEDIIN	80.18
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	76	83	8	SSSFFHDS	77.93
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	98	108	11	PLGIYQTNLYG	87.23
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	119	127	9	STLLSSKLL	75.92
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	167	142	148	7	QHAVYRA	79.79
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	260	332	268	274	7	LLEKIIR	80.98
DP00135	P10961	Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	260	332	304	327	24	GSNNSNNNISSSNSFFNNGHLLQG	78.62
DP00136	P15865	Histone H1.4 (H1d)	Rattus norvegicus (Rat)	31	119	40	52	13	VSELITKAVAASK	76.33
DP00136	P15865	Histone H1.4 (H1d)	Rattus norvegicus (Rat)	31	119	56	63	8	GVSLAALK	73.91
DP00136	P15865	Histone H1.4 (H1d)	Rattus norvegicus (Rat)	31	119	67	81	15	AAAGYDVEKNNSRIK	75.52
DP00138	P12272	Parathyroid hormone-related protein (PTH-rP) (PTHrP) (Parathyroid hormone-like protein) (PLP) Cleaved into: PTHrP1-36; PTHrP38-94; Osteostatin (PTHrP107-139)	Homo sapiens (Human)	68	144	68	76	9	HTAEIRATS	77.26
DP00138	P12272	Parathyroid hormone-related protein (PTH-rP) (PTHrP) (Parathyroid hormone-like protein) (PLP) Cleaved into: PTHrP1-36; PTHrP38-94; Osteostatin (PTHrP107-139)	Homo sapiens (Human)	68	144	99	115	17	DEGRYLTQETNKVETYK	79.26
DP00140	P0A7L8	50S ribosomal protein L27 (Large ribosomal subunit protein bL27)	Escherichia coli (strain K12)	1	85	28	38	11	GESVLAGSIIV	87.44
DP00140	P0A7L8	50S ribosomal protein L27 (Large ribosomal subunit protein bL27)	Escherichia coli (strain K12)	1	85	56	63	8	DHTLFAKA	75.92
DP00140	P0A7L8	50S ribosomal protein L27 (Large ribosomal subunit protein bL27)	Escherichia coli (strain K12)	1	85	65	71	7	GKVKFEV	80.27
DP00141	O95405	Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation)	Homo sapiens (Human)	663	751	676	682	7	GQFGISA	82.7
DP00141	O95405	Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation)	Homo sapiens (Human)	663	751	710	716	7	ARFTFTK	88.96
DP00141	O95405	Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation)	Homo sapiens (Human)	663	751	737	743	7	CKLLYMD	77.16
DP00145	P0A7S3	30S ribosomal protein S12 (Small ribosomal subunit protein uS12)	Escherichia coli (strain K12)	1	27	2	8	7	ATVNQLV	79.93
DP00146	P0A7T7	30S ribosomal protein S18 (Small ribosomal subunit protein bS18)	Escherichia coli (strain K12)	1	75	9	15	7	KFCRFTA	80.6
DP00146	P0A7T7	30S ribosomal protein S18 (Small ribosomal subunit protein bS18)	Escherichia coli (strain K12)	1	75	17	45	29	GVQEIDYKDIATLKNYITESGKIVPSRIT	77.6
DP00146	P0A7T7	30S ribosomal protein S18 (Small ribosomal subunit protein bS18)	Escherichia coli (strain K12)	1	75	55	70	16	LARAIKRARYLSLLPY	78.49
DP00148	P03347	Gag polyprotein (Pr55Gag) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Spacer peptide 2 (SP2) (p1); p6-gag	Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1)	378	432	389	396	8	MVKCFNCG	75.92
DP00151	P02547	Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein)	Sus scrofa (Pig)	444	549	448	460	13	QEEQIEVEETIEA	82.97
DP00151	P02547	Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein)	Sus scrofa (Pig)	444	549	497	512	16	AQEEEEAAEKEESEEA	74.25
DP00152	Q13426	DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4)	Homo sapiens (Human)	178	202	178	187	10	KRFILVLNEK	76.56
DP00152	Q13426	DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4)	Homo sapiens (Human)	203	265	213	221	9	GETAICSEM	77.59
DP00152	Q13426	DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4)	Homo sapiens (Human)	203	265	254	260	7	DDSIISS	93.65
DP00154	P29353	SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1)	Homo sapiens (Human)	127	151	130	144	15	GGEEWTRHGSFVNKP	75.25
DP00154	P29353	SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1)	Homo sapiens (Human)	127	149	130	144	15	GGEEWTRHGSFVNKP	75.25
DP00156	P54725	UV excision repair protein RAD23 homolog A (HR23A) (hHR23A)	Homo sapiens (Human)	283	316	290	296	7	ELADISD	73.91
DP00156	P54725	UV excision repair protein RAD23 homolog A (HR23A) (hHR23A)	Homo sapiens (Human)	283	316	300	311	12	EVGAIGEEAPQM	79.85
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	425	512	462	470	9	QTAEIVNVK	75.96
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	425	512	490	497	8	DTTVITGN	81.9
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	446	512	462	470	9	QTAEIVNVK	75.96
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	446	512	490	497	8	DTTVITGN	81.9
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	658	684	658	666	9	AGPAYESYL	83.61
DP00157	P0CL52	Cell invasion protein SipA (Effector protein SipA)	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)	658	684	671	679	9	VDRVITTVD	76.44
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	751	759	9	RDNVYYYDE	96.84
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	765	773	9	EDQDFDLSQ	73.58
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	808	818	11	EIGNFIDENLK	80.36
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	844	854	11	AASLSSLNSSE	76.53
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	732	884	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	751	759	9	RDNVYYYDE	96.84
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	765	773	9	EDQDFDLSQ	73.58
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	808	818	11	EIGNFIDENLK	80.36
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	844	854	11	AASLSSLNSSE	76.53
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	736	884	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	778	884	808	818	11	EIGNFIDENLK	80.36
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	778	884	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	778	884	844	854	11	AASLSSLNSSE	76.53
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	778	884	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	784	852	808	818	11	EIGNFIDENLK	80.36
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	784	852	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	812	884	829	839	11	YDSLLVFDYEG	85.01
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	812	884	844	854	11	AASLSSLNSSE	76.53
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	812	884	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00159	P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3	Mus musculus (Mouse)	855	881	857	872	16	QDQDYDYLNEWGNRFK	79.54
DP00162	O75324	Stannin (AG8_1)	Homo sapiens (Human)	34	59	37	43	7	RLQRISQ	76.49
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	8	30	23	KQELEVLESIYPDELRIINDEYP	88.12
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	34	68	35	FEVAIKLELDTGDSTSVLTKEHTIIAEFKLPENYP	79.03
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	70	89	20	EPCLISLEAQEVALNDNEED	79.08
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	106	153	48	VLKKFENLPDLISFKGYLPELTVQLESQIETDMLLGMQMCFALISSIK	78.76
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	156	175	20	CEQWYSEQLNKLEKQYELEA	84.88
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	192	210	19	TRESYLEWRSKFRQELKLD	76.18
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	227	233	7	GKQMFEQ	75.25
DP00163	Q03768	Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	265	238	244	7	TGDEYME	75.54
DP00164	P05318	60S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	106	3	34	32	TESALSYAALILADSEIEISSEKLLTLTNAAN	80.47
DP00164	P05318	60S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	106	36	48	13	PVENIWADIFAKA	85.75
DP00164	P05318	60S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	106	55	65	11	KDLLVNFSAGA	80.81
DP00166	P19429	Troponin I; cardiac muscle (Cardiac troponin I)	Homo sapiens (Human)	163	210	191	200	10	WRKNIDALSG	75.25
DP00168	Q9NVS9	"Pyridoxine-5-phosphate oxidase (EC 1.4.3.5) (Pyridoxamine-phosphate oxidase)"	Homo sapiens (Human)	1	48	1	13	13	MTCWLRGVTATFG	78.34
DP00173	O00273	DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD)	Homo sapiens (Human)	1	116	33	41	9	GVAASCLED	73.8
DP00173	O00273	DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD)	Homo sapiens (Human)	1	116	45	70	26	KACDILAIDKSLTPVTLVLAEDGTIV	83.88
DP00173	O00273	DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD)	Homo sapiens (Human)	1	116	72	100	29	DDDYFLCLPSNTKFVALASNEKWAYNNSD	81.49
DP00173	O00273	DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD)	Homo sapiens (Human)	1	116	102	111	10	GTAWISQESF	87.06
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	16	26	11	SGQAFELILSP	82.55
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	44	51	8	DLSLEEIQ	84.03
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	66	75	10	AEVLKQLAEK	76.25
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	83	102	20	LQKAIEENNNFSKMAEEKLT	76.87
DP00174	P16949	Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)	Homo sapiens (Human)	1	149	126	133	8	KDKHIEEV	75.25
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	130	15	23	9	NDELISFKD	81.23
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	130	42	60	19	ADVKSSLVNESETNQNSSS	78.52
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	130	102	109	8	GYPFIMIP	77.42
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	56	15	23	9	NDELISFKD	81.23
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	56	42	51	10	ADVKSSLVNE	80.8
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	53	15	23	9	NDELISFKD	81.23
DP00175	Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	Homo sapiens (Human)	1	53	42	48	7	ADVKSSL	81.22
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	68	7	16	10	KVSEIFQSSK	88.46
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	68	49	61	13	EKHNYQEQYNKLK	86.36
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	2	34	7	16	10	KVSEIFQSSK	88.46
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	2	32	7	16	10	KVSEIFQSSK	88.46
DP00179	P01094	Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	33	68	49	61	13	EKHNYQEQYNKLK	86.36
DP00180	P19972	Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain)	Millerozyma farinosa (Yeast) (Pichia farinosa)	146	222	146	154	9	GEATTIWGV	79
DP00180	P19972	Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain)	Millerozyma farinosa (Yeast) (Pichia farinosa)	146	222	169	180	12	DLQNMSADLAKN	75.25
DP00180	P19972	Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain)	Millerozyma farinosa (Yeast) (Pichia farinosa)	146	222	198	209	12	KDVYMIKFSLAG	83.97
DP00181	P08775	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit)	Mus musculus (Mouse)	1529	1959	1542	1550	9	GAAGFSPSA	77.26
DP00184	P11473	Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1)	Homo sapiens (Human)	16	125	32	40	9	TGFHFNAMT	78.82
DP00184	P11473	Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1)	Homo sapiens (Human)	16	125	54	69	16	RKALFTCPFNGDCRIT	78.2
DP00184	P11473	Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1)	Homo sapiens (Human)	16	125	83	97	15	RCVDIGMMKEFILTD	78.82
DP00184	P11473	Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1)	Homo sapiens (Human)	120	164	127	152	26	EQQRIIAILLDAHHKTYDPTYSDFCQ	79.39
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	3	10	8	SQQNQNRQ	79.93
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	14	20	7	QEQGYME	80.6
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	26	33	8	VVNAWEST	80.56
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	36	53	18	TLSSTAQAAAEKTAEFRD	74.93
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	69	76	8	KGQEFKER	77.26
DP00186	Q95V77	Late embryogenesis abundant protein 1 (Aavlea1)	Aphelenchus avenae (Mycophagous nematode worm)	1	143	109	115	7	KMEEYKQ	79.93
DP00187	P04273	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mesocricetus auratus (Golden hamster)	23	106	29	39	11	GGWNTGGSRYP	80.94
DP00187	P04273	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mesocricetus auratus (Golden hamster)	23	106	95	101	7	THNQWNK	74.25
DP00187	P04273	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mesocricetus auratus (Golden hamster)	90	126	95	101	7	THNQWNK	74.25
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	88	103	16	KRLTYDEIQSKTYLEV	77.42
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	125	138	14	KPGKYTAKKFCLEP	77.45
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	144	150	7	KAEGISK	75.92
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	155	161	7	DFQNTKL	79.93
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	163	174	12	TRLTYTLDEIEG	77.15
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	176	187	12	FEVSSDGTVKFE	80.77
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	194	200	7	YAAVTVQ	75.54
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	207	220	14	VPFLFTIKQLVASG	86.5
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	253	259	7	NAVALPA	79.93
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	274	290	17	KNVASSKGTITLSVTSS	76.73
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	294	306	13	TGEVIGVFQSLQP	80.7
DP00188	P12359	Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit)	Spinacia oleracea (Spinach)	85	332	317	327	11	KDVKIEGVWYA	85.25
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	62	74	13	PGITIISASQTGN	78.83
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	87	118	32	LAAKLNVKLVNAGDYKFKQIASEKLLIVVTST	78.07
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	130	138	9	ALHKFLFSK	80.16
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	142	165	24	KLENTAFAVFSLGDSSYEFFCQSG	79.7
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	168	176	9	FDSKLAELG	74.25
DP00190	P38038	Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2)	Escherichia coli (strain K12)	52	224	186	199	14	ADVEYQAAASEWRA	88.8
DP00192	P02668	Kappa-casein Cleaved into: Casoxin-C; Casoxin-6; Casoxin-A; Casoxin-B; Casoplatelin	Bos taurus (Bovine)	1	21	1	16	16	MMKSFFLVVTILALTL	79.95
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	2	22	21	KCLLLALALTCGAQALIVTQT	82
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	31	49	19	VAGTWYSLAMAASDISLLD	80.2
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	54	63	10	PLRVYVEELK	79.2
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	68	79	12	GDLEILLQKWEN	81.1
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	83	91	9	AQKKIIAEK	79.45
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	96	127	32	AVFKIDALNENKVLVLDTDYKKYLLFCMENSA	80.88
DP00193	P02754	Beta-lactoglobulin (Beta-LG) (allergen Bos d 5)	Bos taurus (Bovine)	1	178	162	173	12	HIRLSFNPTQLE	78.12
DP00194	P0AFZ3	Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB)	Escherichia coli (strain K12)	111	165	112	118	7	EDTSIMN	74.1
DP00194	P0AFZ3	Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB)	Escherichia coli (strain K12)	111	165	124	135	12	ADNETVMSVIDG	83.58
DP00194	P0AFZ3	Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB)	Escherichia coli (strain K12)	118	165	124	135	12	ADNETVMSVIDG	83.58
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	153	165	13	MDAALDDLIDTLG	82.69
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	171	179	9	EEENTTYTG	76.59
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	186	195	10	MSSTYIEELG	77.26
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	232	242	11	IDALSSDFTCG	78.93
DP00196	P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	Homo sapiens (Human)	137	277	257	271	15	TEVLKAQSAGTVRSA	75.59
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	28	60	30	55	26	KLCYLLDGILFIYGVILTALFLRVKF	84.69
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	52	164	67	86	20	GQNQLYNELNLGRREEYDVL	78.13
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	52	164	107	115	9	QEGLYNELQ	81.57
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	52	164	119	127	9	MAEAYSEIG	89.07
DP00200	P20963	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	Homo sapiens (Human)	52	164	138	159	22	HDGLYQGLSTATKDTYDALHMQ	80.42
DP00201	P02721	ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)	Bos taurus (Bovine)	33	108	39	51	13	VQKLFVDKIREYR	85.18
DP00201	P02721	ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)	Bos taurus (Bovine)	33	108	63	83	21	AGPEYQQDLDRELFKLKQMYG	75.16
DP00201	P02721	ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)	Bos taurus (Bovine)	33	108	85	97	13	ADMNTFPNFTFED	77.57
DP00201	P02721	ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)	Bos taurus (Bovine)	84	108	85	97	13	ADMNTFPNFTFED	77.57
DP00205	Q82S91	Metal-binding protein SmbP	Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)	1	117	2	29	28	KTTLIKVIAASVTALFLSMQVYASGHTA	81.09
DP00205	Q82S91	Metal-binding protein SmbP	Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)	1	117	50	57	8	TDQLLEHA	80.27
DP00205	Q82S91	Metal-binding protein SmbP	Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)	1	117	102	110	9	AQEAIEHLR	94.31
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	528	535	8	ALATFAMP	93.31
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	570	585	16	LLSRFFGALKALFSGG	77.38
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	646	653	8	AQQQTAET	77.26
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	657	665	9	RQQAEVTEK	76.37
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	697	709	13	LNVEEQSVQETEQ	74.84
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	727	760	34	QKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPA	77.58
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	779	786	8	EQQEENNA	76.25
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	828	835	8	LTVACASP	73.91
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	840	849	10	GKVWIRYPIV	81.37
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	876	882	7	VAAAIEP	76.25
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	908	946	39	EVVETTHPEVIAAAVTEQPQVITESDVAVAQEVAEQAEP	77.45
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	955	971	17	ADIEEVVETAEVVVAEP	77.65
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	980	1008	29	PVVAEVAAEVETVAAVEPEVTVEHNHATA	79.17
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	498	1061	1031	1037	7	PTFAFEG	77.74
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	646	653	8	AQQQTAET	77.26
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	657	665	9	RQQAEVTEK	76.37
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	697	709	13	LNVEEQSVQETEQ	74.84
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	727	760	34	QKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPA	77.58
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	779	786	8	EQQEENNA	76.25
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	603	850	828	835	8	LTVACASP	73.91
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	646	653	8	AQQQTAET	77.26
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	657	665	9	RQQAEVTEK	76.37
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	697	709	13	LNVEEQSVQETEQ	74.84
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	727	760	34	QKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPA	77.58
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	779	786	8	EQQEENNA	76.25
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	628	843	828	835	8	LTVACASP	73.91
DP00207	P21513	Ribonuclease E (RNase E) (EC 3.1.26.12)	Escherichia coli (strain K12)	816	850	828	835	8	LTVACASP	73.91
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	2	19	18	RIAVICFCLLGITCAIPV	79.52
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	29	46	18	EKQLYNKYPDAVATWLNP	84.17
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	59	75	17	NAVSSEETNDFKQETLP	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	99	108	10	SQDSIDSNDS	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	142	149	8	ATEVFTPV	80.77
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	161	169	9	DSVVYGLRS	77.41
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	185	191	7	TDEDITS	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	198	206	9	LNGAYKAIP	80.04
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	222	229	8	KDSYETSQ	74.75
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	258	268	11	SDVIDSQELSK	75.25
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	1	314	296	309	14	KHLKFRISHELDSA	78.02
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	29	46	18	EKQLYNKYPDAVATWLNP	84.17
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	59	75	17	NAVSSEETNDFKQETLP	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	99	108	10	SQDSIDSNDS	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	142	149	8	ATEVFTPV	80.77
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	161	169	9	DSVVYGLRS	77.41
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	185	191	7	TDEDITS	75.92
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	198	206	9	LNGAYKAIP	80.04
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	222	229	8	KDSYETSQ	74.75
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	258	268	11	SDVIDSQELSK	75.25
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	17	314	296	309	14	KHLKFRISHELDSA	78.02
DP00214	P10451	Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin)	Homo sapiens (Human)	85	116	99	108	10	SQDSIDSNDS	75.92
DP00217	P05221	Nucleoplasmin	Xenopus laevis (African clawed frog)	120	200	120	131	12	MEEDYSWAEEED	76.14
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	14	23	10	LKRWIGSETD	79.93
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	34	61	28	TKVKFDDGAVFLAACSSGDTEEVLRLLE	78.94
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	64	84	21	ADINYANVDGLTALHQACIDD	80.75
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	87	101	15	DMVKFLVENGANINQ	79.84
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	104	110	7	NEGWIPL	87.96
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	114	139	26	ASCGYLDIAEYLISQGAHVGAVNSEG	82.33
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	150	168	19	AMEELLQNEVNRQGVDIEA	77.7
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	181	196	16	ARQWLNSGHINDVRHA	82.69
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	212	235	24	TEVLKLLIQARYDVNIKDYDGWTP	83.26
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	246	257	12	EACRILVENLCD	78.99
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	259	284	26	EAVNKVGQTAFDVADEDILGYLEELQ	79.17
DP00218	Q90623	Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit)	Gallus gallus (Chicken)	1	299	286	293	8	KQNLLHSE	74.92
DP00219	O60927	E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3)	Homo sapiens (Human)	1	126	5	22	18	GAGLSETVTETTVTVTTE	78.3
DP00219	O60927	E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3)	Homo sapiens (Human)	1	126	39	46	8	KKVEWTSD	80.02
DP00219	O60927	E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3)	Homo sapiens (Human)	1	126	59	65	7	KCCCIYE	86.29
DP00219	O60927	E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3)	Homo sapiens (Human)	1	126	69	76	8	AFGESSTE	76.25
DP00220	P17810	Peripherin-2 (Retinal degeneration slow protein)	Bos taurus (Bovine)	284	346	284	292	9	RYLHTALEG	75.25
DP00220	P17810	Peripherin-2 (Retinal degeneration slow protein)	Bos taurus (Bovine)	284	346	303	323	21	SEGWLLEKSVPETWKAFLESV	79.44
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	2	12	11	SQQHTLPVTLS	76.35
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	16	23	8	SQELLKTV	75.5
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	83	103	21	QEQELQQQHWEQHEEYQKAEN	79.31
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	149	156	8	KEQLLELP	79.68
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	241	248	8	GQLELSEQ	78.22
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	251	258	8	GQLELSEQ	78.22
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	281	288	8	GQLKYLEQ	94.31
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	333	339	7	LEQLEEQ	76.92
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	367	376	10	EQQVLQLKQL	81.57
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	487	493	7	EAQLELP	75.54
DP00221	P07476	Involucrin	Homo sapiens (Human)	1	585	563	569	7	GEVLLPV	80.27
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	6	20	15	ADAQIQRETYDSNES	80.91
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	63	73	11	QASSFSFLNRA	79.81
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	94	103	10	KALNLQFKAK	75.12
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	119	140	22	LFTRYELYIKNILEAPVKSIEN	79.52
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	174	180	7	PKFTIDA	76.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	185	192	8	SDSVFSFG	86.33
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	214	230	17	PEFKFSGTVSSDVFKLN	79.78
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	245	257	13	KPFSFSSATSTTE	74.38
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	275	288	14	VDNNSKAEASFTFG	83.33
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	300	306	7	PSFVFGQ	77.07
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	315	326	12	KSSFTFGSTTIE	81.13
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	329	338	10	NDENSTSNSK	79.93
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	350	358	9	PSFSFSIPS	79.78
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	383	390	8	KPVFSFGA	75.84
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	414	423	10	PAFNLISNAG	82.07
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	436	446	11	PAFSFGISNGS	81.7
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	472	484	13	PAFSFGINTNTTK	79.73
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	489	506	18	KAPTFTFGSSALADNKED	75.75
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	509	517	9	KPFSFGTSQ	76.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	548	557	10	TGFKFSLPFE	76.45
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	560	582	23	GSQTTTNDSKEESTTEATGNESQ	74.55
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	605	613	9	DEVALFSQK	81.46
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	615	627	13	KLMTFNAETKSYD	81.71
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	656	671	16	GNVLLNATVVDSFKYE	82.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	720	688	700	13	ADGKLVTYIVKFK	88.53
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	185	192	8	SDSVFSFG	86.33
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	214	230	17	PEFKFSGTVSSDVFKLN	79.78
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	245	257	13	KPFSFSSATSTTE	74.38
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	275	288	14	VDNNSKAEASFTFG	83.33
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	300	306	7	PSFVFGQ	77.07
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	315	326	12	KSSFTFGSTTIE	81.13
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	329	338	10	NDENSTSNSK	79.93
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	350	358	9	PSFSFSIPS	79.78
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	383	390	8	KPVFSFGA	75.84
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	414	423	10	PAFNLISNAG	82.07
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	436	446	11	PAFSFGISNGS	81.7
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	472	484	13	PAFSFGINTNTTK	79.73
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	489	506	18	KAPTFTFGSSALADNKED	75.75
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	185	527	509	517	9	KPFSFGTSQ	76.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	562	720	605	613	9	DEVALFSQK	81.46
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	562	720	615	627	13	KLMTFNAETKSYD	81.71
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	562	720	656	671	16	GNVLLNATVVDSFKYE	82.25
DP00222	P32499	Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	562	720	688	700	13	ADGKLVTYIVKFK	88.53
DP00223	P14635	G2/mitotic-specific cyclin-B1	Homo sapiens (Human)	1	78	7	22	16	RNSKINAENKAKINMA	80.06
DP00223	P14635	G2/mitotic-specific cyclin-B1	Homo sapiens (Human)	1	78	44	52	9	ALGDIGNKV	75.25
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	329	343	15	DIFATASAAAPVSSA	86.62
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	373	392	20	GATAWGDLLGEDSLAALSSV	76.51
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	417	444	28	SASASATTAVTAATTEVDLFGDAFAASP	75.37
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	463	469	7	VAAALDA	75.59
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	488	495	8	ELDLFAMK	75.38
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	525	553	29	AVAATAATTTAAAAATTTATTSAAAATTA	76.48
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	558	569	12	ALDIFGDLFDSA	81.94
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	583	592	10	SIDLFGTDAF	79.63
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	604	614	11	ESSLTADLLSG	77.38
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	625	640	16	HVPLFFTAVDAFAAPS	83.55
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	652	671	20	SSGVIDLFGDAFGSSASETQ	79.33
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	675	696	22	QAVSSSSASADLLAGFGGSFMA	77.41
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	705	722	18	AQNNLLQPNFEAAFGTTP	78.21
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	769	786	18	LDSSLASLVGNLGISGTT	75.68
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	790	797	8	GDLQWNAG	79.56
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	896	803	809	7	GGANWQP	80.94
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	329	343	15	DIFATASAAAPVSSA	86.62
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	373	392	20	GATAWGDLLGEDSLAALSSV	76.51
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	417	444	28	SASASATTAVTAATTEVDLFGDAFAASP	75.37
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	463	469	7	VAAALDA	75.59
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	488	495	8	ELDLFAMK	75.38
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	525	553	29	AVAATAATTTAAAAATTTATTSAAAATTA	76.48
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	558	569	12	ALDIFGDLFDSA	81.94
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	583	592	10	SIDLFGTDAF	79.63
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	604	614	11	ESSLTADLLSG	77.38
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	625	640	16	HVPLFFTAVDAFAAPS	83.55
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	652	671	20	SSGVIDLFGDAFGSSASETQ	79.33
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	675	696	22	QAVSSSSASADLLAGFGGSFMA	77.41
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	328	745	705	722	18	AQNNLLQPNFEAAFGTTP	78.21
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	745	896	769	786	18	LDSSLASLVGNLGISGTT	75.68
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	745	896	790	797	8	GDLQWNAG	79.56
DP00225	Q05140	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180)	Rattus norvegicus (Rat)	745	896	803	809	7	GGANWQP	80.94
DP00226	Q9CXW3	Calcyclin-binding protein (CacyBP) (Siah-interacting protein)	Mus musculus (Mouse)	178	229	195	202	8	VLKKIYED	77.63
DP00226	Q9CXW3	Calcyclin-binding protein (CacyBP) (Siah-interacting protein)	Mus musculus (Mouse)	178	229	207	219	13	MKRTINKAWVESR	77
DP00229	P05455	Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B)	Homo sapiens (Human)	326	408	353	359	7	GKVQFQG	79.26
DP00229	P05455	Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B)	Homo sapiens (Human)	326	408	397	403	7	KQQKTEN	73.91
DP00230	Q14449	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Homo sapiens (Human)	361	435	361	367	7	SSQSISP	75.97
DP00230	Q14449	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Homo sapiens (Human)	361	435	375	382	8	SLVAMDFS	75.92
DP00230	Q14449	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Homo sapiens (Human)	361	435	386	408	23	SRVIENPTEALSVAVEEGLAWRK	77.5
DP00231	P14859	POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1)	Homo sapiens (Human)	1	200	35	50	16	VGGAISTAQAQAFLGH	79.18
DP00231	P14859	POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1)	Homo sapiens (Human)	1	200	52	75	24	HQVQLAGTSLQAAAQSLNVQSKSN	79.95
DP00231	P14859	POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1)	Homo sapiens (Human)	1	200	93	157	65	VQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASA	78.89
DP00231	P14859	POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1)	Homo sapiens (Human)	1	200	176	195	20	LQQLQQLQQQNLNLQQFVLV	77.76
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	248	256	9	AMSAFNNIK	93.65
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	258	264	7	MQVVLER	80.03
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	282	289	8	TGKLITSS	76.13
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	349	357	9	EGSTYHFSG	81.46
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	370	384	15	DLESFFTHDSVSTSS	78.97
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	440	451	12	KTVLTSSSSSFN	79.1
DP00233	P14448	Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain	Gallus gallus (Chicken)	238	504	453	461	9	GGSTFETKS	83.95
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	144	156	13	HGSKYLATASTMD	81.04
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	171	180	10	ILDSIGRFFG	76.52
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	219	228	10	PVVHFFKNIV	86.76
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	242	252	11	GLSLSRFSWGA	76.28
DP00236	P02686	Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)	Homo sapiens (Human)	134	304	280	291	12	AQGTLSKIFKLG	79.68
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	100	108	9	EYANSYNFA	88.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	120	134	15	DEVSIIQSMGYRNRA	91.66
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	146	165	20	SLQETSLSVQLSNLGTVRTL	79.15
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	175	184	10	KTSVYIELGS	78.73
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	192	209	18	NKATYCSVGDQELLQITP	80.1
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	213	220	8	RDEISLDS	76.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	224	237	14	AACEFSETDVTNTE	76.09
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	244	250	7	NDLNTTE	82.61
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	257	271	15	HPEKYQGSSVSNLHV	75.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	282	294	13	SLQHENSSLLLTK	76.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	369	394	26	DVPWITLNSSIQKVNEWFSRSDELLG	79.57
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	410	435	26	ADVLDVLNEVDEYSGSSEKIDLLASD	77.73
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	437	445	9	HEALICKSE	91.64
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	450	466	17	KSVESNIEDKIFGKTYR	79.87
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	475	494	20	SHVTENLIIGAFVTEPQIIQ	82.31
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	544	552	9	QVMNITNSG	85.62
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	559	567	9	GDSIQNEKN	76.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	576	604	29	KESAFKTKAEPISSSISNMELELNIHNSK	77.51
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	621	632	12	HALELVVSRNLS	76.56
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	637	643	7	TELQIDS	80.27
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	646	656	11	SSEEIKKKKYN	75.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	665	671	7	NLQLMEG	77.26
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	711	725	15	KCSNTSELKEFVNPS	76.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	765	772	8	ESSSISLV	74.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	779	792	14	TQESISLLEVSTLG	79.53
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	804	812	9	QCAAFENPK	85.95
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	852	862	11	LDAQYLQNTFK	86.11
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	865	874	10	KRQSFAPFSN	76.45
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	880	889	10	EECATFSAHS	82.71
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	897	905	9	PKVTFECEQ	74.58
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	921	927	7	QTVNITA	86.96
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	948	959	12	GGSRFCLSSQFR	78.6
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	962	969	8	ETGLITPN	85.28
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	997	1008	12	NLLEENFEEHSM	88.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1015	1062	48	GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIG	82.01
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1064	1073	10	SDENIQAELG	83.78
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1109	1135	27	KKQEYEEVVQTVNTDFSPYLISDNLEQ	77.62
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1155	1181	27	DDGEIKEDTSFAENDIKESSAVFSKSV	77.37
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1198	1204	7	LAQGYRR	75.92
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1212	1220	9	SEENLSSED	75.36
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1225	1238	14	CFQHLLFGKVNNIP	85.98
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1245	1254	10	STVATECLSK	76.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1256	1267	12	TEENLLSLKNSL	75.64
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1271	1279	9	SNQVILAKA	94.02
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1292	1320	29	SASLFSSQCSELEDLTANTNTQDPFLIGS	80.15
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1326	1337	12	HQSESQGVGLSD	75.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1361	1371	11	MDSNLGEAASG	77.26
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1387	1395	9	SQSDILTTQ	78.15
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1400	1420	21	MQHNLIKLQQEMAELEAVLEQ	78.79
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1452	1466	15	KAVLTSQKSSEYPIS	77.61
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1476	1486	11	KFEVSADSSTS	75.55
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1505	1513	9	DDRWYMHSC	91.97
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1516	1543	28	SLQNRNYPSQEELIKVVDVEEQQLEESG	79.57
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1545	1554	10	HDLTETSYLP	78.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1564	1573	10	LESGISLFSD	91.3
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	100	1649	1615	1632	18	AAAHTTDTAGYNAMEESV	75.03
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	175	184	10	KTSVYIELGS	78.73
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	192	209	18	NKATYCSVGDQELLQITP	80.1
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	213	220	8	RDEISLDS	76.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	224	237	14	AACEFSETDVTNTE	76.09
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	244	250	7	NDLNTTE	82.61
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	257	271	15	HPEKYQGSSVSNLHV	75.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	175	303	282	294	13	SLQHENSSLLLTK	76.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	224	237	14	AACEFSETDVTNTE	76.09
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	244	250	7	NDLNTTE	82.61
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	257	271	15	HPEKYQGSSVSNLHV	75.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	282	294	13	SLQHENSSLLLTK	76.59
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	369	394	26	DVPWITLNSSIQKVNEWFSRSDELLG	79.57
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	410	435	26	ADVLDVLNEVDEYSGSSEKIDLLASD	77.73
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	437	445	9	HEALICKSE	91.64
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	450	466	17	KSVESNIEDKIFGKTYR	79.87
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	219	498	475	493	19	SHVTENLIIGAFVTEPQII	82.24
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	304	394	369	389	21	DVPWITLNSSIQKVNEWFSRS	80.44
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	433	511	437	445	9	HEALICKSE	91.64
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	433	511	450	466	17	KSVESNIEDKIFGKTYR	79.87
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	433	511	475	494	20	SHVTENLIIGAFVTEPQIIQ	82.31
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	544	552	9	QVMNITNSG	85.62
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	559	567	9	GDSIQNEKN	76.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	576	604	29	KESAFKTKAEPISSSISNMELELNIHNSK	77.51
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	621	632	12	HALELVVSRNLS	76.56
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	637	643	7	TELQIDS	80.27
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	498	663	646	656	11	SSEEIKKKKYN	75.25
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	765	772	8	ESSSISLV	74.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	779	792	14	TQESISLLEVSTLG	79.53
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	804	812	9	QCAAFENPK	85.95
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	852	862	11	LDAQYLQNTFK	86.11
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	865	874	10	KRQSFAPFSN	76.45
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	880	889	10	EECATFSAHS	82.71
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	897	905	9	PKVTFECEQ	74.58
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	921	927	7	QTVNITA	86.96
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	948	959	12	GGSRFCLSSQFR	78.6
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	962	969	8	ETGLITPN	85.28
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	997	1008	12	NLLEENFEEHSM	88.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	1015	1062	48	GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIG	82.01
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	740	1083	1064	1073	10	SDENIQAELG	83.78
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	765	772	8	ESSSISLV	74.33
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	779	792	14	TQESISLLEVSTLG	79.53
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	804	812	9	QCAAFENPK	85.95
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	852	862	11	LDAQYLQNTFK	86.11
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	865	874	10	KRQSFAPFSN	76.45
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	880	889	10	EECATFSAHS	82.71
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	897	905	9	PKVTFECEQ	74.58
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	921	927	7	QTVNITA	86.96
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	948	959	12	GGSRFCLSSQFR	78.6
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	962	969	8	ETGLITPN	85.28
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	997	1008	12	NLLEENFEEHSM	88.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	758	1064	1015	1059	45	GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSIN	81.66
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	936	1057	948	959	12	GGSRFCLSSQFR	78.6
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	936	1057	962	969	8	ETGLITPN	85.28
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	936	1057	997	1008	12	NLLEENFEEHSM	88.29
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	936	1057	1015	1052	38	GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTN	81.01
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	1343	1440	1361	1371	11	MDSNLGEAASG	77.26
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	1343	1440	1387	1395	9	SQSDILTTQ	78.15
DP00238	P38398	Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)	Homo sapiens (Human)	1343	1440	1400	1420	21	MQHNLIKLQQEMAELEAVLEQ	78.79
DP00239	P31896	Carbon monoxide dehydrogenase (CODH) (EC 1.2.7.4)	Rhodospirillum rubrum	1	27	13	22	10	ACATEMLNLA	76.29
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	444	451	8	KTRWLNSG	75.25
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	485	495	11	VPNLFVPLNTN	79.26
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	507	517	11	REQNLQDIKTA	75.62
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	534	560	27	VQGELVTASKAIIEKEYQPHVIVSTTG	77.12
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	562	569	8	NPFTTLTD	75.25
DP00240	P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	Homo sapiens (Human)	430	737	632	638	7	SDAATFK	79.69
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	430	446	17	KTRWLNTPNTYLRVNVA	79.15
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	481	491	11	NPNQFVPLYTD	79.96
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	493	503	11	QEVLEMRNKIR	85.95
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	516	527	12	QSQLLASVIAEK	76.95
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	557	569	13	FSQLTDQELEEYK	77.98
DP00241	P35612	Beta-adducin (Erythrocyte adducin subunit beta)	Homo sapiens (Human)	409	726	657	664	8	TAEEILSK	83.32
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	1	83	17	39	23	MEKSIVVAIERFVKHPIYGKFIK	81.82
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	1	83	51	63	13	NECGIGDVVEIRE	81.61
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	1	83	70	76	7	TKSWTLV	79.31
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	4	83	17	39	23	MEKSIVVAIERFVKHPIYGKFIK	81.82
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	4	83	51	63	13	NECGIGDVVEIRE	81.61
DP00242	P0AG63	30S ribosomal protein S17 (Small ribosomal subunit protein uS17)	Escherichia coli (strain K12)	4	83	70	76	7	TKSWTLV	79.31
DP00245	P00514	cAMP-dependent protein kinase type I-alpha regulatory subunit Cleaved into: cAMP-dependent protein kinase type I-alpha regulatory subunit; N-terminally processed	Bos taurus (Bovine)	91	112	95	107	13	RRGAISAEVYTEE	83.77
DP00249	P63315	Troponin C; slow skeletal and cardiac muscles (TN-C)	Bos taurus (Bovine)	103	161	108	130	23	ADGYIDLEELKIMLQATGETITE	87.06
DP00249	P63315	Troponin C; slow skeletal and cardiac muscles (TN-C)	Bos taurus (Bovine)	103	161	144	156	13	NDGRIDYDEFLEF	83.41
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	44	50	7	GQSEYFD	88.87
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	53	61	9	TQMNINLYD	95.62
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	66	86	21	TQTGFVRHDDGYVSTSISLRS	75.71
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	90	122	33	VGQTILSGHSTYYIYVIATAPNMFNVNDVLGAY	82.39
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	135	160	26	GGIPYSQIYGWYRVHFGVLDEQLHRN	77.9
DP00250	P01555	Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	19	212	164	174	11	RDRYYSNLDIA	76.38
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	155	166	12	AQTATASSAAVG	77.26
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	173	179	7	AEQAWPQ	80.27
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	186	195	10	LQLQLALAMS	76.25
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	211	221	11	VQLQLALSLSR	77.32
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	238	246	9	LQMAIEESK	87.63
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	260	267	8	LADVFTTP	76.88
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	421	428	8	GELELLAG	79.43
DP00251	O88339	Epsin-1 (EPS-15-interacting protein 1)	Rattus norvegicus (Rat)	144	575	525	535	11	ATLTLNQLRLS	80.27
DP00252	P0A877	Tryptophan synthase alpha chain (EC 4.2.1.20)	Escherichia coli (strain K12)	54	74	63	69	7	TIQNATL	81.08
DP00253	P26645	Myristoylated alanine-rich C-kinase substrate (MARCKS)	Mus musculus (Mouse)	1	309	1	9	9	MGAQFSKTA	78.6
DP00253	P26645	Myristoylated alanine-rich C-kinase substrate (MARCKS)	Mus musculus (Mouse)	1	309	88	94	7	AAAATEP	76.92
DP00253	P26645	Myristoylated alanine-rich C-kinase substrate (MARCKS)	Mus musculus (Mouse)	1	309	118	128	11	AEGASASSTSS	76.71
DP00253	P26645	Myristoylated alanine-rich C-kinase substrate (MARCKS)	Mus musculus (Mouse)	1	309	158	166	9	KLSGFSFKK	79.12
DP00256	P40316	Securin	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	110	8	24	17	KENNIVYTGNESSGINF	88.53
DP00256	P40316	Securin	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	110	51	65	15	RDANSNNGNTLKYIQ	81.54
DP00256	P40316	Securin	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	110	96	104	9	SKSFIFPET	87.7
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	167	3	41	39	LNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQ	83.83
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	167	89	107	19	GGGSFSTADQLEMVTELLG	77.59
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	167	120	154	35	DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQA	78.4
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	143	3	41	39	LNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQ	83.83
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	143	89	107	19	GGGSFSTADQLEMVTELLG	77.59
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	143	120	138	19	DDETFIKNIIIQDCMWSGF	79.65
DP00260	P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	Homo sapiens (Human)	1	88	3	41	39	LNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQ	83.83
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	404	437	34	AGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLP	78.82
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	442	451	10	KLQNINLAMS	79.53
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	472	479	8	QEVALKLE	77.26
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	484	491	8	SLELSFTM	80.98
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	515	543	29	SPSEYCFYVDSDMVNEFKLELVEKLFAED	79.23
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	403	603	571	582	12	DFQLRSFDQLSP	75.59
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	535	543	9	LVEKLFAED	80.9
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	571	582	12	DFQLRSFDQLSP	75.59
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	598	609	12	TVTVFQQTQIQE	76.81
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	611	627	17	TANATTTTATTDELKTV	74.11
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	633	642	10	EDIKILIASP	78.6
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	651	657	7	TTSATSS	74.25
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	530	698	673	682	10	GKGVIEQTEK	79.33
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	776	826	792	807	16	LPQLTSYDCEVNAPIQ	79.18
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	776	826	815	821	7	GEELLRA	73.91
DP00262	Q16665	Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)	Homo sapiens (Human)	776	813	792	807	16	LPQLTSYDCEVNAPIQ	79.18
DP00265	P04925	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mus musculus (Mouse)	23	120	29	39	11	GGWNTGGSRYP	80.94
DP00265	P04925	Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Mus musculus (Mouse)	23	120	94	100	7	THNQWNK	74.25
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1365	1374	10	IRETIINYED	83.31
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1386	1401	16	LNVLRTQPFYEEKLYK	78.09
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1418	1425	8	DIADFLGD	78.26
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1441	1462	22	DVRHYAYEGDGNSDGSLSSLAS	76.39
DP00269	Q24298	DE-cadherin (Protein shotgun)	Drosophila melanogaster (Fruit fly)	1350	1507	1467	1478	12	GDLNFDYLSNFG	89.91
DP00271	P02699	Rhodopsin	Bos taurus (Bovine)	327	348	332	343	12	EASTTVSKTETS	76.25
DP00278	P08050	Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein)	Rattus norvegicus (Rat)	255	316	263	271	9	PKYAYFNGC	83.5
DP00278	P08050	Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein)	Rattus norvegicus (Rat)	255	316	297	311	15	SCRNYNKQASEQNWA	86.47
DP00282	Q04656	Copper-transporting ATPase 1 (EC 7.2.2.8) (Copper pump 1) (Menkes disease-associated protein)	Homo sapiens (Human)	1125	1176	1131	1171	41	HKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISN	79.34
DP00284	P16009	Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C	Enterobacteria phage T4 (Bacteriophage T4)	129	179	136	155	20	GEVGYDSSSNVIQDSNLDTA	82.06
DP00284	P16009	Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C	Enterobacteria phage T4 (Bacteriophage T4)	339	389	347	361	15	ARSLSAMAATVAKSS	78.04
DP00284	P16009	Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C	Enterobacteria phage T4 (Bacteriophage T4)	339	389	370	384	15	NDSRILFKEPVSSYK	80.25
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	164	170	7	GQPRYYP	75.25
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	201	208	8	QPGYYPTS	77.26
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	264	278	15	GQQLGQGQQGYYPTS	84.97
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	286	308	23	QPGYYPTSLQQLGQGQSGYYPTS	78.42
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	358	365	8	QPGYYPTS	77.26
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	373	380	8	QPGYYPTS	77.26
DP00285	P10388	Glutenin; high molecular weight subunit DX5	Triticum aestivum (Wheat)	147	440	418	425	8	QPGYYPTS	77.26
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	1	59	4	13	10	RAENWDEAEV	77.99
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	1	59	18	24	7	AGVEEYG	86.14
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	71	80	10	PSQVIFCNRS	77.49
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	85	93	9	LPVWLNFDG	88.37
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	114	120	7	GHLWLFR	95.37
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	125	140	16	HDGLLVNQTELFVPSL	86.41
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	144	158	15	GQPIFANITLPVYTL	83.77
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	54	213	163	187	25	LQVVRSLVKPENYRRLDIVRSLYED	78.93
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	67	117	71	80	10	PSQVIFCNRS	77.49
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	67	117	85	93	9	LPVWLNFDG	88.37
DP00287	P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	Homo sapiens (Human)	153	184	163	179	17	LQVVRSLVKPENYRRLD	75.78
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	73	1	22	22	MQSINFRTARGNLSEVLNNVEA	79.9
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	73	24	30	7	EEVEITR	90.64
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	73	34	48	15	EPAVIVSKATFEAYK	81.74
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	73	52	64	13	LDAEFASLFDTLD	89.89
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	58	1	22	22	MQSINFRTARGNLSEVLNNVEA	79.9
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	58	24	30	7	EEVEITR	90.64
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	58	34	48	15	EPAVIVSKATFEAYK	81.74
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	57	1	22	22	MQSINFRTARGNLSEVLNNVEA	79.9
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	57	24	30	7	EEVEITR	90.64
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	1	57	34	48	15	EPAVIVSKATFEAYK	81.74
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	41	73	52	64	13	LDAEFASLFDTLD	89.89
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	51	73	52	64	13	LDAEFASLFDTLD	89.89
DP00288	Q06253	Antitoxin phd (Addiction protein pdh) (Prevent host death protein)	Escherichia phage P1 (Bacteriophage P1)	52	73	52	64	13	LDAEFASLFDTLD	89.89
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	66	72	7	ELELSTV	75.39
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	79	89	11	LDQLQAQTKFT	80.45
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	113	139	27	TFKLIYSQFFPQGDATTYAHFLFNAFD	86.52
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	142	196	55	GNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGCITKEEMLAIMKSIYD	84.37
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	214	223	10	HVERFFQKMD	82.98
DP00291	Q9QXT8	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	Mus musculus (Mouse)	65	256	228	251	24	GVVTIDEFLETCQKDENIMNSMQL	81.27
DP00298	Q07817	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Homo sapiens (Human)	28	80	28	35	8	SDVEENRT	79.93
DP00298	Q07817	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Homo sapiens (Human)	28	80	47	60	14	TPSAINGNPSWHLA	84.95
DP00298	Q07817	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Homo sapiens (Human)	71	119	77	92	16	AREVIPMAAVKQALRE	74.77
DP00298	Q07817	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Homo sapiens (Human)	71	119	94	114	21	GDEFELRYRRAFSDLTSQLHI	79.18
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	4	18	15	SEGEWQLVLHVWAKV	77.7
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	25	35	11	HGQDILIRLFK	82.43
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	40	48	9	TLEKFDRFK	85.95
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	67	77	11	VTVLTALGAIL	89.84
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	100	117	18	IPIKYLEFISEAIIHVLH	79.9
DP00303	P02185	Myoglobin	Physeter macrocephalus (Sperm whale) (Physeter catodon)	1	153	128	140	13	AQGAMNKALELFR	84.05
DP00304	P31751	RAC-beta serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-2) (Protein kinase B beta) (PKB beta) (RAC-PK-beta)	Homo sapiens (Human)	441	481	458	466	9	SLGLLELDQ	76.89
DP00304	P31751	RAC-beta serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-2) (Protein kinase B beta) (PKB beta) (RAC-PK-beta)	Homo sapiens (Human)	442	480	458	466	9	SLGLLELDQ	76.89
DP00306	Q07108	Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)	Homo sapiens (Human)	1	84	3	14	12	SENCFVAENSSL	80.13
DP00306	Q07108	Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)	Homo sapiens (Human)	1	84	33	76	44	HEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPGQYTFSM	82.35
DP00307	P51946	Cyclin-H (MO15-associated protein) (p34) (p37)	Homo sapiens (Human)	288	323	310	316	7	EEEEWTD	77.59
DP00314	Q9UJY5	ADP-ribosylation factor-binding protein GGA1 (Gamma-adaptin-related protein 1) (Golgi-localized; gamma ear-containing; ARF-binding protein 1)	Homo sapiens (Human)	166	189	166	172	7	NVIFEDE	77.26
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	186	193	8	MASASSSQ	75.59
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	212	224	13	GNDNFGRGGNFSG	78.88
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	243	254	12	GYNGFGNDGGYG	75.92
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	270	292	23	GGQGYGNQGSGYGGSGSYDSYNN	76.34
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	186	320	302	315	14	SGSNFGGGGSYNDF	83.8
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	193	250	212	224	13	GNDNFGRGGNFSG	78.88
DP00324	P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed	Homo sapiens (Human)	257	305	270	292	23	GGQGYGNQGSGYGGSGSYDSYNN	76.34
DP00325	P01099	Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1)	Oryctolagus cuniculus (Rabbit)	1	166	9	15	7	KIQFTVP	86.96
DP00325	P01099	Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1)	Oryctolagus cuniculus (Rabbit)	1	166	37	44	8	ATLVLTSD	77.63
DP00328	Q08605	Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein)	Drosophila melanogaster (Fruit fly)	281	348	294	306	13	ATGEITPAQGATG	80.86
DP00328	Q08605	Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein)	Drosophila melanogaster (Fruit fly)	281	348	313	319	7	SGVLSTP	79.93
DP00328	Q08605	Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein)	Drosophila melanogaster (Fruit fly)	310	335	313	319	7	SGVLSTP	79.93
DP00328	Q08605	Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein)	Drosophila melanogaster (Fruit fly)	368	444	408	418	11	VQSLHTLQGVQ	75.92
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	1	75	75	MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVY	78.57
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	137	150	14	SQSLTLTDVENLHL	82.94
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	154	160	7	LLQSWMH	76.88
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	175	182	8	QSVLSLSQ	80.27
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	224	201	212	12	PIQAFLLYQEPV	79.46
DP00329	P02666	Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin	Bos taurus (Bovine)	1	25	1	20	20	MKVLILACLVALALARELEE	79.08
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	2	21	20	KTALILLSILGMACAFSMKN	82.64
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	24	54	31	RRVKIEDSEENGVFKYRPRYYLYKHAYFYPH	84.94
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	88	97	10	GENNEESNED	75.25
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	101	115	15	EAENTTLSATTLGYG	77.35
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	121	134	14	GTGYTGLAAIQLPK	75.44
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	169	180	12	VDENEQGINGTS	81.02
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	255	282	28	TTVEYEGEYEYTGANEYDNGYEIYESEN	83.03
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	1	317	287	312	26	GDNYRAYEDEYSYFKGQGYDGYDGQN	83.1
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	258	317	259	282	24	YEGEYEYTGANEYDNGYEIYESEN	83.54
DP00332	P21815	Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein)	Homo sapiens (Human)	258	317	287	312	26	GDNYRAYEDEYSYFKGQGYDGYDGQN	83.1
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	18	40	23	EPAVYFKEQFLDGDGWTSRWIES	79.12
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	45	59	15	DFGKFVLSSGKFYGD	82.03
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	65	85	21	GLQTSQDARFYALSASFEPFS	79.36
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	87	105	19	KGQTLVVQFTVKHEQNIDC	86.8
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	108	122	15	GYVKLFPNSLDQTDM	80.36
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	124	133	10	GDSEYNIMFG	84.18
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	143	160	18	KVHVIFNYKGKNVLINKD	97.21
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	164	175	12	KDDEFTHLYTLI	84.64
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	178	205	28	PDNTYEVKIDNSQVESGSLEDDWDFLPP	82.97
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	286	300	15	KGTWIHPEIDNPEYS	77.26
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	417	302	357	56	DPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQM	81.82
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	18	40	23	EPAVYFKEQFLDGDGWTSRWIES	79.12
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	45	59	15	DFGKFVLSSGKFYGD	82.03
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	65	85	21	GLQTSQDARFYALSASFEPFS	79.36
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	87	105	19	KGQTLVVQFTVKHEQNIDC	86.8
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	108	122	15	GYVKLFPNSLDQTDM	80.36
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	124	133	10	GDSEYNIMFG	84.18
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	143	160	18	KVHVIFNYKGKNVLINKD	97.21
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	164	175	12	KDDEFTHLYTLI	84.64
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	178	205	28	PDNTYEVKIDNSQVESGSLEDDWDFLPP	82.97
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	18	307	286	300	15	KGTWIHPEIDNPEYS	77.26
DP00333	P27797	Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)	Homo sapiens (Human)	308	417	310	357	48	NFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQM	81.36
DP00334	Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	Homo sapiens (Human)	1	24	12	19	8	GAVTTSQI	86.62
DP00334	Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	Homo sapiens (Human)	210	304	233	270	38	GDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSD	78.81
DP00334	Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	Homo sapiens (Human)	210	304	272	299	28	DDEVYQVTVYQAGESDTDSFEEDPEISL	78.2
DP00335	Q64364	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p19ARF)	Mus musculus (Mouse)	1	37	4	12	9	RFLVTVRIQ	83.28
DP00335	Q64364	Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p19ARF)	Mus musculus (Mouse)	1	37	19	28	10	QERVFLVKFV	88.6
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	12	29	18	SSENFDELLKALGVNAML	76.9
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	32	46	15	VAVAAASKPHVEIRQ	75.14
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	48	77	30	GDQFYIKTSTTVRTTEINFKVGEGFEEETV	80.43
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	87	95	9	TWENENKIH	78.26
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	107	113	7	KTYWTRE	75.25
DP00340	P62965	Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)	Mus musculus (Mouse)	1	137	116	124	9	NDELILTFG	89.89
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	1	133	21	48	28	AVSHWQQQSYLDSGIHSGATTTAPSLSG	85.2
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	1	133	60	76	17	SQVLYEWEQGFSQSFTQ	80.54
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	1	133	78	89	12	QVADIDGQYAMT	76.37
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	17	48	21	43	23	AVSHWQQQSYLDSGIHSGATTTA	85.11
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	664	781	674	694	21	LSVELTSSLFRTEPMAWNETA	78.15
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	664	781	769	776	8	GDSNQLAW	79.89
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	672	781	674	694	21	LSVELTSSLFRTEPMAWNETA	78.15
DP00341	Q02248	Catenin beta-1 (Beta-catenin)	Mus musculus (Mouse)	672	781	769	776	8	GDSNQLAW	79.89
DP00342	P09883	Colicin-E9 (EC 3.1.-.-)	Escherichia coli	1	83	36	43	8	GSGWSSEN	75.25
DP00342	P09883	Colicin-E9 (EC 3.1.-.-)	Escherichia coli	1	61	36	43	8	GSGWSSEN	75.25
DP00343	Q9Y6Q9	Nuclear receptor coactivator 3 (NCoA-3) (EC 2.3.1.48) (ACTR) (Amplified in breast cancer 1 protein) (AIB-1) (CBP-interacting protein) (pCIP) (Class E basic helix-loop-helix protein 42) (bHLHe42) (Receptor-associated coactivator 3) (RAC-3) (Steroid receptor coactivator protein 3) (SRC-3) (Thyroid hormone receptor activator molecule 1) (TRAM-1)	Homo sapiens (Human)	1018	1088	1054	1065	12	LDQLHTLLSNTD	79.01
DP00345	P16535	Leukotoxin (Lkt)	Mannheimia haemolytica (Pasteurella haemolytica)	884	953	884	904	21	GNGKITQDELSKVVDNYELLK	78.56
DP00345	P16535	Leukotoxin (Lkt)	Mannheimia haemolytica (Pasteurella haemolytica)	884	953	908	927	20	NVTNSLDKLISSVSAFTSSN	78.95
DP00345	P16535	Leukotoxin (Lkt)	Mannheimia haemolytica (Pasteurella haemolytica)	884	953	940	948	9	LDQSLSSLQ	78.52
DP00347	P04972	"Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)"	Bos taurus (Bovine)	1	87	46	52	7	GVQGFGD	77.26
DP00347	P04972	"Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)"	Bos taurus (Bovine)	1	87	63	82	20	DITVICPWEAFNHLELHELA	79.67
DP00347	P04972	"Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)"	Bos taurus (Bovine)	46	78	46	52	7	GVQGFGD	77.26
DP00347	P04972	"Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)"	Bos taurus (Bovine)	46	78	63	73	11	DITVICPWEAF	79.45
DP00348	P45481	Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Mus musculus (Mouse)	2059	2118	2084	2113	30	QQQVLNILKSNPQLMAAFIKQRTAKYVANQ	80
DP00348	P45481	Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Mus musculus (Mouse)	2059	2117	2084	2112	29	QQQVLNILKSNPQLMAAFIKQRTAKYVAN	80.21
DP00348	P45481	Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-)	Mus musculus (Mouse)	2113	2152	2139	2147	9	SLQNLNAMQ	76.07
DP00349	P06709	Bifunctional ligase/repressor BirA (Biotin operon repressor) (Biotin--acetyl-CoA-carboxylase ligase) (EC 6.3.4.15) (Biotin--protein ligase) (Biotin-acetyl-CoA carboxylase synthetase)	Escherichia coli (strain K12)	212	234	217	229	13	SVVNQGWITLQEA	82.89
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	573	579	7	GEGATFD	79.31
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	592	604	13	LLGSFLNTASASS	80.55
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	624	630	7	PAVNIQP	91.97
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	632	641	10	VSGAWDWHTK	76.92
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	683	690	8	GGSSFASK	80.94
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	721	732	12	QGGGYNWQQTQS	76.48
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	745	756	12	NRPNYNVSFSSM	77.29
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	766	772	7	AAANLEG	79.93
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	780	792	13	EDLLSGQGFNAHK	75.25
DP00351	Q27974	Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6)	Bos taurus (Bovine)	547	813	796	803	8	GPRTIAEM	74.58
DP00352	O33599	Glycyl-glycine endopeptidase LytM (EC 3.4.24.75) (Autolysin LytM)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	147	182	150	158	9	NNQAYNSHD	78.11
DP00352	O33599	Glycyl-glycine endopeptidase LytM (EC 3.4.24.75) (Autolysin LytM)	Staphylococcus aureus (strain NCTC 8325 / PS 47)	147	182	161	167	7	GKVNYPN	87.29
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	90	6	64	59	GNQVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQNNNSG	78.02
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	90	68	81	14	SQNNDNENNIKNTL	78.09
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	89	6	64	59	GNQVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQNNNSG	78.02
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	89	68	81	14	SQNNDNENNIKNTL	78.09
DP00353	P23202	Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	273	294	278	286	9	NAAAYSAGT	85.51
DP00356	Q99967	Cbp/p300-interacting transactivator 2 (MSG-related protein 1) (MRG-1) (P35srj)	Homo sapiens (Human)	220	269	220	241	22	TDFIDEEVLMSLVIEMGLDRIK	82.43
DP00356	Q99967	Cbp/p300-interacting transactivator 2 (MSG-related protein 1) (MRG-1) (P35srj)	Homo sapiens (Human)	220	269	243	262	20	LPELWLGQNEFDFMTDFVCK	79.5
DP00357	P62328	Thymosin beta-4 (T beta-4) (Fx) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Homo sapiens (Human)	1	44	6	14	9	DMAEIEKFD	81.72
DP00357	P62328	Thymosin beta-4 (T beta-4) (Fx) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Homo sapiens (Human)	1	44	31	37	7	SKETIEQ	75.92
DP00357	P62328	Thymosin beta-4 (T beta-4) (Fx) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Homo sapiens (Human)	17	44	31	37	7	SKETIEQ	75.92
DP00359	A6Q0K5	Calvin cycle protein CP12; chloroplastic (CP12 domain-containing protein) (Chloroplast protein 12)	Chlamydomonas reinhardtii (Chlamydomonas smithii)	1	50	5	11	7	KSVVISR	81.08
DP00365	P53041	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	Homo sapiens (Human)	19	147	34	41	8	QANDYFKA	79.97
DP00365	P53041	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	Homo sapiens (Human)	19	147	44	101	58	YENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYR	79.75
DP00365	P53041	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	Homo sapiens (Human)	19	147	103	113	11	AASNMALGKFR	79.93
DP00365	P53041	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	Homo sapiens (Human)	19	147	132	142	11	AKMKYQECNKI	80.12
DP00372	Q9NR00	Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)	Homo sapiens (Human)	1	106	7	18	12	HQAVIMSTSLRV	83.7
DP00372	Q9NR00	Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)	Homo sapiens (Human)	1	106	35	56	22	AVGNIFENTDQESLERLFRNSG	80.15
DP00372	Q9NR00	Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)	Homo sapiens (Human)	1	106	63	77	15	RAKIIFAIDQDVEEK	96.3
DP00372	Q9NR00	Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)	Homo sapiens (Human)	1	106	89	101	13	KDKLFQFLKLRKY	80.89
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	153	215	154	163	10	NLQNQQVLTG	83.68
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	153	215	167	199	33	VMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQD	79.12
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	153	215	202	210	9	GQIQIIPGA	92.23
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	366	382	17	DALNIQQNQTSGGSLQA	77.1
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	391	403	13	NQQTQQQQILIQP	88.6
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	408	417	10	GGQALQALQA	76.49
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	421	442	22	SGQTFTTQAISQETLQNLQLQA	80.05
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	446	452	7	SGPIIIR	79.55
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	342	488	460	483	24	GQVSWQTLQLQNLQVQNPQAQTIT	77.49
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	366	382	17	DALNIQQNQTSGGSLQA	77.1
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	391	403	13	NQQTQQQQILIQP	88.6
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	408	417	10	GGQALQALQA	76.49
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	421	442	22	SGQTFTTQAISQETLQNLQLQA	80.05
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	446	452	7	SGPIIIR	79.55
DP00378	P08047	Transcription factor Sp1	Homo sapiens (Human)	349	495	460	485	26	GQVSWQTLQLQNLQVQNPQAQTITLA	77.32
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	557	564	8	QNEKFFRN	77.76
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	568	591	24	GEVDFRDIDLTDEILTYVQDSLSK	81.05
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	601	611	11	QQQSLALNSSC	78.93
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	645	663	19	MQVNGMFENWNSNQFVPFN	82.91
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	668	688	21	DPQQYNVFTDLHGISQEFPYK	79.36
DP00381	P35869	Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)	Homo sapiens (Human)	545	713	696	704	9	YTQNFISCN	83.72
DP00385	P49841	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	Homo sapiens (Human)	1	34	8	14	7	TSFAESC	75.25
DP00385	P49841	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	Homo sapiens (Human)	1	34	19	26	8	QPSAFGSM	76.25
DP00385	P49841	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	Homo sapiens (Human)	1	33	8	14	7	TSFAESC	75.25
DP00385	P49841	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	Homo sapiens (Human)	1	33	19	26	8	QPSAFGSM	76.25
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	24	34	11	ANRQFVLYTLD	81.3
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	38	58	21	NDELRVGLSVSKKIGNAVMRN	74.71
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	64	72	9	IRQAFLEEK	76.63
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	78	85	8	KDYIIIAR	96.82
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	88	97	10	ASQLTYEETK	90.87
DP00387	P25814	Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)	Bacillus subtilis (strain 168)	1	116	99	111	13	SLQHLFRKSSLYK	85.03
DP00389	P09983	Hemolysin; chromosomal	Escherichia coli	962	1023	962	994	33	DALAYGSQGNLNPLINEISKIISAAGNFDVKEE	81.23
DP00389	P09983	Hemolysin; chromosomal	Escherichia coli	962	1023	996	1018	23	AAASLLQLSGNASDFSYGRNSIT	81.34
DP00396	O74718	Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF3) (ERF2) (Polypeptide release factor 3) (Translation release factor 3)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	280	307	282	296	15	KESWYLSWALDSTSE	78.97
DP00398	P07342	Acetolactate synthase catalytic subunit; mitochondrial (EC 2.2.1.6) (Acetohydroxy-acid synthase catalytic subunit) (AHAS) (ALS)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	647	687	660	668	9	GLDEFINFD	90.71
DP00399	P50097	"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)"	Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis)	102	221	112	124	13	PDQTFADVLAISQ	82.22
DP00399	P50097	"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)"	Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis)	102	221	140	161	22	HGVLLGLVTQRDYPIDLTQTET	80.27
DP00399	P50097	"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)"	Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis)	102	221	184	201	18	EANKIIWEKKLNALPIID	82.5
DP00399	P50097	"Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)"	Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis)	102	221	204	213	10	QHLRYIVFRK	79.67
DP00407	P07363	Chemotaxis protein CheA (EC 2.7.13.3)	Escherichia coli (strain K12)	124	158	124	130	7	RQLALEA	79.26
DP00410	P12497	Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)	Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1)	108	143	122	138	17	TGNNSQVSQNYPIVQNL	76.45
DP00410	P12497	Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)	Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1)	123	143	126	138	13	SQVSQNYPIVQNL	77.23
DP00415	P0ABE0	Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)	Escherichia coli O157:H7	49	76	57	70	14	AQSNAAAPATVPSM	77.26
DP00418	P78504	Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339)	Homo sapiens (Human)	1094	1218	1118	1124	7	QLNQIKN	79.93
DP00418	P78504	Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339)	Homo sapiens (Human)	1094	1218	1129	1137	9	HGANTVPIK	76.03
DP00418	P78504	Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339)	Homo sapiens (Human)	1094	1218	1172	1179	8	KQPAYTLV	80.27
DP00418	P78504	Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339)	Homo sapiens (Human)	1094	1218	1207	1213	7	SAQSLNR	78.17
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	13	54	42	GIKLSADVKPFVPRFAGLNVAWLESSEACVFPSSAATYYPFV	79.57
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	60	96	37	TEQKIYTEDMAFGASTFPPQYLSSEITLHPYAYSPYT	80.22
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	100	106	7	TQNVYSV	87.86
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	108	126	19	GSQYLYNQPSCYRGFQTVK	77.06
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	139	149	11	MKALFKKKTYD	77.26
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	164	175	12	ADGTISSEIKSA	81.83
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	179	190	12	HHLSIYAENSLK	83.25
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	201	224	24	KSRIIAKNVSTSKPEFEFTTLDFP	81.41
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	226	237	12	LQGAENNMSEIQ	81.77
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	262	275	14	AAVLSKGEIVVKNN	78.36
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	277	289	13	NESVTANAATNSP	77.72
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	293	314	22	RELSWTPMGYVVRQTLSTELSA	75.05
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	317	332	16	KNVTSMINLKTIASSA	85.68
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	335	359	25	KNVSIPSSEALSSDPSYNKEKHIIH	76.63
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	388	397	10	STSKYEVLTV	86.05
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	405	417	13	DAEEFPNLAVASE	78.65
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	453	461	9	GGMLTALEK	73.91
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	531	539	9	SLKKIILKE	79.45
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	547	559	13	LQENAVSPAFTSD	75.92
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	1	600	584	590	7	MDELIST	79.74
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	776	854	780	786	7	VQQELVG	82.61
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	776	854	817	825	9	EPHYIEIWK	84.58
DP00420	Q96T21	Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2)	Homo sapiens (Human)	776	854	827	849	23	HLEAYSGCTLELEESLEASTSQM	75.88
DP00421	P07516	Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)	Bos taurus (Bovine)	1	202	37	43	7	MLFRLSE	74.96
DP00421	P07516	Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)	Bos taurus (Bovine)	1	202	81	105	25	AVQRIAESHLQSISNLGENQASEEE	81.78
DP00422	P0A6R3	DNA-binding protein Fis (Factor-for-inversion stimulation protein) (Hin recombinational enhancer-binding protein)	Escherichia coli (strain K12)	1	23	4	18	15	QRVNSDVLTVSTVNS	80.38
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	166	252	176	188	13	SSLTYKEMILKSM	77.87
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	166	252	196	212	17	GSSRIVLKKYVKDTFSS	82.06
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	166	252	216	229	14	TSSNFDYLFNSAIK	85.16
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	171	258	176	188	13	SSLTYKEMILKSM	77.87
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	171	258	196	212	17	GSSRIVLKKYVKDTFSS	82.06
DP00423	P53551	Histone H1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	171	258	216	229	14	TSSNFDYLFNSAIK	85.16
DP00424	P04325	Protein Rev (ART/TRS) (Anti-repression transactivator) (Regulator of expression of viral proteins)	Human immunodeficiency virus type 1 group M subtype B (isolate PCV12) (HIV-1)	62	116	99	111	13	SPQILVESPTILE	74.35
DP00427	P0AFG8	Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1)	Escherichia coli (strain K12)	1	55	15	27	13	RDWLQAIESVIRE	79.93
DP00427	P0AFG8	Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1)	Escherichia coli (strain K12)	1	55	32	44	13	RAQYLIDQLLAEA	85.49
DP00435	Q01853	Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP)	Mus musculus (Mouse)	736	806	751	764	14	DIRKYEMFAQTLQQ	81.15
DP00435	Q01853	Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP)	Mus musculus (Mouse)	736	806	767	774	8	GFGSFRFP	76.51
DP00435	Q01853	Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP)	Mus musculus (Mouse)	736	806	792	799	8	GGSVYTED	83.15
DP00436	P50477	Canavalin	Canavalia ensiformis (Jack bean) (Dolichos ensiformis)	1	45	2	29	28	AFSARFPLWLLLGVVLLASVSASFAHSG	78.33
DP00437	P43351	DNA repair protein RAD52 homolog	Homo sapiens (Human)	1	23	4	10	7	TEEAILG	89.97
DP00438	Q05158	Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2)	Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)	68	115	76	83	8	GAGTLNMD	78.93
DP00438	Q05158	Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2)	Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)	82	117	106	112	7	NTSKFAQ	85.91
DP00446	O35718	Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (Protein EF-10)	Mus musculus (Mouse)	186	225	200	206	7	HLDSYEK	75.35
DP00446	O35718	Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (Protein EF-10)	Mus musculus (Mouse)	186	225	213	220	8	PIREFLDQ	74.25
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	16	29	14	RATKFLESIKGKFT	78.88
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	37	67	31	KDSIISVNSTDIEVTKESPITSNSTIINPTN	82.19
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	83	90	8	PLVSFKED	78.26
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	94	133	40	SDNPFSKLYKETIETFDNNEEESSYSYEEINDQTNDNITA	82.79
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	141	157	17	KLSEILGMLHTLVVASA	78.73
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	174	196	23	REEMIEKIRTEALMTNDRLEAMA	80.28
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	241	222	230	9	KLNNLLEGN	74.84
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	118	16	29	14	RATKFLESIKGKFT	78.88
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	118	37	67	31	KDSIISVNSTDIEVTKESPITSNSTIINPTN	82.19
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	118	83	90	8	PLVSFKED	78.26
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	118	94	113	20	SDNPFSKLYKETIETFDNNE	79.25
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	102	16	29	14	RATKFLESIKGKFT	78.88
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	102	37	67	31	KDSIISVNSTDIEVTKESPITSNSTIINPTN	82.19
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	1	102	83	90	8	PLVSFKED	78.26
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	161	241	174	196	23	REEMIEKIRTEALMTNDRLEAMA	80.28
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	161	241	222	230	9	KLNNLLEGN	74.84
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	164	241	174	196	23	REEMIEKIRTEALMTNDRLEAMA	80.28
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	164	241	222	230	9	KLNNLLEGN	74.84
DP00447	P12579	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain Long)	198	241	222	230	9	KLNNLLEGN	74.84
DP00448	Q9Y613	FH1/FH2 domain-containing protein 1 (Formin homolog overexpressed in spleen 1) (FHOS) (Formin homology 2 domain-containing protein 1)	Homo sapiens (Human)	1104	1164	1110	1117	8	LLVQSVTK	77.26
DP00448	Q9Y613	FH1/FH2 domain-containing protein 1 (Formin homolog overexpressed in spleen 1) (FHOS) (Formin homology 2 domain-containing protein 1)	Homo sapiens (Human)	1104	1164	1150	1158	9	LVQALGLSK	75.92
DP00449	P53563	Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)	Rattus norvegicus (Rat)	31	80	47	60	14	TPSAINGNPSWHLA	84.95
DP00455	P84092	AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein)	Rattus norvegicus (Rat)	130	158	130	140	11	KTFITQQGIKS	79.69
DP00455	P84092	AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein)	Rattus norvegicus (Rat)	130	158	147	153	7	EQSQITS	77.11
DP00455	P84092	AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein)	Rattus norvegicus (Rat)	135	158	147	153	7	EQSQITS	77.11
DP00458	P37727	Rab proteins geranylgeranyltransferase component A 1 (Choroideremia protein homolog) (Rab escort protein 1) (REP-1)	Rattus norvegicus (Rat)	108	208	110	141	32	KDVEEAGALQKNHASVTSAQSAEAAEAAETSC	77.58
DP00461	P08083	Colicin-N	Escherichia coli	1	90	6	15	10	ADNAHNNAFG	80.13
DP00461	P08083	Colicin-N	Escherichia coli	1	90	21	27	7	GIGNTSG	80.27
DP00461	P08083	Colicin-N	Escherichia coli	1	90	42	48	7	NGWSWSN	82.04
DP00461	P08083	Colicin-N	Escherichia coli	1	90	58	70	13	SDGSYHITFHGDN	78.44
DP00461	P08083	Colicin-N	Escherichia coli	2	90	6	15	10	ADNAHNNAFG	80.13
DP00461	P08083	Colicin-N	Escherichia coli	2	90	21	27	7	GIGNTSG	80.27
DP00461	P08083	Colicin-N	Escherichia coli	2	90	42	48	7	NGWSWSN	82.04
DP00461	P08083	Colicin-N	Escherichia coli	2	90	58	70	13	SDGSYHITFHGDN	78.44
DP00461	P08083	Colicin-N	Escherichia coli	40	76	42	48	7	NGWSWSN	82.04
DP00461	P08083	Colicin-N	Escherichia coli	40	76	58	70	13	SDGSYHITFHGDN	78.44
DP00462	P11157	Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)	Mus musculus (Mouse)	1	64	14	21	8	QQQLQLSP	76.76
DP00462	P11157	Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)	Mus musculus (Mouse)	1	64	47	59	13	AARRIFQDSAELE	77.44
DP00462	P11157	Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)	Mus musculus (Mouse)	353	390	353	371	19	NISLEGKTNFFEKRVGEYQ	78.61
DP00462	P11157	Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)	Mus musculus (Mouse)	353	390	373	385	13	MGVMSNSTENSFT	77.31
DP00463	Q9Z0U4	Gamma-aminobutyric acid type B receptor subunit 1 (GABA-B receptor 1) (GABA-B-R1) (GABA-BR1) (GABABR1) (Gb1)	Rattus norvegicus (Rat)	17	98	49	66	18	QVKAINFLPVDYEIEYVC	86.55
DP00463	Q9Z0U4	Gamma-aminobutyric acid type B receptor subunit 1 (GABA-B receptor 1) (GABA-B-R1) (GABA-BR1) (GABABR1) (Gb1)	Rattus norvegicus (Rat)	17	98	82	89	8	ANGSWTDM	79.14
DP00466	P04156	Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Homo sapiens (Human)	23	124	29	39	11	GGWNTGGSRYP	80.94
DP00466	P04156	Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230)	Homo sapiens (Human)	23	124	95	101	7	THSQWNK	73.91
DP00468	P25963	NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3)	Homo sapiens (Human)	1	66	38	54	17	KDEEYEQMVKELQEIRL	82.71
DP00468	P25963	NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3)	Homo sapiens (Human)	276	317	285	312	28	DEESYDTESEFTEFTEDELPYDDCVFGG	79.47
DP00469	O24646	Transcription factor HY5 (Protein LONG HYPOCOTYL 5) (bZIP transcription factor 56) (AtbZIP56)	Arabidopsis thaliana (Mouse-ear cress)	1	77	2	15	14	QEQATSSLAASSLP	74.18
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	20	27	8	LAGHFTQD	84.28
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	54	69	16	LGVASEDELVAEFLQD	78.66
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	78	100	23	APQTFKMDDLLAEMQQIEQSNFR	81.42
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	110	125	16	ADLALSENWAQEFLAA	79.93
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	129	148	20	VDVTQDYNETDWSQEFISEV	81.3
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	159	175	17	WAEEYLEQSEEKLWLGE	75.96
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	181	190	10	TDRWYDEYHP	80.27
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	193	205	13	DLQHTASDFVAKV	76.85
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	209	223	15	KLANSEFLKFVRQIG	87.78
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	225	231	7	GQVSLES	79.41
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	239	298	60	QAEQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEM	78.64
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	324	306	319	14	HPWLSDYDDLTSAT	79.67
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	110	20	27	8	LAGHFTQD	84.28
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	110	54	69	16	LGVASEDELVAEFLQD	78.66
DP00472	P50542	Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1)	Homo sapiens (Human)	1	110	78	100	23	APQTFKMDDLLAEMQQIEQSNFR	81.42
DP00473	Q49AN0	Cryptochrome-2	Homo sapiens (Human)	490	593	496	522	27	SRLNIERMKQIYQQLSRYRGLCLLASV	78.53
DP00474	Q43125	Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2)	Arabidopsis thaliana (Mouse-ear cress)	506	681	511	524	14	GDSAEVEEAPIEFP	76.9
DP00474	Q43125	Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2)	Arabidopsis thaliana (Mouse-ear cress)	506	681	565	572	8	SLNLRNSV	75.75
DP00474	Q43125	Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2)	Arabidopsis thaliana (Mouse-ear cress)	506	681	599	619	21	NQVTAMIPEFNIRIVAESTED	79.61
DP00474	Q43125	Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2)	Arabidopsis thaliana (Mouse-ear cress)	506	681	660	676	17	TTSSYLQNHHEILNWRR	79.64
DP00475	Q6Q547	H/ACA ribonucleoprotein complex subunit NOP10 (Nucleolar protein 10) (Nucleolar protein family A member 3) (snoRNP protein NOP10)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	17	38	22	28	7	ESGEITK	75.25
DP00482	Q08826	Sorting nexin-3 (Golgi retention deficient protein 19)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	29	3	18	16	REFKSFGSTEKSLLSK	73.91
DP00485	Q9UBE0	SUMO-activating enzyme subunit 1 (Ubiquitin-like 1-activating enzyme E1A) Cleaved into: SUMO-activating enzyme subunit 1; N-terminally processed	Homo sapiens (Human)	289	311	290	299	10	DFVRYCFSEM	78.66
DP00486	Q9UBT2	SUMO-activating enzyme subunit 2 (EC 2.3.2.-) (Anthracycline-associated resistance ARX) (Ubiquitin-like 1-activating enzyme E1B) (Ubiquitin-like modifier-activating enzyme 2)	Homo sapiens (Human)	551	640	562	568	7	AAKSITN	79.93
DP00486	Q9UBT2	SUMO-activating enzyme subunit 2 (EC 2.3.2.-) (Anthracycline-associated resistance ARX) (Ubiquitin-like 1-activating enzyme E1B) (Ubiquitin-like modifier-activating enzyme 2)	Homo sapiens (Human)	551	640	585	593	9	DDVLIVDSD	98.33
DP00487	P09938	Ribonucleoside-diphosphate reductase small chain 1 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 1) (Ribonucleotide reductase small subunit 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	41	11	36	26	ADALSDLEIKDSKSNLNKELETLREE	79.07
DP00488	P49723	Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	51	3	15	13	AHNQFLKTFQKER	80.19
DP00488	P49723	Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	51	23	46	24	KDEILLMENSRRFVMFPIKYHEIW	76.99
DP00490	O88900	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Rattus norvegicus (Rat)	361	435	369	380	12	VSENSLVAMDFS	75.25
DP00490	O88900	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Rattus norvegicus (Rat)	361	435	383	389	7	KTRVIDN	74.25
DP00490	O88900	Growth factor receptor-bound protein 14 (GRB14 adapter protein)	Rattus norvegicus (Rat)	361	435	391	406	16	TEALSVAVEEGLAWRK	77.17
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	654	662	9	VVEWTNNTL	80.27
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	669	680	12	KEQIIGLSRRIA	91.97
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	689	695	7	AFSNALE	78.26
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	699	708	10	KALSIAVTGS	80.67
DP00491	Q62165	Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)	Mus musculus (Mouse)	654	750	713	719	7	HLQFIPV	81.89
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	182	205	24	KDILSEASTMQLLQQQQQEAVSEG	76.2
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	221	233	13	SKDNYLGGTSTIS	83.43
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	250	258	9	GVEALEHLS	76.7
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	305	318	14	DTAEYSPFKGGYTK	74.41
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	344	351	8	TLSLYKSG	92.64
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	355	371	17	EAAAYQSRDYYNFPLAL	83.12
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	395	416	22	YGSAWAAAAAQCRYGDLASLHG	79.74
DP00492	P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Homo sapiens (Human)	142	485	433	449	17	SSWHTLFTAEEGQLYGP	82.59
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	310	316	7	EQASIEM	80.32
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	320	329	10	AAREIRRAIT	77.26
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	338	354	17	NCVNKDHLTAATHWASM	77.06
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	364	372	9	NGAAYSRYP	79.97
DP00499	Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	Rattus norvegicus (Rat)	306	430	386	399	14	AVEGIVPSAMSLSH	81.27
DP00505	P04234	T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d)	Homo sapiens (Human)	127	171	138	151	14	DTQALLRNDQVYQP	76.37
DP00505	P04234	T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d)	Homo sapiens (Human)	127	171	156	166	11	DDAQYSHLGGN	79.26
DP00506	P07766	T-cell surface glycoprotein CD3 epsilon chain (T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e)	Homo sapiens (Human)	153	207	195	202	8	QRDLYSGL	76.09
DP00508	P09693	T-cell surface glycoprotein CD3 gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g)	Homo sapiens (Human)	139	182	156	162	7	NDQLYQP	97.99
DP00508	P09693	T-cell surface glycoprotein CD3 gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g)	Homo sapiens (Human)	139	182	170	177	8	QYSHLQGN	75.25
DP00510	O60356	Nuclear protein 1 (Candidate of metastasis 1) (Protein p8)	Homo sapiens (Human)	1	82	26	38	13	ESDLYSLAHSYLG	78.85
DP00517	P52179	Myomesin-1 (190 kDa connectin-associated protein) (190 kDa titin-associated protein) (Myomesin family member 1)	Homo sapiens (Human)	836	931	871	877	7	KDALLGS	75.92
DP00517	P52179	Myomesin-1 (190 kDa connectin-associated protein) (190 kDa titin-associated protein) (Myomesin family member 1)	Homo sapiens (Human)	836	931	891	907	17	LGQTEVSKVSETVQEEL	75.37
DP00518	O54918	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	Mus musculus (Mouse)	1	113	73	86	14	SPLFIFVRRSSLLS	95.63
DP00518	O54918	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	Mus musculus (Mouse)	1	113	88	97	10	SSSGYFSFDT	88.8
DP00518	O54918	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	Mus musculus (Mouse)	85	113	88	97	10	SSSGYFSFDT	88.8
DP00518	O54918	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	Mus musculus (Mouse)	139	171	153	166	14	IGDEFNETYTRRVF	82.51
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1393	1405	13	LDSFESRSIASSV	77.93
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1413	1420	8	MVSGIISP	86.2
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1470	1484	15	AAVNAAVQRVQVLPD	78.66
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1487	1495	9	TLLHFATES	79.86
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1505	1525	21	SLSALSLDEPFIQKDVELRIM	77.15
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1528	1539	12	VQENDNGNETES	75.25
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1543	1558	16	KESNENQEKEAEKTID	77.45
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1570	1582	13	DDIEILEECIISA	79.21
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1647	1662	16	TPINFSTATSLSDLTI	80.73
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1362	1745	1722	1731	10	DILAECINSA	76.42
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1459	1532	1470	1484	15	AAVNAAVQRVQVLPD	78.66
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1459	1532	1487	1495	9	TLLHFATES	79.86
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1459	1532	1505	1525	21	SLSALSLDEPFIQKDVELRIM	77.15
DP00519	P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	Homo sapiens (Human)	1614	1679	1647	1662	16	TPINFSTATSLSDLTI	80.73
DP00520	Q969F2	Protein naked cuticle homolog 2 (Naked-2) (hNkd2)	Homo sapiens (Human)	1	217	23	32	10	SFVASAYASG	93.38
DP00520	Q969F2	Protein naked cuticle homolog 2 (Naked-2) (hNkd2)	Homo sapiens (Human)	1	217	105	114	10	QRLNIDALQC	86.29
DP00520	Q969F2	Protein naked cuticle homolog 2 (Naked-2) (hNkd2)	Homo sapiens (Human)	1	217	123	134	12	RQEWTFTLYDFD	83.92
DP00520	Q969F2	Protein naked cuticle homolog 2 (Naked-2) (hNkd2)	Homo sapiens (Human)	1	217	147	163	17	LMHTIYEVVDASVNHSS	78.6
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	1	8	8	MATLIYVD	97.37
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	65	75	11	GTVNRATEKSV	76.25
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	107	121	15	SDDAYPEIEKFFPFN	81.61
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	123	129	7	LDFESFD	84.85
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	144	150	7	VPLMILD	77.26
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	155	162	8	LEKLFQLG	82.61
DP00521	O95997	Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)	Homo sapiens (Human)	1	202	174	194	21	WESNLLQSPSSILSTLDVELP	76.84
DP00527	P02783	Seminal vesicle secretory protein 4 (Androgen-dependent protein) (ADP) (Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV) (SVS protein S)	Rattus norvegicus (Rat)	1	70	3	21	19	STSLFLCSLLLLLVTGAIG	79.39
DP00527	P02783	Seminal vesicle secretory protein 4 (Androgen-dependent protein) (ADP) (Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV) (SVS protein S)	Rattus norvegicus (Rat)	1	70	24	42	19	TKEKYSQSEEVVSESFASG	77.93
DP00530	P12950	Dehydrin DHN1 (M3) (RAB-17 protein)	Zea mays (Maize)	1	168	139	147	9	TGGAYATGT	79.34
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	115	8	15	8	HHHLFHHK	74.58
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	115	21	30	10	GPVDYEKEIK	73.91
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	115	34	54	21	HLEQIGKLGTVAAGAYALHEK	79.9
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	1	115	69	89	21	IEEEIAAAAAVGAGGFAFHEH	81.73
DP00531	Q08655	Abscisic stress-ripening protein 1	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)	61	115	69	89	21	IEEEIAAAAAVGAGGFAFHEH	81.73
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	270	287	18	THGSISPQEESVSPNISS	76.87
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	309	330	22	SKELIVSEEIPINSSEQESDYE	76.77
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	332	340	9	NNETSVLSS	78.15
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	356	365	10	GRENFVYANN	88.36
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	386	393	8	SDEAIIPV	84.99
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	401	432	32	GSELSSKIRKIHIQETQEFSKNYTTETDNEMN	77.98
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	459	483	25	NAKMIDFATLSKLKKKYQIILDRFA	81.69
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	493	514	22	QLNKLTDEQSSLDVAGLEDKFR	73.91
DP00533	P06701	Regulatory protein SIR3 (Silent information regulator 3)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	216	549	521	540	20	GRETILSNFNADINLEESIR	81.44
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	1	131	2	20	19	ATIATGLNIATQRVFVTSE	80.46
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	1	131	28	44	17	GPVHLNNSWNLGSRTTN	79.17
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	1	131	84	96	13	CVAAWDEVEELSA	77.21
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	1	131	112	118	7	PLEEYCK	79.93
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	54	131	84	96	13	CVAAWDEVEELSA	77.21
DP00534	Q9LZP9	Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2)	Arabidopsis thaliana (Mouse-ear cress)	54	131	112	118	7	PLEEYCK	79.93
DP00537	O43236	Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2)	Homo sapiens (Human)	1	119	20	27	8	GIKRFLED	75.25
DP00537	O43236	Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2)	Homo sapiens (Human)	1	119	33	47	15	ELSKFVKDFSGNASC	86.96
DP00537	O43236	Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2)	Homo sapiens (Human)	1	119	68	78	11	APDLYDDDLEF	78.47
DP00537	O43236	Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2)	Homo sapiens (Human)	1	119	88	97	10	DNQQYFCAPA	79.63
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	207	215	9	VQVKRVLEK	75.92
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	310	319	10	ETVSIEVKEV	78.29
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	323	329	7	LLVSTLG	76.02
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	168	486	438	451	14	PAVATAATAAEKYK	80.48
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	207	310	207	215	9	VQVKRVLEK	75.92
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	207	310	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	261	330	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	261	330	310	319	10	ETVSIEVKEV	78.29
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	285	313	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	285	309	286	304	19	KAVKESSIRSVQETVLPIK	76.52
DP00539	P51608	Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2)	Homo sapiens (Human)	335	486	438	451	14	PAVATAATAAEKYK	80.48
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	7	28	22	EETKISTEPVDNAWSMKIPAFR	76.06
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	35	67	33	GMVEESSFATLFPKYRERYLKEVWPLVEQCLAE	75.62
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	90	98	9	WDPYIIIKA	78.78
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	123	133	11	GCDIIKIGNLV	81.73
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	153	179	27	TLKSIELLTDCYVLVQGNTVSALGPYK	76.66
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	186	193	8	DIVLETMN	77.01
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	195	207	13	VHPIYNIKALMIK	79.26
DP00540	Q9VPU8	KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble)	Drosophila melanogaster (Fruit fly)	1	345	262	274	13	KQLASGEYFLNQE	78.65
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	187	199	13	RLLSFRDVDFEED	76.97
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	210	216	7	TLGLSSV	77.26
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	223	232	10	LQSLSGEPYS	80.27
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	242	252	11	GLEETGARALG	73.91
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	302	313	12	LPSQYLADVDTS	74.25
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	337	344	8	ETQILELN	80.23
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	349	361	13	AVEHLLVHLENTV	79.8
DP00541	Q91V27	Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a)	Mus musculus (Mouse)	147	403	388	398	11	LEELTSNISGS	87.84
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	1	63	3	10	8	GLVDSNPA	74.58
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	1	63	33	40	8	RDACIIEK	77.97
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	1	63	45	51	7	CGHLIEA	77.4
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	1	29	3	10	8	GLVDSNPA	74.58
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	25	63	33	40	8	RDACIIEK	77.97
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	25	63	45	51	7	CGHLIEA	77.4
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	25	60	33	40	8	RDACIIEK	77.97
DP00543	Q14061	Cytochrome c oxidase copper chaperone	Homo sapiens (Human)	25	60	45	51	7	CGHLIEA	77.4
DP00544	B0FRH7	Protein LLP (Protein LAPS18-like)	"Aplysia kurodai (Kurodas sea hare)"	1	120	35	55	21	KAQELDLDNVVTMKSAEEIKN	74.79
DP00544	B0FRH7	Protein LLP (Protein LAPS18-like)	"Aplysia kurodai (Kurodas sea hare)"	1	120	81	94	14	TQQNEDGHYPQWMN	76.59
DP00546	Q9NX55	Huntingtin-interacting protein K (Huntingtin yeast partner K)	Homo sapiens (Human)	1	129	13	23	11	GDVELELETET	75.22
DP00546	Q9NX55	Huntingtin-interacting protein K (Huntingtin yeast partner K)	Homo sapiens (Human)	1	129	54	69	16	EIQSSNLETAMSVIGD	80.23
DP00546	Q9NX55	Huntingtin-interacting protein K (Huntingtin yeast partner K)	Homo sapiens (Human)	1	129	94	105	12	DLELIMTEMEIS	79.4
DP00546	Q9NX55	Huntingtin-interacting protein K (Huntingtin yeast partner K)	Homo sapiens (Human)	1	129	118	124	7	GNVVEAL	83.52
DP00549	O00488	Zinc finger protein 593 (Zinc finger protein T86)	Homo sapiens (Human)	36	77	65	72	8	ACARYFID	78.64
DP00549	O00488	Zinc finger protein 593 (Zinc finger protein T86)	Homo sapiens (Human)	78	116	89	102	14	LKQLSVEPYSQEEA	75.25
DP00550	P02628	Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3)	Esox lucius (Northern pike)	1	108	19	36	18	AEGSFNHKKFFALVGLKA	86.79
DP00550	P02628	Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3)	Esox lucius (Northern pike)	1	108	53	70	18	ASGFIEEEELKFVLKSFA	79.49
DP00550	P02628	Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3)	Esox lucius (Northern pike)	1	108	80	88	9	ETKAFLKAA	75.62
DP00550	P02628	Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3)	Esox lucius (Northern pike)	1	108	92	103	12	GDGKIGIDEFET	79.6
DP00551	P16860	Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)	Homo sapiens (Human)	1	77	9	24	16	RALLLLLFLHLAFLGG	80.18
DP00551	P16860	Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)	Homo sapiens (Human)	1	77	36	42	7	SDLETSG	74.92
DP00551	P16860	Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)	Homo sapiens (Human)	1	77	53	66	14	KLSELQVEQTSLEP	75.92
DP00552	P0AFX7	Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein)	Escherichia coli (strain K12)	121	216	123	129	7	GQSETSQ	79.93
DP00552	P0AFX7	Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein)	Escherichia coli (strain K12)	121	216	134	140	7	PVFNTLP	76.49
DP00552	P0AFX7	Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein)	Escherichia coli (strain K12)	121	216	176	183	8	MLQDYELQ	75.67
DP00552	P0AFX7	Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein)	Escherichia coli (strain K12)	121	216	189	204	16	EQLQFEQAQTQQAAVQ	76.42
DP00553	Q9NZ94	Neuroligin-3 (Gliotactin homolog)	Homo sapiens (Human)	731	848	783	797	15	TLRLTALPDYTLTLR	75.14
DP00553	Q9NZ94	Neuroligin-3 (Gliotactin homolog)	Homo sapiens (Human)	731	848	807	838	32	TPNTITMIPNSLVGLQTLHPYNTFAAGFNSTG	77.08
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	1	10	10	MDVFMKGLSM	75.59
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	14	41	28	GVVAAAEKTKQGVTEAAEKTKEGVLYVG	81.4
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	50	60	11	QGVASVAEKTK	79.93
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	67	90	24	GGAVFSGAGNIAAATGLVKREEFP	90.73
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	115	121	7	EGESYED	77.07
DP00555	Q16143	Beta-synuclein	Homo sapiens (Human)	1	134	123	129	7	PQEEYQE	79.84
DP00557	Q00955	Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) Includes: Biotin carboxylase (EC 6.3.4.14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	2048	2080	2055	2062	8	RSQLSNKS	75.25
DP00557	Q00955	Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) Includes: Biotin carboxylase (EC 6.3.4.14)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	2048	2080	2067	2073	7	VHQQISK	80.22
DP00563	Q61337	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	Mus musculus (Mouse)	1	204	40	50	11	AQSMFQIPEFE	78.29
DP00563	Q61337	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	Mus musculus (Mouse)	1	204	82	88	7	LGSNIHQ	82.27
DP00563	Q61337	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	Mus musculus (Mouse)	1	204	140	148	9	NLWAAQRYG	82.5
DP00563	Q61337	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	Mus musculus (Mouse)	1	204	183	196	14	WTRIIQSWWDRNLG	90.64
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	3	24	22	LHVSLANGNRDLDYDSVQPYFM	78.5
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	63	69	7	HAGLYSP	76.64
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	73	79	7	AVAVSFA	91.16
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	85	92	8	GDSFSIAD	85.79
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	111	140	30	DDETFVKNIILQDCMWNGFSASAKLVSKLD	81.55
DP00564	Q6P8Z1	Protein B-Myc	Mus musculus (Mouse)	2	169	150	159	10	TGVSLAADVE	74.05
DP00566	P13102	Hemagglutinin Cleaved into: Hemagglutinin HA1 chain; Hemagglutinin HA2 chain	Influenza A virus (strain A/Whale/Maine/328/1984 H13N2)	141	175	156	170	15	GTNSFYRNLVWFVKK	89.07
DP00573	P03305	Genome polyprotein Cleaved into: Leader protease (Lb(pro)) (EC 3.4.22.46); Capsid protein VP0 (VP4-VP2); Capsid protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Capsid protein VP1 (P1D) (Virion protein 1); Protein 2A (P2A) (P52); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Protein 3B-1 (P3B-1) (Genome-linked protein VPg1); Protein 3B-2 (P3B-2) (Genome-linked protein VPg2); Protein 3B-3 (P3B-3) (Genome-linked protein VPg3); Protease 3C (EC 3.4.22.28) (Picornain 3C) (P3C) (Protease P20B); RNA-directed RNA polymerase 3D-POL (P3D-POL) (EC 2.7.7.48) (P56A)	Foot-and-mouth disease virus (isolate Bovine/Germany/O1Kaufbeuren/1966 serotype O) (FMDV)	852	890	871	877	7	DLQVLAQ	79.65
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	174	183	10	ADQLLQMIRV	76.45
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	229	242	14	LQRALALSRQEIDM	76.68
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	249	258	10	LRRAIQLSMQ	85.15
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	260	266	7	SSRNISQ	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	284	297	14	RREAYFEKQQQKQQ	86.48
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	174	361	341	351	11	QAAVTMSLETV	76.19
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	182	291	229	242	14	LQRALALSRQEIDM	76.68
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	182	291	249	258	10	LRRAIQLSMQ	85.15
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	182	291	260	266	7	SSRNISQ	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	182	291	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	229	242	14	LQRALALSRQEIDM	76.68
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	249	258	10	LRRAIQLSMQ	85.15
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	260	266	7	SSRNISQ	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	284	297	14	RREAYFEKQQQKQQ	86.48
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	194	361	341	351	11	QAAVTMSLETV	76.19
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	229	242	14	LQRALALSRQEIDM	76.68
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	249	258	10	LRRAIQLSMQ	85.15
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	260	266	7	SSRNISQ	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	224	348	284	297	14	RREAYFEKQQQKQQ	86.48
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	262	361	273	281	9	GTNLTSEEL	79.93
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	262	361	284	297	14	RREAYFEKQQQKQQ	86.48
DP00576	P54252	Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein)	Homo sapiens (Human)	262	361	341	351	11	QAAVTMSLETV	76.19
DP00583	P16006	Deoxycytidylate deaminase (EC 3.5.4.12) (dCMP deaminase) (dCD)	Enterobacteria phage T4 (Bacteriophage T4)	63	83	64	70	7	KHAIIQG	87.63
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	7	21	15	FVPLILAFVGVSISA	87.05
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	37	49	13	DQRHIFTVQFNVG	77.85
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	56	62	7	GDSVTTD	74.1
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	202	211	10	GDSASAEKTD	79.26
DP00584	A2VD23	Protein starmaker	Danio rerio (Zebrafish) (Brachydanio rerio)	1	613	522	530	9	SDSASVEAN	76.25
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	12	40	29	LEALESIYPDSFTVLSESPPSFTITVTSE	80.59
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	47	61	15	TVQTTLKFTYSEKYP	77.75
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	63	77	15	ETPLYEIFSQENLED	78.28
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	79	121	43	DVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTR	82.45
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	144	166	23	TPVTIENFLSWKAKFDAELLEIK	79.96
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	183	204	22	GKQLFETDHNLDTSDIQFLEDA	82.65
DP00587	Q9CQK7	RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1)	Mus musculus (Mouse)	1	243	210	225	16	VDESLFQEMDDLELED	77.15
DP00588	P27958	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1a (isolate H77) (HCV)	1	82	20	36	17	QDVKFPGGGQIVGGVYL	81.53
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1009	1015	7	HVQHIIG	91.26
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1026	1034	9	AHDNFLAGG	80.6
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1053	1061	9	EGQNTVIGG	74.92
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1063	1078	16	GDDVFLQDLGVWSNQL	83.13
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1120	1138	19	PALNLFSVDHVKNIENLHG	78.75
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1186	1197	12	GNDIFLQDDETV	79.1
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1208	1222	15	DTVDYSAMIHPGRIV	79.93
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1225	1240	16	HEYGFGIEADLSREWV	79.95
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1246	1279	34	LGVDYYDNVRNVENVIGTSMKDVLIGDAQANTLM	83.18
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1292	1298	7	GDDLLFG	88.72
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1328	1336	9	GNDWFGQTQ	77.63
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1350	1356	7	DTVDYSQ	79.93
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1359	1376	18	AHAGIAAGRIGLGILADL	78.34
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1388	1412	25	GSSAYDTVSGIENVVGTELADRITG	78.33
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1414	1421	8	AQANVLRG	74.25
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1460	1476	17	GDDWFFQDAANAGNLLD	89.67
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1497	1513	17	AKGVFLSLGKGFASLMD	76.73
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1518	1531	14	SNVLRNIENAVGSA	76.47
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1533	1539	7	DDVLIGD	96.32
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1541	1556	16	GANVLNGLAGNDVLSG	79.06
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1586	1605	20	GDDTYLFGVGYGHDTIYESG	78.04
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1609	1615	7	DTIRINA	79.93
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1617	1625	9	ADQLWFARQ	97.81
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1627	1635	9	NDLEIRILG	81.68
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1637	1648	12	DDALTVHDWYRD	79.93
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1651	1662	12	HRVEIIHAANQA	76.92
DP00591	J7QLC0	Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin	Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)	1006	1706	1664	1680	17	DQAGIEKLVEAMAQYPD	77.06
DP00592	P48539	Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4)	Homo sapiens (Human)	1	62	25	33	9	KVQEEFDID	79.71
DP00592	P48539	Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4)	Homo sapiens (Human)	1	62	42	54	13	AAVAIQSQFRKFQ	79.78
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	545	555	11	LQQLHTLQSQA	79.87
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	576	597	22	NSGGYNYHGHFNAINASANLSP	81.01
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	601	610	10	ASSLYEYNGV	92.17
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	612	619	8	AADNFYGQ	95.23
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	624	667	44	QQQSYQQHNYNSHNGERYSLPTFPTISELAAATAAVEAAAAATV	81.89
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	695	702	8	KLAKITLN	75.5
DP00594	P49869	Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4)	Drosophila melanogaster (Fruit fly)	523	753	712	718	7	ALQLNSA	85.28
DP00605	Q24246	Cytoplasmic dynein 1 intermediate chain (DH IC) (Dynein intermediate chain; cytosolic) (Protein short wing)	Drosophila melanogaster (Fruit fly)	109	135	109	121	13	NLSVYNVQATNIP	81.35
DP00605	Q24246	Cytoplasmic dynein 1 intermediate chain (DH IC) (Dynein intermediate chain; cytosolic) (Protein short wing)	Drosophila melanogaster (Fruit fly)	109	135	124	130	7	ETLVYTK	86.67
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	1	9	9	MAEEYKNTV	75.73
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	31	38	8	GMFDFLKK	80.6
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	57	67	11	KTQISEPESFV	75.25
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	134	148	15	DHVKTVEEENQGVMD	74.16
DP00606	P42759	Dehydrin ERD10 (Low-temperature-induced protein LTI45)	Arabidopsis thaliana (Mouse-ear cress)	1	260	209	224	16	QVVNTTPLVETATPIA	79.35
DP00607	Q16595	Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN)	Homo sapiens (Human)	1	41	9	16	8	VAGLLASP	79.93
DP00607	Q16595	Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN)	Homo sapiens (Human)	1	41	20	27	8	QAQTLTRV	74.67
DP00607	Q16595	Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN)	Homo sapiens (Human)	42	86	61	79	19	GLNQIWNVKKQSVYLMNLR	80.21
DP00608	Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	Homo sapiens (Human)	59	129	63	75	13	AFPEIHVAQYPLD	75.25
DP00608	Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	Homo sapiens (Human)	59	129	84	102	19	NALAIQVDSEGKIKYDAIA	80.87
DP00608	Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	Homo sapiens (Human)	59	129	108	118	11	KDKVIYSKYTD	85.92
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	11	19	9	TNPFYASSG	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	21	37	17	SGKTYASVVAAAAAAAA	74.9
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	118	125	8	DDVSSLSP	75.25
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	154	162	9	GESKIENGS	84.62
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	210	239	30	SDNVIEEEGVELTDKGDVIVNSSPVESVHV	83.71
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	256	278	23	EELKINADAETLEVANKFDQIGD	83.36
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	288	308	21	SDKAIEEVEEKFTSESDSIAD	81.27
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	324	330	7	VVAAESG	73.91
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	344	361	18	KGMTYAEVIKAASAVADN	77.63
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	392	403	12	DSSAIEAVNVDV	76.51
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	414	427	14	VEVSEVLETDGNIP	81.77
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	442	449	8	GEVELESD	74.96
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	475	484	10	VDADINVAEP	75.72
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	493	500	8	KEAVIKED	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	506	515	10	VDKTISNIEE	91
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	519	536	18	LTAAYDGNFELAVKEISE	82.66
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	549	556	8	VEVEELPV	77.26
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	575	581	7	AESQFEV	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	636	656	21	TEEMIFGSSEAAKQFLAELEK	80.24
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	666	675	10	DEANISNNMS	78.8
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	678	686	9	IDGQIVTDS	76.44
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	1	727	705	713	9	ALAALLKAA	75.88
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	210	239	30	SDNVIEEEGVELTDKGDVIVNSSPVESVHV	83.71
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	256	278	23	EELKINADAETLEVANKFDQIGD	83.36
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	288	308	21	SDKAIEEVEEKFTSESDSIAD	81.27
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	324	330	7	VVAAESG	73.91
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	163	374	344	361	18	KGMTYAEVIKAASAVADN	77.63
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	414	427	14	VEVSEVLETDGNIP	81.77
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	442	449	8	GEVELESD	74.96
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	475	484	10	VDADINVAEP	75.72
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	493	500	8	KEAVIKED	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	506	515	10	VDKTISNIEE	91
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	519	536	18	LTAAYDGNFELAVKEISE	82.66
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	549	556	8	VEVEELPV	77.26
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	408	627	575	581	7	AESQFEV	79.93
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	646	656	11	AAKQFLAELEK	79.14
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	666	675	10	DEANISNNMS	78.8
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	678	686	9	IDGQIVTDS	76.44
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	705	713	9	ALAALLKAA	75.88
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	720	729	10	EGGNFTITSQ	81.24
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	731	738	8	GTKLFSMD	82.27
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	759	783	25	NRSNIFSNSNVTMADETEINLSEEE	81.74
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	790	825	36	LQSLRVKFLRLLQRLGHSAEDSIAAQVLYRLALLAG	78.37
DP00609	O81283	Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86)	Arabidopsis thaliana (Mouse-ear cress)	639	839	828	834	7	AGQLFSL	80.36
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	3	12	10	DGTEFVVRSD	75.25
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	44	56	13	EDEVFEEAIGSEN	78.06
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	66	73	8	KRELFESD	76.92
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	76	82	7	PLVETLK	73.91
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	91	97	7	EDFEEAV	75.92
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	100	108	9	LDETSSNEG	75.25
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	111	119	9	KDFTAVGES	74.58
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	123	134	12	GEAEFDVLATKM	79.93
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	160	182	23	TENATSTNTNGSNLAAEHVGIEN	78.03
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	186	194	9	HSFLGNGIA	74.8
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	217	227	11	NDGIEVDNWEE	80.12
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	231	252	22	GIQTEQEVEEGEGTTENQFEKR	78.96
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	264	272	9	SKNLFEKQT	80.27
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	284	291	8	KDLFENGS	80.27
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	306	320	15	TGAAYTSNIVTNASG	83.9
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	322	331	10	NEVSSAVTSS	79.06
DP00610	Q9SLF3	Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein)	Arabidopsis thaliana (Mouse-ear cress)	1	455	368	375	8	TEVHSNSG	80.27
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	22	29	8	RQKLIFSP	87.29
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	51	59	9	EDSAFQEPD	86.96
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	111	123	13	GDSWEEEGFGSSS	80.27
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	129	140	12	AAPYFLGSSFSP	83.05
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	231	239	9	PQVNINPFT	85.73
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	242	248	7	SLLLHSS	75.63
DP00611	P30291	Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)	Homo sapiens (Human)	1	292	255	262	8	KRTYWNDS	78.76
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	42	70	29	LGLVFGVIVVCFAMLYPTLFHPMLMGFLG	84.85
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	113	119	7	QAQAESQ	76.21
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	125	147	23	GMFTWMLPVYTIGVVLFLLYTLF	82.01
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	157	165	9	KKRNYFDSE	83.5
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	173	182	10	SETKYGGKFG	74.98
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	199	210	12	AMSKILEQLESV	81.16
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	226	232	7	SEQLEED	74.25
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	238	267	30	AVGLTETNEQYIKDLEVALKEFQSLSKEYD	80.21
DP00613	Q22472	Resistance to inhibitors of cholinesterase protein 3	Caenorhabditis elegans	1	378	294	305	12	ELSEIEEEEEEV	85.28
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2213	2308	2223	2235	13	DADLIEANLLWRQ	80.6
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2213	2308	2237	2258	22	MGGNITRVESENKVVILDSFEP	86.96
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2213	2308	2297	2303	7	LLESWKD	75.25
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2218	2314	2223	2235	13	DADLIEANLLWRQ	80.6
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2218	2314	2237	2258	22	MGGNITRVESENKVVILDSFEP	86.96
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2218	2314	2297	2303	7	LLESWKD	75.25
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2221	2314	2223	2235	13	DADLIEANLLWRQ	80.6
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2221	2314	2237	2258	22	MGGNITRVESENKVVILDSFEP	86.96
DP00615	Q9WMX2	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 1b (isolate Con1) (HCV)	2221	2314	2297	2303	7	LLESWKD	75.25
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	194	211	18	SSELYTEASGYISSLEYP	77.31
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	218	226	9	LRCNYSIRV	79.71
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	232	243	12	LHLKFLEPFDID	77.26
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	252	267	16	YDQLQIYANGKNIGEF	83.57
DP00621	P00736	Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain	Homo sapiens (Human)	193	305	282	291	10	AVDLLFFTDE	80.1
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	1	174	1	13	13	MNSYFEQASGFYG	82.66
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	1	174	36	79	44	AAAAYRGFPLSLGMSPYANHHLQRTTQDSPYDASITAACNKIYG	80.65
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	1	174	95	107	13	DAVNGYKDIWNTG	81.07
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	1	174	137	148	12	NAANANGQNNPA	73.91
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	235	286	235	246	12	SNHTFYPWMAIA	77.65
DP00623	P83949	Homeotic protein ultrabithorax	Drosophila melanogaster (Fruit fly)	235	286	264	281	18	QYGGISTDMGKRYSESLA	75.92
DP00624	P35638	DNA damage-inducible transcript 3 protein (DDIT-3) (C/EBP zeta) (C/EBP-homologous protein) (CHOP) (C/EBP-homologous protein 10) (CHOP-10) (CCAAT/enhancer-binding protein homologous protein) (Growth arrest and DNA damage-inducible protein GADD153)	Homo sapiens (Human)	116	168	132	147	16	AQLAEENERLKQEIER	74.87
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	80	88	9	DLEVIISLG	78.67
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	98	109	12	LLDSYSTAATSS	77.2
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	111	136	26	KDVISVATDVSNTITKTSDERLITEG	82.81
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	139	147	9	NQGVTATTV	75.81
DP00625	P45976	Pre-mRNA polyadenylation factor FIP1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	80	195	168	181	14	KEGIFDSVGITTID	82.27
DP00626	P0AG11	"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD"	Escherichia coli (strain K12)	1	139	8	27	20	DLREIVTFPLFSDLVQCGFP	82.54
DP00626	P0AG11	"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD"	Escherichia coli (strain K12)	1	139	31	80	50	ADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITA	83.16
DP00626	P0AG11	"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD"	Escherichia coli (strain K12)	1	139	83	96	14	GDIVIAAVDGEFTV	78.88
DP00626	P0AG11	"Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD"	Escherichia coli (strain K12)	1	139	104	134	31	TVQLIPMNSAYSPITISSEDTLDVFGVVIHV	81.51
DP00628	P15309	"Prostatic acid phosphatase (PAP) (EC 3.1.3.2) (5-nucleotidase) (5-NT) (EC 3.1.3.5) (Acid phosphatase 3) (Ecto-5-nucleotidase) (Protein tyrosine phosphatase ACP3) (EC 3.1.3.48) (Thiamine monophosphatase) (TMPase) Cleaved into: PAPf39"	Homo sapiens (Human)	248	286	260	271	12	GGVLVNEILNHM	78.76
DP00629	Q07097	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Sendai virus (strain Fushimi) (SeV)	401	524	413	432	20	GGGAIEVALDNADIDLETEA	77.46
DP00629	Q07097	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Sendai virus (strain Fushimi) (SeV)	401	524	454	462	9	SGGHFVTLH	80.01
DP00629	Q07097	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Sendai virus (strain Fushimi) (SeV)	402	524	413	432	20	GGGAIEVALDNADIDLETEA	77.46
DP00629	Q07097	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Sendai virus (strain Fushimi) (SeV)	402	524	454	462	9	SGGHFVTLH	80.01
DP00630	O76070	Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR)	Homo sapiens (Human)	1	127	6	12	7	KGFSIAK	87.29
DP00630	O76070	Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR)	Homo sapiens (Human)	1	127	24	40	17	QGVTEAAEKTKEGVMYV	80.27
DP00630	O76070	Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR)	Homo sapiens (Human)	1	127	47	93	47	NVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSG	79.06
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	67	76	10	MTSPFNGLTS	74.45
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	88	97	10	KRTLFQFESH	77.46
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	111	139	29	RVNRILFPTQQNVDIDAAEEEEEGEVLLP	79.23
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	147	155	9	RQLHLSLER	74.58
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	175	191	17	SDKVITFELAKNWNNNS	78.65
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	204	212	9	EEDIIINPV	95.13
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	225	231	7	VTQEIRN	80.03
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	284	244	254	11	IEDVITYVNKK	90.12
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	90	67	76	10	MTSPFNGLTS	74.45
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	67	76	10	MTSPFNGLTS	74.45
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	88	97	10	KRTLFQFESH	77.46
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	111	139	29	RVNRILFPTQQNVDIDAAEEEEEGEVLLP	79.23
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	147	155	9	RQLHLSLER	74.58
DP00631	P38634	Protein SIC1 (CDK inhibitor p40)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	31	190	175	185	11	SDKVITFELAK	79.96
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	4	11	8	TDYSTYSQ	89.88
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	14	23	10	AQQGYSAYTA	81.97
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	29	45	17	YAQTTQAYGQQSYGTYG	84.87
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	48	72	25	TDVSYTQAQTTATYGQTAYATSYGQ	82.69
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	82	88	7	APQAYSQ	87.29
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	94	128	35	GTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYG	83.73
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	166	174	9	GQSNYSYPQ	78.52
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	203	233	31	YDQSSYSQQNTYGQPSSYGQQSSYGQQSSYG	83.55
DP00632	Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	Homo sapiens (Human)	1	264	243	259	17	QTGSYSQAPSQYSQQSS	76.37
DP00633	Q09472	Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)	Homo sapiens (Human)	401	566	425	432	8	NQQPILTG	82.61
DP00633	Q09472	Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)	Homo sapiens (Human)	401	566	455	480	26	TVSQIDPSSIERAYAALGLPYQVNQM	80.74
DP00633	Q09472	Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)	Homo sapiens (Human)	401	566	533	541	9	LHSAINSQN	80.3
DP00636	P17120	Kinesin-like protein bimC	Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)	1	71	44	50	7	KTAAISR	86.29
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	400	525	414	429	16	QAQVSFLHGDQSENEL	85.03
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	400	525	492	508	17	ADALLRLQAMAGISEEQ	75.76
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	400	525	514	520	7	TPIVYND	80.55
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	401	525	414	429	16	QAQVSFLHGDQSENEL	85.03
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	401	525	492	508	17	ADALLRLQAMAGISEEQ	75.76
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	401	525	514	520	7	TPIVYND	80.55
DP00640	Q89933	Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)	Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus)	401	486	414	429	16	QAQVSFLHGDQSENEL	85.03
DP00641	P51671	Eotaxin (C-C motif chemokine 11) (Eosinophil chemotactic protein) (Small-inducible cytokine A11)	Homo sapiens (Human)	1	31	4	19	16	SAALLWLLLIAAAFSP	80.56
DP00644	P22362	C-C motif chemokine 1 (Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309)	Homo sapiens (Human)	1	23	1	18	18	MQIITTALVCLLLAGMWP	82.29
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	5	19	15	QCVEELEDDVFQSED	75.25
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	27	41	15	GGLLSADLFAQSQLD	76.21
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	46	53	8	RLQLFPLT	87.29
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	69	75	7	ATQTLSP	79.26
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	92	104	13	PQRLFYGNAGYRL	80.42
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	123	135	13	GQFLQHRAEVQIA	83.33
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	137	148	12	KLQCIADQFHRL	75.61
DP00645	Q91ZE9	Bcl-2-modifying factor	Mus musculus (Mouse)	1	185	153	176	24	HQQNRDRAWWQVFLFLQNLALNRQ	80.48
DP00646	Q01231	Gap junction alpha-5 protein (Connexin-40) (Cx40)	Mus musculus (Mouse)	251	355	275	287	13	SGEKFFSDFSNNM	77.95
DP00646	Q01231	Gap junction alpha-5 protein (Connexin-40) (Cx40)	Mus musculus (Mouse)	251	355	303	329	27	NQEQIPGEGFIHMHYSQKPEYASGASA	79.39
DP00654	Q9ZPI5	Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 (AtMPF2) Includes: Enoyl-CoA hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase (EC 4.2.1.17) (EC 5.1.2.3) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)	Arabidopsis thaliana (Mouse-ear cress)	576	596	582	590	9	RKGFYLYDD	94.83
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	141	250	160	174	15	VIEDILNLESSSTSS	79.15
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	141	250	179	195	17	SPGLYSKTMTPTYDPIN	76.02
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	141	250	199	208	10	ALSTMTWFGD	82.68
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	141	250	215	222	8	NCSVLAFS	80.14
DP00655	P59113	Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1)	Mus musculus (Mouse)	653	677	658	672	15	KDQNETLDEDLFHKL	76.01
DP00656	P07674	Transcriptional repressor protein KorB	Escherichia coli	1	64	30	42	13	GLDSIGDLSSLLD	75.3
DP00656	P07674	Transcriptional repressor protein KorB	Escherichia coli	252	294	259	266	8	TVDAFNGQ	84.62
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	1	7	7	MAEEYKN	76.06
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	31	40	10	DRGLFDFLGK	84.82
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	60	66	7	KAQISEP	79.93
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	73	91	19	EEVKENKITLLEELQEKTE	76.71
DP00657	P31168	Dehydrin COR47 (Cold-induced COR47 protein)	Arabidopsis thaliana (Mouse-ear cress)	1	265	97	110	14	KPSVIEKLHRSNSS	73.91
DP00658	P42758	Dehydrin Xero 2 (Low-temperature-induced protein LTI30)	Arabidopsis thaliana (Mouse-ear cress)	1	193	87	98	12	GTNTTYGTTNTG	79.49
DP00658	P42758	Dehydrin Xero 2 (Low-temperature-induced protein LTI30)	Arabidopsis thaliana (Mouse-ear cress)	1	193	126	140	15	TNTAYGTNTNVVHHE	79.93
DP00658	P42758	Dehydrin Xero 2 (Low-temperature-induced protein LTI30)	Arabidopsis thaliana (Mouse-ear cress)	1	193	163	185	23	TTTSYGNTGVVHHENKSTMDKIK	74.49
DP00659	P16458	Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit)	Sterkiella nova (Ciliate) (Oxytricha nova)	233	385	275	283	9	SVDKIVKYT	89.97
DP00659	P16458	Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit)	Sterkiella nova (Ciliate) (Oxytricha nova)	233	385	333	345	13	TMAQFVKYLDWHE	84.54
DP00659	P16458	Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit)	Sterkiella nova (Ciliate) (Oxytricha nova)	233	385	366	372	7	KASATSG	75.92
DP00661	Q9CX60	Protein LBH (Limb bud and heart-expressed protein)	Mus musculus (Mouse)	1	105	1	15	15	MSVYFPIHCSDYLRS	79.82
DP00661	Q9CX60	Protein LBH (Limb bud and heart-expressed protein)	Mus musculus (Mouse)	1	105	27	34	8	SMEEIGLS	79.93
DP00661	Q9CX60	Protein LBH (Limb bud and heart-expressed protein)	Mus musculus (Mouse)	1	105	37	47	11	KDGLSYQIFPD	86.87
DP00661	Q9CX60	Protein LBH (Limb bud and heart-expressed protein)	Mus musculus (Mouse)	1	105	71	81	11	GEVESGELRWP	76.25
DP00662	Q8LBP4	Inner membrane protein ALBINO3; chloroplastic	Arabidopsis thaliana (Mouse-ear cress)	339	462	341	354	14	NNVLSTAQQVYLRK	83.44
DP00662	Q8LBP4	Inner membrane protein ALBINO3; chloroplastic	Arabidopsis thaliana (Mouse-ear cress)	339	462	365	372	8	NASKIISA	85.54
DP00662	Q8LBP4	Inner membrane protein ALBINO3; chloroplastic	Arabidopsis thaliana (Mouse-ear cress)	339	462	408	421	14	DTVELVEESQSESE	76.21
DP00662	Q8LBP4	Inner membrane protein ALBINO3; chloroplastic	Arabidopsis thaliana (Mouse-ear cress)	339	462	434	442	9	GALASSTTS	76.14
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	10	22	13	HGSKYLASASTMD	78.31
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	39	46	8	SLGRFFGA	79.01
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	85	94	10	PVVHFFKNIV	86.76
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	108	118	11	GLSLSRFSWGA	76.28
DP00663	P81558	Myelin basic protein (MBP)	Sus scrofa (Pig)	1	171	147	158	12	AQGTLSKIFKLG	79.68
DP00664	Q01417	18 kDa seed maturation protein	Glycine max (Soybean) (Glycine hispida)	1	173	7	24	18	AGESIKETATNIGASAKA	78.71
DP00664	Q01417	18 kDa seed maturation protein	Glycine max (Soybean) (Glycine hispida)	1	173	77	83	7	KQSATTA	79.93
DP00664	Q01417	18 kDa seed maturation protein	Glycine max (Soybean) (Glycine hispida)	1	173	98	109	12	GTATYSTTGEYG	78.62
DP00666	P32004	Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171)	Homo sapiens (Human)	1144	1257	1147	1153	7	KGGKYSV	78.26
DP00666	P32004	Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171)	Homo sapiens (Human)	1144	1257	1169	1181	13	KDETFGEYRSLES	85.7
DP00666	P32004	Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171)	Homo sapiens (Human)	1144	1257	1215	1231	17	VDVQFNEDGSFIGQYSG	82.06
DP00667	P42763	Dehydrin ERD14	Arabidopsis thaliana (Mouse-ear cress)	1	185	1	7	7	MAEEIKN	75.25
DP00667	P42763	Dehydrin ERD14	Arabidopsis thaliana (Mouse-ear cress)	1	185	27	36	10	DRGLFDFLGK	84.82
DP00667	P42763	Dehydrin ERD14	Arabidopsis thaliana (Mouse-ear cress)	1	185	48	60	13	IASEFEQKVHISE	86.13
DP00669	P81019	Seminal plasma protein BSP-30 kDa (BSP-30K)	Bos taurus (Bovine)	26	96	52	66	15	PPEIYTTTFLPRTIY	76.79
DP00672	Q92886	Neurogenin-1 (NGN-1) (Class A basic helix-loop-helix protein 6) (bHLHa6) (Neurogenic basic-helix-loop-helix protein) (Neurogenic differentiation factor 3) (NeuroD3)	Homo sapiens (Human)	90	150	127	145	19	KLTKIETLRFAYNYIWALA	83.51
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	1	24	12	18	7	RAVNMLK	77.26
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	12	18	7	RAVNMLK	77.26
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	24	30	7	GLSLIGL	95.32
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	45	60	16	RFVLALLAFFRFTAIA	84.64
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	79	85	7	KHLLSFK	80.27
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	2	105	89	96	8	GTLTSAIN	87.88
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	76	105	79	85	7	KHLLSFK	80.27
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	76	105	89	96	8	GTLTSAIN	87.88
DP00673	P06935	Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5)	West Nile virus (WNV)	80	105	89	96	8	GTLTSAIN	87.88
DP00674	Q69422	Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Hepatitis GB virus B (GBV-B) (GB virus B)	2	155	21	34	14	QTQASYPVSIKTSV	78.19
DP00674	Q69422	Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Hepatitis GB virus B (GBV-B) (GB virus B)	2	155	51	71	21	RNYKIAGIHDGLQTLAQAALP	79.07
DP00674	Q69422	Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Hepatitis GB virus B (GBV-B) (GB virus B)	2	155	86	104	19	NLGILLDYPLGWIGDVTTH	78.56
DP00674	Q69422	Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Hepatitis GB virus B (GBV-B) (GB virus B)	2	155	119	150	32	PVCQIVRLLEDGVNWATGWFGVHLFVVCLLSL	79.95
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	169	270	208	221	14	PDATIVVEGVKYQV	83.44
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	169	270	233	241	9	QDGLYHNKN	86.96
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	169	270	253	265	13	ALLAWAIIAIVLF	87.39
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	170	260	208	221	14	PDATIVVEGVKYQV	83.44
DP00675	P19711	Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)	Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)	170	260	233	241	9	QDGLYHNKN	86.96
DP00677	P12810	16.9 kDa class I heat shock protein 1 (HSP 16.9) (Heat shock protein 16.9A) (Heat shock protein 17) (Low molecular weight heat shock protein)	Triticum aestivum (Wheat)	1	42	6	19	14	RSNVFDPFADLWAD	76.97
DP00677	P12810	16.9 kDa class I heat shock protein 1 (HSP 16.9) (Heat shock protein 16.9A) (Heat shock protein 17) (Low molecular weight heat shock protein)	Triticum aestivum (Wheat)	1	42	23	32	10	TFRSIVPAIS	81.07
DP00678	P11171	Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1)	Homo sapiens (Human)	800	864	800	807	8	TTQITKTV	75.92
DP00678	P11171	Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1)	Homo sapiens (Human)	800	864	818	841	24	KRIVITGDADIDHDQVLVQAIKEA	82.65
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	26	37	12	LTSFLIQDILRD	82.83
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	73	79	7	NDQLSTG	81.27
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	86	94	9	EAETLAETE	74.25
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	98	111	14	HLGSYLLDSENTSG	78.12
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	127	151	25	SRAAFSHTQVIELERKFSHQKYLSA	78.53
DP00683	Q99801	Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)	Homo sapiens (Human)	1	184	166	176	11	TQVKIWFQNRR	85.95
DP00689	P30185	Dehydrin Rab18	Arabidopsis thaliana (Mouse-ear cress)	1	186	9	29	21	GGQATDEYGNPIQQQYDEYGN	76.7
DP00689	P30185	Dehydrin Rab18	Arabidopsis thaliana (Mouse-ear cress)	1	186	46	73	28	GGQGYGTGGQGYGSGGQGYGTGGQGYGT	75.25
DP00693	P45561	Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP)	Sus scrofa (Pig)	2	173	2	16	15	GTWILFACLLGAAFS	79.75
DP00693	P45561	Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP)	Sus scrofa (Pig)	2	173	25	47	23	HPGYINFSYEVLTPLKWYQNMIR	83.36
DP00693	P45561	Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP)	Sus scrofa (Pig)	2	173	63	72	10	HHQIIPVVSQ	75.85
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	20	45	26	ADEGFWDCSVCTFRNSAEAFKCSICD	77.48
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	60	70	11	QLVAQQVAQQY	77.29
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	124	144	21	EANSIQSANATTKTSETNHTS	77.35
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	156	176	21	AQQLAVTVGNVTVIITDFKEK	80.12
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	1	228	194	202	9	EQQNQSSSG	73.58
DP00694	Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	Homo sapiens (Human)	145	179	156	174	19	AQQLAVTVGNVTVIITDFK	80.04
DP00697	Q9IK92	Nucleoprotein (Protein N) (Nucleocapsid protein)	Nipah virus	400	532	418	430	13	GGVLIGGSDQDID	86.91
DP00697	Q9IK92	Nucleoprotein (Protein N) (Nucleocapsid protein)	Nipah virus	400	532	441	459	19	RQSVTFKREMSISSLANSV	80.16
DP00697	Q9IK92	Nucleoprotein (Protein N) (Nucleocapsid protein)	Nipah virus	400	532	469	481	13	GTRLTNSLLNLRS	75.56
DP00697	Q9IK92	Nucleoprotein (Protein N) (Nucleocapsid protein)	Nipah virus	400	532	498	511	14	DDPAISNRTQGESE	75.78
DP00698	O89339	Nucleoprotein (Protein N) (Nucleocapsid protein)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	400	532	425	437	13	GEQDIDEEEEPIE	77.26
DP00698	O89339	Nucleoprotein (Protein N) (Nucleocapsid protein)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	400	532	441	447	7	RQSVTFK	85.05
DP00698	O89339	Nucleoprotein (Protein N) (Nucleocapsid protein)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	400	532	469	481	13	GTRLTNSLLNLRS	75.56
DP00698	O89339	Nucleoprotein (Protein N) (Nucleocapsid protein)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	400	532	484	498	15	AAKAIKESTAQSSSE	77.53
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	9	39	31	DGLNIIDFIQKNQKEIQKTYGRSSIQQPSIK	79.91
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	46	59	14	EDFLQCTSGESEQV	75.78
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	112	118	7	TDVVYHD	79.07
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	125	131	7	GYGFTSS	79.41
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	135	153	19	GWSDYTSGANNGNVCLVSD	74.67
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	155	169	15	KMLSYAPEIAVSKED	80.25
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	173	185	13	DLVHLENKLSTTG	74.79
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	189	200	12	TAVPFTLRNLSD	76.56
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	208	220	13	IAEHYYGLGVKEQ	90.66
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	228	241	14	RNVNLDSIKLYTSD	76.92
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	245	267	23	ADQLEFEDEFAGSSSEVIVGISP	81.85
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	283	304	22	IGRTIEGQSIRDNLQAKDNKST	75.49
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	328	335	8	LAEEFECS	77.26
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	338	355	18	EDPIIRELLKENSLINCQ	81.94
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	364	373	10	YHWSIERSIS	80.47
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	406	378	388	11	EIVNGAVQTAD	76.89
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	100	9	39	31	DGLNIIDFIQKNQKEIQKTYGRSSIQQPSIK	79.91
DP00699	Q9IK91	Phosphoprotein (Protein P)	Nipah virus	1	100	46	59	14	EDFLQCTSGESEQV	75.78
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	10	34	25	GLDIIDFIQKNQKEIQKTYGRSSIQ	78.74
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	46	54	9	EDFLQSTSG	75.88
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	79	101	23	SSVTSSDGTIGQRVSNTRAWAED	78.19
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	112	118	7	TDVVYHD	79.07
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	134	140	7	RGWSYHM	79.93
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	168	184	17	EVREIDLIGLEDKFASA	76.92
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	207	215	9	VIPEYYYGS	86.36
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	228	241	14	GNVNLDSIKIYTSD	80.67
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	245	265	21	ENQLEYEDEFAKSSSEVVIDT	83.53
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	327	335	9	MLSEEFECS	79.34
DP00700	O55778	Phosphoprotein (Protein P)	Hendra virus (isolate Horse/Autralia/Hendra/1994)	1	404	338	347	10	DDPIIQELER	75.82
DP00702	P46937	Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog)	Homo sapiens (Human)	50	171	50	57	8	AGHQIVHV	75.59
DP00702	P46937	Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog)	Homo sapiens (Human)	50	171	59	73	15	GDSETDLEALFNAVM	78.13
DP00705	P22943	12 kDa heat shock protein (Glucose and lipid-regulated protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	109	21	35	15	SQKSYAEQGKEYITD	80.22
DP00705	P22943	12 kDa heat shock protein (Glucose and lipid-regulated protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	109	49	55	7	NKGVFQG	74.25
DP00705	P22943	12 kDa heat shock protein (Glucose and lipid-regulated protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	109	69	82	14	GQGESLADQARDYM	74.25
DP00705	P22943	12 kDa heat shock protein (Glucose and lipid-regulated protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	109	91	98	8	DAVEYVSG	77.3
DP00706	Q15517	Corneodesmosin (S protein)	Homo sapiens (Human)	60	171	64	70	7	GFSSYSG	92.64
DP00706	Q15517	Corneodesmosin (S protein)	Homo sapiens (Human)	60	171	74	80	7	SGSSISS	76.78
DP00706	Q15517	Corneodesmosin (S protein)	Homo sapiens (Human)	60	171	109	119	11	GTGYSQVSYSS	79.6
DP00706	Q15517	Corneodesmosin (S protein)	Homo sapiens (Human)	60	171	157	166	10	SSSSFQFSSS	77.39
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	161	243	170	176	7	NAENTAS	81.61
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	161	243	191	203	13	LEQLLALYVAEIR	81.73
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	161	243	218	228	11	PDSAYLQEARL	84.62
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	347	420	372	383	12	LDEVISKYAMLQ	89.72
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	347	420	398	406	9	LQGTSSHSA	75.25
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	498	509	12	SSLQISNEKNLE	77.26
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	539	550	12	APSSIDAESNGE	75.14
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	563	575	13	VSQLFELEIEALP	79.6
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	598	614	17	TTVLENGAGMVSSTSFN	79.58
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	644	652	9	LGNSYVERQ	86.96
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	495	740	692	702	11	GLVTSSLCIPS	85.62
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	566	739	566	575	10	LFELEIEALP	78.56
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	566	739	598	614	17	TTVLENGAGMVSSTSFN	79.58
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	566	739	644	652	9	LGNSYVERQ	86.96
DP00707	Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	Homo sapiens (Human)	566	739	692	702	11	GLVTSSLCIPS	85.62
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	570	578	9	SQLAELEME	79.34
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	596	613	18	SLPTILENGAAVVTSTSV	77.93
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	643	650	8	LLGNSYIK	86.37
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	658	664	7	SGQNTSV	80.22
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	673	684	12	ASVASVADSSTR	80.6
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	690	698	9	HELVTSSLC	79.34
DP00708	O35613	Death domain-associated protein 6 (Daxx)	Mus musculus (Mouse)	566	739	711	726	16	AQSLRQCIYKTSVATQ	82.63
DP00709	Q9Y3M2	Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1)	Homo sapiens (Human)	1	63	3	9	7	FFGNTFS	86.34
DP00709	Q9Y3M2	Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1)	Homo sapiens (Human)	1	63	18	27	10	SASLSNLHSL	80.6
DP00709	Q9Y3M2	Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1)	Homo sapiens (Human)	1	63	35	42	8	ELGLEYGS	84.16
DP00709	Q9Y3M2	Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1)	Homo sapiens (Human)	1	63	49	58	10	GQSLKFENGQ	81.47
DP00716	P02545	Prelamin-A/C Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32)	Homo sapiens (Human)	567	664	575	583	9	DPAEYNLRS	77.33
DP00716	P02545	Prelamin-A/C Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32)	Homo sapiens (Human)	567	664	617	627	11	ASSVTVTRSYR	74.25
DP00716	P02545	Prelamin-A/C Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32)	Homo sapiens (Human)	567	664	633	652	20	GGGSFGDNLVTRSYLLGNSS	75.69
DP00717	P35521	Methylosome subunit pICln (Chloride channel; nucleotide sensitive 1A) (Chloride conductance regulatory protein ICln) (I(Cln))	Canis lupus familiaris (Dog) (Canis familiaris)	93	115	103	110	8	DVEPIAEF	80.31
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	9	111	14	31	18	SDSFTDTLSANISQEMTM	76.77
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	9	111	41	55	15	TNFGISSVDLSVMED	82.45
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	9	111	63	84	22	KPFTTVDFSSISTPHYEDIPFT	75.68
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	9	111	91	106	16	ADYKYDLKLQEYQSAI	85.64
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	112	174	119	125	7	KTQLYNK	96.99
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	112	174	133	139	7	SLMAIEC	75.2
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	112	174	147	153	7	SGFHYGV	87.29
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	238	278	243	255	13	AKHLYDSYIKSFP	78.85
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	238	278	260	267	8	KARAILTG	75.84
DP00718	P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	Homo sapiens (Human)	453	477	456	472	17	SSQLFAKLLQKMTDLRQ	78.18
DP00719	Q13569	G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG)	Homo sapiens (Human)	1	50	5	29	25	NAGSYSLQQAQAFYTFPFQQLMAEA	82.78
DP00719	Q13569	G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG)	Homo sapiens (Human)	51	111	94	103	10	KQEKITDTFK	87.29
DP00719	Q13569	G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG)	Homo sapiens (Human)	340	410	360	369	10	SNGLIESVEL	79.97
DP00719	Q13569	G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG)	Homo sapiens (Human)	340	410	371	399	29	GESAFSGIPNGQWMTQSFTDQIPSFSNHC	79.77
DP00720	Q05344	FACT complex subunit Ssrp1 (Chorion-factor 5) (Facilitates chromatin transcription complex subunit Ssrp1) (Recombination signal sequence recognition protein) (Single-strand recognition protein) (dSSRP1)	Drosophila melanogaster (Fruit fly)	437	518	488	501	14	SDVAEEYDSNVESD	86.86
DP00720	Q05344	FACT complex subunit Ssrp1 (Chorion-factor 5) (Facilitates chromatin transcription complex subunit Ssrp1) (Recombination signal sequence recognition protein) (Single-strand recognition protein) (dSSRP1)	Drosophila melanogaster (Fruit fly)	625	723	659	665	7	SKEYISD	78.4
DP00721	Q8IRG6	FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16)	Drosophila melanogaster (Fruit fly)	889	1044	889	916	28	KEWLNSCDIRYSEGVQSLNWQKIMKTIT	78.83
DP00721	Q8IRG6	FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16)	Drosophila melanogaster (Fruit fly)	889	1044	919	932	14	PEGFFEQGGWTFLD	85.12
DP00721	Q8IRG6	FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16)	Drosophila melanogaster (Fruit fly)	889	1044	939	953	15	GENETAESEEDEAYN	82.34
DP00721	Q8IRG6	FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16)	Drosophila melanogaster (Fruit fly)	889	1044	965	979	15	EDSEYSEASEDSEES	87.29
DP00722	P0AGE2	Single-stranded DNA-binding protein (SSB)	Escherichia coli O157:H7	113	177	144	151	8	GGNQFSGG	75.59
DP00724	Q9LQT8	DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2)	Arabidopsis thaliana (Mouse-ear cress)	11	113	27	38	12	MDELLAVLGYKV	80.16
DP00724	Q9LQT8	DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2)	Arabidopsis thaliana (Mouse-ear cress)	11	113	47	58	12	AQKLEQLEVMMS	78.93
DP00724	Q9LQT8	DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2)	Arabidopsis thaliana (Mouse-ear cress)	11	113	66	89	24	SQLATETVHYNPAELYTWLDSMLT	81.55
DP00724	Q9LQT8	DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2)	Arabidopsis thaliana (Mouse-ear cress)	11	113	96	108	13	SNAEYDLKAIPGD	78.36
DP00725	P41851	Type II secretion system protein M (T2SS protein M) (Cholera toxin secretion protein EpsM) (General secretion pathway protein M)	Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)	44	85	58	75	18	KQLLSWVSENANDIVTLR	76.92
DP00728	P00760	Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2	Bos taurus (Bovine)	4	47	4	16	13	FIFLALLGAAVAF	85.23
DP00728	P00760	Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2	Bos taurus (Bovine)	4	47	20	42	23	DDDKIVGGYTCGANTVPYQVSLN	78.92
DP00728	P00760	Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2	Bos taurus (Bovine)	68	89	74	84	11	GEDNINVVEGN	82.61
DP00729	P00974	Pancreatic trypsin inhibitor (Aprotinin) (Basic protease inhibitor) (BPI) (BPTI)	Bos taurus (Bovine)	14	38	15	23	9	LLGTLAAST	75.59
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	18	24	7	TAGNLET	75.82
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	26	43	18	GSQGIAEEVAEGTVGTSD	76.25
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	69	80	12	GEASILDELKTD	78.9
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	169	181	13	GAEVTVNEAETES	80.4
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	231	237	7	RAAVIPS	78.26
DP00742	Q99LM3	Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM)	Mus musculus (Mouse)	1	341	313	336	24	NRKAIMDKFGGAASGPTALFRNTK	75.5
DP00747	P01160	Natriuretic peptides A (Atrial natriuretic factor prohormone) (proANF) (Atrial natriuretic peptide prohormone) (preproANP) (proANP) (Atriopeptigen) (Cardiodilatin) (CDD) (preproCDD-ANF) Cleaved into: Long-acting natriuretic peptide (LANP) (Long-acting natriuretic hormone) (LANH) (Pro atrial natriuretic factor 1-30) (proANF 1-30) (Pro atrial natriuretic peptide 1-30) (proANP 1-30); Vessel dilator (VSDL) (Pro atrial natriuretic factor 31-67) (proANF 31-67) (Pro atrial natriuretic peptide 31-67) (proANP 31-67); Kaliuretic peptide (KP) (Pro atrial natriuretic factor 79-98) (proANF 79-98) (Pro atrial natriuretic peptide 79-98) (proANP 79-98); Urodilatin (URO) (CDD 95-126) (CDD-ANP (95-126)) (Pro atrial natriuretic peptide 95-126) (proANP 95-126); Auriculin-C (Atrial natriuretic factor 1-33) (ANF 1-33); Auriculin-D (Atrial natriuretic factor 3-33) (ANF 3-33); Atrial natriuretic peptide (ANP) (Alpha-atrial natriuretic peptide) (Alpha-hANP) (Atrial natriuretic factor) (ANF) (CDD-ANF) (CDD-ANP (99-126)) (Cardionatrin) (Pro atrial natriuretic factor 99-126) (proANF 99-126); Auriculin-B (Atrial natriuretic factor 8-33) (ANF 8-33); Auriculin-A; Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II); Atriopeptin-3 (Atriopeptin III)	Homo sapiens (Human)	56	123	70	76	7	AGAALSP	73.91
DP00748	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	192	223	196	203	8	SVSALIGG	85.41
DP00748	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	238	293	239	278	40	YARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGE	79.84
DP00749	Q9TY14	Apical membrane antigen 1 (Fragment)	Plasmodium vivax	413	445	414	440	27	AEIKENNQVVIKEEFRNYYENGEEKSN	77.16
DP00750	Q38151	39 protein	Bacillus phage SPP1 (Bacteriophage SPP1)	68	126	73	96	24	RDRFIPSYEETQRILKEQAEAEEA	74.83
DP00750	Q38151	39 protein	Bacillus phage SPP1 (Bacteriophage SPP1)	68	126	105	121	17	AAQEENMRKIREMLGIN	78.63
DP00750	Q38151	39 protein	Bacillus phage SPP1 (Bacteriophage SPP1)	68	112	73	96	24	RDRFIPSYEETQRILKEQAEAEEA	74.83
DP00752	E6PBU9	40S ribosomal protein rpS31e	Tetrahymena thermophila	1	71	10	52	43	GETKIYTLEQGTSVLDLKSQISQDMGFEIDMMTLVNNGFIAPN	78.47
DP00752	E6PBU9	40S ribosomal protein rpS31e	Tetrahymena thermophila	1	71	58	66	9	DDVTYYLSL	85.99
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	1	81	12	25	14	EQQEYKEAFQLFDK	90.8
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	1	81	27	38	12	NDNKLTAEELGT	73.91
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	1	81	48	60	13	TKQKISEIVKDYD	89.19
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	1	81	63	76	14	NSGKFDQETFLTIM	84.78
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	82	150	91	97	7	KAFEIFD	97.75
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	82	150	100	122	23	KNGYISASELKHVLTTLGEKLTE	79.45
DP00753	C4M0U8	Calmodulin; putative	Entamoeba histolytica	82	150	128	145	18	LLKEIGVEEGLINVDDFV	84.97
DP00754	Q70Q12	FXYD domain-containing ion transport regulator	Squalus acanthias (Spiny dogfish)	62	94	81	87	7	TAQHLLQ	79.55
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	18	52	18	24	7	AYEHITH	91.97
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	18	52	33	47	15	NKNKISTVSDYFRNI	81.14
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	75	114	78	92	15	NNNKYSVNIENVRIR	80.31
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	145	188	154	163	10	TIEVTTVPSN	84.08
DP00756	Q04884	Opacity protein opA60 (Fragment)	Neisseria gonorrhoeae	145	188	167	175	9	GAVTTYNTD	81.64
DP00759	P80220	TSC22 domain family protein 3 (DSIP-immunoreactive peptide) (DIP protein) (Delta sleep-inducing peptide immunoreactor) (Glucocorticoid-induced leucine zipper protein)	Sus scrofa (Pig)	48	77	48	57	10	QLEKFQSRLS	86.62
DP00765	O00585	C-C motif chemokine 21 (6Ckine) (Beta-chemokine exodus-2) (Secondary lymphoid-tissue chemokine) (SLC) (Small-inducible cytokine A21)	Homo sapiens (Human)	71	111	83	91	9	VQQLMQHLD	80.27
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	14	99	43	50	8	TELEEVSL	73.91
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	14	99	61	67	7	VAAVTLG	82.99
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	14	99	70	77	8	GTQETALT	75.92
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	14	99	83	89	7	QAQVSVA	75.54
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	117	166	121	131	11	PSQNIAAGLES	76.86
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	117	166	136	143	8	AGAQILGQ	77.01
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	288	296	9	DVQTISILP	81.16
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	301	309	9	ESHLILEEV	79.04
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	340	346	7	GEVVEQT	76.25
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	466	475	10	HSVLLDSYLV	84.25
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	505	521	17	GAQALSEESETQDQSEV	76.18
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	552	567	16	QDQSTSHQELQEEALA	74.87
DP00768	Q28181	Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP)	Bos taurus (Bovine)	272	590	570	585	16	SGGSFQMSPFEALQEC	73.58
DP00769	Q24F70	40S ribosomal protein S10; putative	Tetrahymena thermophila (strain SB210)	106	162	147	157	11	GAAETAQGNQE	75.92
DP00771	P20435	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	71	4	30	27	YEEAFNDGNENFEDFDVEHFSDEETYE	83.66
DP00771	P20435	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	71	44	52	9	NGKTIVTGG	80.27
DP00771	P20435	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	71	58	65	8	FQQHEQIR	75.25
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	40	52	13	VDELFDTQLMLFA	91.23
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	58	66	9	LDLNEINAA	90.64
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	83	94	12	DDALTFAIFTHD	84.03
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	106	123	18	EDIPYSYQREGFADGQLV	76.14
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	127	134	8	DPWRFVWM	79.93
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	35	158	139	152	14	GKYRIVVGQEWEYR	83.13
DP00774	P40719	Sensor protein QseC (EC 2.7.13.3)	Escherichia coli (strain K12)	386	417	396	404	9	ALARIGERF	79.71
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	130	150	130	141	12	VQAKFGDYNKEV	81.86
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	320	327	8	RQQLETEK	77.55
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	350	357	8	RLQDYEEK	75.25
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	365	378	14	LSEQIQRALQLEEE	75.51
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	416	434	19	QLAAELAEYTAKIALLEEA	80.55
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	484	491	8	HVQESLQD	74.67
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	298	515	498	506	9	GYSAELSSE	77.41
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	506	586	529	540	12	RQLLTLSSELSQ	76.11
DP00775	P15311	Ezrin (Cytovillin) (Villin-2) (p81)	Homo sapiens (Human)	506	586	549	557	9	HNDIIHNEN	76.66
DP00776	P0ACF8	DNA-binding protein H-NS (Heat-stable nucleoid-structuring protein) (Histone-like protein HLP-II) (Protein B1) (Protein H1)	Escherichia coli (strain K12)	57	89	57	67	11	KLQQYREMLIA	82.24
DP00776	P0ACF8	DNA-binding protein H-NS (Heat-stable nucleoid-structuring protein) (Histone-like protein HLP-II) (Protein B1) (Protein H1)	Escherichia coli (strain K12)	57	89	74	84	11	ELLNSLAAVKS	77.04
DP00778	P46670	Tubulin-specific chaperone C (Chromosome instability protein 2) (Tubulin-folding cofactor C)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	220	245	225	240	16	RDHLIIQDFSNPFQSE	76.15
DP00783	P10279	Major prion protein (PrP) (Major scrapie-associated fibril protein 1) (CD antigen CD230)	Bos taurus (Bovine)	23	121	32	42	11	GGWNTGGSRYP	80.94
DP00786	G4NEJ8	PC4 domain-containing protein	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)	117	158	147	153	7	KKANIEA	80.12
DP00787	B2LME8	Alginase	Pseudoalteromonas sp. SM0524	32	155	36	61	26	NAGFESGFSNWNETDPAAISSDAYSG	78.13
DP00787	B2LME8	Alginase	Pseudoalteromonas sp. SM0524	32	155	72	150	79	ARVYQVVDIQPNTEYTLSAYVLGKGQIGVNDLNGLFKNQTFNVSSWTKVTKTFTSANTNSLQVFAKHYNNTSDVRFDNF	80.49
DP00788	P38801	Exosome complex protein LRP1 (Like an rRNA processing protein 1) (Yeast C1D domain-containing protein) (rRNA processing protein 47)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	118	184	148	157	10	AESTTTKIID	79.26
DP00790	P08245	Uncharacterized protein YciH	Escherichia coli (strain K12)	1	31	6	18	13	SRLVYSTETGRID	77.67
DP00791	P9WHJ5	RNA polymerase-binding protein RbpA	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	26	12	19	8	GAVSYETD	82.15
DP00791	P9WHJ5	RNA polymerase-binding protein RbpA	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	25	12	19	8	GAVSYETD	82.15
DP00792	P36886	Photosystem I reaction center subunit psaK; chloroplastic (Light-harvesting complex I 7 kDa protein) (PSI-K) (Photosystem I subunit X)	Hordeum vulgare (Barley)	1	42	2	11	10	ASQLSAMTSV	79.93
DP00793	P05387	60S acidic ribosomal protein P2 (Large ribosomal subunit protein P2) (Renal carcinoma antigen NY-REN-44)	Homo sapiens (Human)	63	115	69	76	8	GAVAVSAA	75.25
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	116	138	124	133	10	LDKEIKNSFN	77.66
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	124	133	10	LDKEIKNSFN	77.66
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	135	143	9	EAQVFMPIS	78.45
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	172	188	17	TQPLTFTTATFAATKFG	80.44
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	218	236	19	KQKAISSSMHSLYGLGLGS	84.83
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	260	268	9	QQQKTSALS	77.93
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	270	278	9	NAKEFIFPN	90.23
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	117	345	300	340	41	PLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQ	82.45
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	172	188	17	TQPLTFTTATFAATKFG	80.44
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	218	236	19	KQKAISSSMHSLYGLGLGS	84.83
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	260	268	9	QQQKTSALS	77.93
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	270	278	9	NAKEFIFPN	90.23
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	345	300	340	41	PLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQ	82.45
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	285	172	188	17	TQPLTFTTATFAATKFG	80.44
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	285	218	236	19	KQKAISSSMHSLYGLGLGS	84.83
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	285	260	268	9	QQQKTSALS	77.93
DP00794	P50616	Protein Tob1 (Transducer of erbB-2 1)	Homo sapiens (Human)	147	285	270	278	9	NAKEFIFPN	90.23
DP00795	P62326	Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Bos taurus (Bovine)	1	44	6	14	9	DMAEIEKFD	81.72
DP00795	P62326	Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Bos taurus (Bovine)	1	44	31	37	7	SKETIEQ	75.92
DP00795	P62326	Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Bos taurus (Bovine)	13	44	31	37	7	SKETIEQ	75.92
DP00795	P62326	Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)	Bos taurus (Bovine)	22	44	31	37	7	SKETIEQ	75.92
DP00796	P15382	Potassium voltage-gated channel subfamily E member 1 (Delayed rectifier potassium channel subunit IsK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel)	Homo sapiens (Human)	107	129	109	117	9	VENHLAIEQ	79.26
DP00797	O15273	Telethonin (Titin cap protein)	Homo sapiens (Human)	91	167	112	123	12	QLQELLALETAL	80.6
DP00797	O15273	Telethonin (Titin cap protein)	Homo sapiens (Human)	91	167	131	138	8	QEVAEITK	78.05
DP00798	O14214	tRNA (guanine(9)-N1)-methyltransferase (EC 2.1.1.221) (tRNA methyltransferase 10) (tRNA(m1G9)-methyltransferase) (tRNA(m1G9)MTase)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	83	42	48	7	RQQEWDA	76.59
DP00798	O14214	tRNA (guanine(9)-N1)-methyltransferase (EC 2.1.1.221) (tRNA methyltransferase 10) (tRNA(m1G9)-methyltransferase) (tRNA(m1G9)MTase)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	271	304	274	288	15	GILLKSDESFDVSED	76.19
DP00799	P9WNK3	ESAT-6-like protein EsxH (10 kDa antigen CFP7) (CFP-7) (Low molecular weight protein antigen 7) (Protein TB10.4)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	76	96	76	82	7	HEANTMA	79.93
DP00803	P22179	Photosystem I reaction center subunit VI; chloroplastic (PSI-H) (Light-harvesting complex I 11 kDa protein)	Spinacia oleracea (Spinach)	1	58	2	15	14	ASLATLAAVQPTTL	75.94
DP00803	P22179	Photosystem I reaction center subunit VI; chloroplastic (PSI-H) (Light-harvesting complex I 11 kDa protein)	Spinacia oleracea (Spinach)	1	58	33	41	9	ARQSFKLNN	76.81
DP00803	P22179	Photosystem I reaction center subunit VI; chloroplastic (PSI-H) (Light-harvesting complex I 11 kDa protein)	Spinacia oleracea (Spinach)	1	58	43	53	11	RSGAIVAKYGD	81.76
DP00806	A1B8N7	ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta)	Paracoccus denitrificans (strain Pd 1222)	116	188	118	128	11	ADVVSAQALTD	84.43
DP00806	A1B8N7	ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta)	Paracoccus denitrificans (strain Pd 1222)	116	188	144	174	31	KTVKLNARVDESLIGGMIVKLGSQMIDSSIR	80.43
DP00806	A1B8N7	ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta)	Paracoccus denitrificans (strain Pd 1222)	116	188	177	183	7	LASLQNA	74.63
DP00808	P24937	Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	51	2	10	9	EDINFASLA	80.75
DP00808	P24937	Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	1	51	18	46	29	FMGNWQDIGTSNMSGGAFSWGSLWSGIKN	79.41
DP00808	P24937	Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	158	250	200	206	7	AVVVTRP	77.93
DP00808	P24937	Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C)	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)	158	250	225	245	21	ASGNWQSTLNSIVGLGVQSLK	87.55
DP00809	P80870	General stress protein 13 (GSP13)	Bacillus subtilis (strain 168)	81	130	95	112	18	AAQVSEEASTPQGFNTLK	78.93
DP00809	P80870	General stress protein 13 (GSP13)	Bacillus subtilis (strain 168)	81	130	114	123	10	KLEEWIEMSN	80
DP00810	P0A882	Trp operon repressor	Escherichia coli O157:H7	63	92	75	87	13	LGAGIATITRGSN	88.37
DP00811	Q9V452	Chromatin accessibility complex 16kD protein	Drosophila melanogaster (Fruit fly)	1	28	15	23	9	TAETFLPLS	90.3
DP00811	Q9V452	Chromatin accessibility complex 16kD protein	Drosophila melanogaster (Fruit fly)	101	140	103	109	7	HQFQEML	75.68
DP00814	P01252	Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1	Bos taurus (Bovine)	1	110	8	15	8	TSSEITTK	74.79
DP00814	P01252	Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1	Bos taurus (Bovine)	1	110	22	29	8	EVVEEAEN	75.92
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	1	206	49	58	10	DEMNILATYH	83.68
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	1	206	83	89	7	DEDAYSD	75.87
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	1	206	145	164	20	RKLHYNEGLNIKLARQLISK	77.68
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	1	206	184	196	13	MNVEESSQGSTTS	73.91
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	57	129	83	89	7	DEDAYSD	75.87
DP00815	Q9DCL8	Protein phosphatase inhibitor 2 (IPP-2)	Mus musculus (Mouse)	170	206	184	196	13	MNVEESSQGSTTS	73.91
DP00816	P41236	Protein phosphatase inhibitor 2 (IPP-2)	Homo sapiens (Human)	9	164	24	31	8	SMVASAEQ	75.67
DP00816	P41236	Protein phosphatase inhibitor 2 (IPP-2)	Homo sapiens (Human)	9	164	36	42	7	VDEELSK	75.25
DP00816	P41236	Protein phosphatase inhibitor 2 (IPP-2)	Homo sapiens (Human)	9	164	48	57	10	DEMNILATYH	83.68
DP00816	P41236	Protein phosphatase inhibitor 2 (IPP-2)	Homo sapiens (Human)	9	164	144	159	16	RKLHYNEGLNIKLARQ	78.11
DP00818	P40422	DNA-directed RNA polymerases I; II; and III subunit RPABC4 (RNA polymerases I; II; and III subunit ABC4) (ABC10-alpha)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	24	4	11	8	EGFQIPTN	75.08
DP00823	N1NXA6	SAGA-associated factor 11	"Saccharomyces cerevisiae (strain CEN.PK113-7D) (Bakers yeast)"	64	99	67	73	7	SSQYIHC	76.54
DP00824	Q9NJS1	Salivary anti-thrombin peptide anophelin	Anopheles albimanus (New world malaria mosquito)	23	83	47	71	25	NDTSITDEDYAAIEASLSETFNTAA	79.71
DP00824	Q9NJS1	Salivary anti-thrombin peptide anophelin	Anopheles albimanus (New world malaria mosquito)	54	83	55	71	17	DYAAIEASLSETFNTAA	80.7
DP00824	Q9NJS1	Salivary anti-thrombin peptide anophelin	Anopheles albimanus (New world malaria mosquito)	56	83	56	71	16	YAAIEASLSETFNTAA	80.29
DP00827	O31467	Sec-independent protein translocase protein TatAd	Bacillus subtilis (strain 168)	49	70	57	65	9	SAELTAVKQ	80.27
DP00828	P13183	Cytochrome c oxidase subunit 7B; mitochondrial (Cytochrome c oxidase polypeptide VIIb) (IHQ)	Bos taurus (Bovine)	36	56	39	51	13	NAVLASGATFCVA	80.45
DP00833	P22995	Antitoxin ParD	Escherichia coli	38	83	42	58	17	ADQAWQELKTMLGNRIN	80.62
DP00833	P22995	Antitoxin ParD	Escherichia coli	38	83	69	78	10	SVGEILDEEL	76.42
DP00833	P22995	Antitoxin ParD	Escherichia coli	50	83	69	78	10	SVGEILDEEL	76.42
DP00833	P22995	Antitoxin ParD	Escherichia coli	58	83	69	78	10	SVGEILDEEL	76.42
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	21	89	32	38	7	LGASIKG	75.25
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	21	89	55	65	11	QDADFTAKTIA	78.63
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	22	44	32	38	7	LGASIKG	75.25
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	44	89	55	65	11	QDADFTAKTIA	78.63
DP00834	P69428	Sec-independent protein translocase protein TatA	Escherichia coli (strain K12)	47	89	55	65	11	QDADFTAKTIA	78.63
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	54	1	7	7	MSQRIIQ	87.1
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	54	19	26	8	SDGYEYTV	85.74
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	54	29	49	21	KQAITSEASTTYIPSRIYSES	76.7
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	104	164	115	126	12	RASAFLSQNESS	77.06
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	104	164	129	136	8	LSNASNSP	74.08
DP00835	Q03337	Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	104	164	138	150	13	MLANSSTATSASA	78.08
DP00836	P01139	Beta-nerve growth factor (Beta-NGF)	Mus musculus (Mouse)	19	128	39	45	7	KLQHSLD	75.25
DP00836	P01139	Beta-nerve growth factor (Beta-NGF)	Mus musculus (Mouse)	19	128	66	72	7	QTRNITV	76.64
DP00836	P01139	Beta-nerve growth factor (Beta-NGF)	Mus musculus (Mouse)	19	128	85	92	8	PRVLFSTQ	79.68
DP00836	P01139	Beta-nerve growth factor (Beta-NGF)	Mus musculus (Mouse)	19	128	101	114	14	LDLDFQAHGTIPFN	77.45
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	1	21	4	11	8	SGALFPSL	79.93
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	132	252	144	151	8	GHELSALG	75.92
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	132	252	155	174	20	GLQSLLGNMSHSQLMQLIGP	84.62
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	132	252	182	188	7	GLGALTG	75.59
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	132	252	190	197	8	GLASLLGS	79.18
DP00839	Q16186	Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)	Homo sapiens (Human)	253	285	261	275	15	PIQLSDLQSILATMN	77.08
DP00840	P46065	Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A)	Bos taurus (Bovine)	74	108	76	86	11	YVAALSLVLKG	76.28
DP00840	P46065	Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A)	Bos taurus (Bovine)	74	108	91	100	10	KLRWYFKLYD	91.14
DP00841	O14733	Dual specificity mitogen-activated protein kinase kinase 7 (MAP kinase kinase 7) (MAPKK 7) (EC 2.7.12.2) (JNK-activating kinase 2) (MAPK/ERK kinase 7) (MEK 7) (Stress-activated protein kinase kinase 4) (SAPK kinase 4) (SAPKK-4) (SAPKK4) (c-Jun N-terminal kinase kinase 2) (JNK kinase 2) (JNKK 2)	Homo sapiens (Human)	30	100	86	95	10	SMESIEIDQK	78.63
DP00842	P12506	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) (HIV-1)	1	86	4	12	9	VDPNIEPWN	77.48
DP00842	P12506	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) (HIV-1)	1	86	34	49	16	CQVCFITKGLGISYGR	82.53
DP00847	P20220	Protein F-112	Sulfolobus spindle-shape virus 1 (SSV1)	74	112	85	94	10	TQDNIAKIFD	86.96
DP00847	P20220	Protein F-112	Sulfolobus spindle-shape virus 1 (SSV1)	74	112	96	107	12	QPANFEQTDQGF	82
DP00848	Q49ZM2	Putative secretory antigen	Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)	1	49	5	22	18	VTATTLTAGIGAAIVGLD	77.07
DP00848	Q49ZM2	Putative secretory antigen	Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)	1	49	27	34	8	ADAAEQTQ	75.25
DP00848	Q49ZM2	Putative secretory antigen	Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)	1	49	37	44	8	NQSTTQST	77.76
DP00849	Q9Q8E9	M156R	Myxoma virus (strain Lausanne) (MYXV)	1	32	14	27	14	KNKNIKVNTYRTSA	82.18
DP00850	P36932	Integrase (EC 2.7.7.-) (EC 3.1.-.-)	Escherichia phage P2 (Bacteriophage P2)	46	161	61	71	11	LSELTQIWWDL	83.37
DP00850	P36932	Integrase (EC 2.7.7.-) (EC 3.1.-.-)	Escherichia phage P2 (Bacteriophage P2)	46	161	82	113	32	NLGKIEIFTKITNDPCAFQITKSLISQYCATR	83.29
DP00850	P36932	Integrase (EC 2.7.7.-) (EC 3.1.-.-)	Escherichia phage P2 (Bacteriophage P2)	46	161	126	146	21	DLTCISGMFTALIEAELFFGE	83.02
DP00851	Q9KX51	PmoC	Methylosinus trichosporium	177	256	177	196	20	HGFSLAFLIVAIGPFMIIPN	83.63
DP00851	Q9KX51	PmoC	Methylosinus trichosporium	177	256	198	247	50	GLNEWGHTFWFMEELFVAPLHWGFVFFGWMALGVFGVVLQILMGVKRLIG	81.48
DP00853	P00127	Cytochrome b-c1 complex subunit 6; mitochondrial (Complex III subunit 6) (Complex III subunit VI) (Cytochrome c1 non-heme 17 kDa protein) (Mitochondrial hinge protein) (Ubiquinol-cytochrome c oxidoreductase subunit 6) (Ubiquinol-cytochrome c reductase 17 kDa protein)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	72	2	18	17	GMLELVGEYWEQLKITV	79.34
DP00858	A8AZZ3	Amylase-binding protein AbpA	Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)	24	44	24	39	16	ADEATDAARNNDGAYY	81.4
DP00863	Q9X0Q3	Transcriptional regulator; crp family	Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)	130	201	134	143	10	KLMNFLVRHM	81.07
DP00863	Q9X0Q3	Transcriptional regulator; crp family	Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)	130	201	154	163	10	TLEELSRLFG	78.06
DP00863	Q9X0Q3	Transcriptional regulator; crp family	Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)	130	201	169	182	14	LSRVFQELEREGYI	78.76
DP00866	O54465	Hypothetical mobile element-associated protein (Pathogenicity island protein)	Staphylococcus aureus	42	72	46	52	7	LQQSEQS	73.91
DP00866	O54465	Hypothetical mobile element-associated protein (Pathogenicity island protein)	Staphylococcus aureus	42	72	56	67	12	QYGTTLQNLAKQ	82
DP00869	F2Z293	Chlorophyll a-b binding protein; chloroplastic	Spinacia oleracea (Spinach)	1	87	19	38	20	KAPEYLDGSLVGDYGFDPFG	77.58
DP00869	F2Z293	Chlorophyll a-b binding protein; chloroplastic	Spinacia oleracea (Spinach)	1	87	41	51	11	KPAEYLQYDYD	79.78
DP00869	F2Z293	Chlorophyll a-b binding protein; chloroplastic	Spinacia oleracea (Spinach)	1	87	53	68	16	LDQNLAKNLAGDIIGT	83.61
DP00869	F2Z293	Chlorophyll a-b binding protein; chloroplastic	Spinacia oleracea (Spinach)	1	87	73	82	10	ADVKSTSLQP	79.93
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	379	392	14	VARLFSLFGCQEED	92.76
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	402	422	21	LALALAHAGELEALQALMELG	77.5
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	431	442	12	NGQTLLHVAARN	75.92
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	445	451	7	DGVVTML	79.26
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	514	520	7	GLQAWGQ	76.97
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	363	565	536	558	23	LCVAEAAGNQEVLALLRNLALVG	77.74
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	379	392	14	VARLFSLFGCQEED	92.76
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	402	422	21	LALALAHAGELEALQALMELG	77.5
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	431	442	12	NGQTLLHVAARN	75.92
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	445	451	7	DGVVTML	79.26
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	514	520	7	GLQAWGQ	76.97
DP00870	H0W0T5	Asparaginase (EC 3.5.1.1)	Cavia porcellus (Guinea pig)	364	565	536	558	23	LCVAEAAGNQEVLALLRNLALVG	77.74
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	4	16	13	NTVSSFQDILLRM	78.18
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	18	25	8	KMQLESSS	77.01
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	28	42	15	LNGMITQFESLKLYR	79.64
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	53	62	10	GDLHSLQNRN	75.72
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	69	83	15	LGQKFEEIRWLIEEV	80.89
DP00871	A4ZNR2	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	Influenza A virus (A/lvPR8/34(H1N1))	1	121	85	116	32	HKLKITENSFEQITFMQALHLLLEVEQEIRTF	81.9
DP00872	P80428	Actin-related protein 4 (Actin-like protein ARP4) (Actin-like protein 4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	199	226	203	211	9	IIPLFAIKQ	85.69
DP00872	P80428	Actin-related protein 4 (Actin-like protein ARP4) (Actin-like protein 4)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	199	226	213	221	9	KPEFIKKTF	76.37
DP00873	Q9H981	Actin-related protein 8 (hArp8) (INO80 complex subunit N)	Homo sapiens (Human)	401	507	420	430	11	HDEHYLLATQS	81.03
DP00873	Q9H981	Actin-related protein 8 (hArp8) (INO80 complex subunit N)	Homo sapiens (Human)	401	507	485	496	12	NDSEEALTALMS	75.47
DP00874	Q12406	Actin-related protein 7 (Actin-like protein ARP7) (Chromatin structure-remodeling complex protein ARP7) (SWI/SNF complex component ARP7)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	353	379	359	374	16	GTSHINTNVGDNNSTA	79.56
DP00875	P69723	Virion infectivity factor (Vif) (SOR protein) Cleaved into: p17; p7	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	141	192	143	156	14	GSLQYLALAALITP	81.56
DP00876	P14340	Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)	Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2)	1	100	26	37	12	VQQLTKRFSLGM	80.94
DP00876	P14340	Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)	Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2)	1	100	43	60	18	PLKLFMALVAFLRFLTIP	85.28
DP00876	P14340	Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)	Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2)	1	100	74	83	10	KSKAINVLRG	75.89
DP00877	P9WHN5	Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	64	39	59	21	LLDEIDDVLEENAEDFVRAYV	82.13
DP00877	P9WHN5	Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	21	61	39	56	18	LLDEIDDVLEENAEDFVR	81.22
DP00877	P9WHN5	Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	21	51	39	46	8	LLDEIDDV	79.93
DP00878	G8HXD9	NepR	Sphingomonas sp. Fr1	28	56	32	44	13	LRSAYQKTIEEQV	82.71
DP00884	P50106	DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	49	79	51	60	10	IDSTTMNTIS	84.75
DP00884	P50106	DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	101	137	102	116	15	AQDFSAAPIQVSTTE	75.67
DP00884	P50106	DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	102	137	102	116	15	AQDFSAAPIQVSTTE	75.67
DP00889	P9WF19	Putative antitoxin VapB5	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	45	24	30	7	EDVTITV	77.88
DP00892	O31818	UPF0291 protein YnzC	Bacillus subtilis (strain 168)	41	77	50	56	7	KSVKIID	85.14
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	1	10	10	MLDFFTIFSK	91.54
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	12	23	12	GLVLWCFQGVSD	91.36
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	29	40	12	VNALIRSVLLQE	77.48
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	42	91	50	GGNNSFTHEALTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFR	82.19
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	100	122	23	QQSALSLLNGTFDFQNDFLRLLR	81.42
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	200	211	12	NGVELSKEELIR	80.99
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	213	220	8	KREEFIQK	85.7
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	256	264	9	KEVLDYSTP	76.92
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	274	282	9	LSEDINLIR	85.28
DP00893	P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	Homo sapiens (Human)	1	331	303	309	7	AAQNSTK	82.94
DP00894	Q7B2Z6	Intrinsic membrane protein PufX (PUFX protien)	Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)	54	82	69	77	9	GALETGIEL	83.28
DP00895	P03421	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain A2)	1	102	16	29	14	RATKFLESIKGKFT	78.88
DP00895	P03421	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain A2)	1	102	37	67	31	KDSIISVNSIDIEVTKESPITSNSTIINPTN	83.53
DP00895	P03421	Phosphoprotein (Protein P)	Human respiratory syncytial virus A (strain A2)	1	102	83	90	8	PLVSFKED	78.26
DP00896	P10121	Signal recognition particle receptor FtsY (SRP receptor)	Escherichia coli (strain K12)	1	187	6	16	11	KRGFFSWLGFG	78.29
DP00896	P10121	Signal recognition particle receptor FtsY (SRP receptor)	Escherichia coli (strain K12)	1	187	34	43	10	VVEEIVQAQE	91.97
DP00896	P10121	Signal recognition particle receptor FtsY (SRP receptor)	Escherichia coli (strain K12)	1	187	62	82	21	AEAETFAADVVEVTEQVAESE	82.4
DP00896	P10121	Signal recognition particle receptor FtsY (SRP receptor)	Escherichia coli (strain K12)	1	187	130	169	40	AEAETVEIVEAAEEEAAKEEITDEELETALAAEAAEEAVM	79.75
DP00898	P13338	RNA polymerase-associated protein Gp33	Enterobacteria phage T4 (Bacteriophage T4)	1	31	1	10	10	MTQFSLNDIR	76.05
DP00899	P44654	Periplasmic nitrate reductase; electron transfer subunit (Diheme cytochrome c NapB)	Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)	28	62	37	44	8	TQAAENIP	88.21
DP00900	Q04660	Ribosome biogenesis protein ERB1 (Eukaryotic ribosome biogenesis protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	535	570	544	552	9	KSNLEVNEN	82.83
DP00900	Q04660	Ribosome biogenesis protein ERB1 (Eukaryotic ribosome biogenesis protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	535	570	559	565	7	GENESAK	74.25
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	1	101	32	38	7	RDEIIEK	89.97
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	1	101	40	96	57	MRLVWSVVQRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQ	83.52
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	159	250	169	193	25	NDGDPITLLDQIADADEASWFDKIA	80.84
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	159	250	204	215	12	RERLIVYLRYYR	85.76
DP00902	O32728	RNA polymerase sigma factor	Geobacillus stearothermophilus (Bacillus stearothermophilus)	159	250	236	245	10	LEKKILQHIK	83.08
DP00903	P47813	Eukaryotic translation initiation factor 1A; X-chromosomal (eIF-1A X isoform) (Eukaryotic translation initiation factor 4C) (eIF-4C)	Homo sapiens (Human)	124	144	125	135	11	DDDEIQFDDIG	75.8
DP00904	Q58876	Uncharacterized protein MJ1481	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	104	213	109	124	16	EGALYIVSNKKLFKKL	81.35
DP00904	Q58876	Uncharacterized protein MJ1481	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	104	213	138	149	12	GMLDIEDMRAIG	74.58
DP00904	Q58876	Uncharacterized protein MJ1481	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)	104	213	168	208	41	NVERFIEKYKPEKIFVVVEDDKDELLYLRAKNLYNAEKLDA	82.85
DP00907	Q9HB71	Calcyclin-binding protein (CacyBP) (hCacyBP) (S100A6-binding protein) (Siah-interacting protein)	Homo sapiens (Human)	48	80	51	57	7	KAELLDN	75.63
DP00907	Q9HB71	Calcyclin-binding protein (CacyBP) (hCacyBP) (S100A6-binding protein) (Siah-interacting protein)	Homo sapiens (Human)	48	80	63	75	13	VVAPITTGYTDGI	76.28
DP00908	P9WJ35	Antitoxin VapB30	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	1	46	27	33	7	EAVVTAL	76.78
DP00910	P41567	Eukaryotic translation initiation factor 1 (eIF1) (A121) (Protein translation factor SUI1 homolog) (Sui1iso1)	Homo sapiens (Human)	1	28	3	14	12	AIQNLHSFDPFA	79.29
DP00912	Q8N4Q1	Mitochondrial intermembrane space import and assembly protein 40 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 4)	Homo sapiens (Human)	107	142	121	134	14	AEQAEETAPIEATA	75.25
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	2	9	8	KFGFIAHP	94.65
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	13	69	57	GLKRYVKMLDLLQRNSTEQHSGYTRELWERQNLVPFMNFARITSATGATCEGVIKYM	78.74
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	87	95	9	VVQGIEELA	79.34
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	103	111	9	GLGGFTSIV	83.5
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	129	151	23	GNSLTTYAGYKALMQIQSWLEIR	79.02
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	155	187	33	EPVAIVGYPGSICLALSRLLLAHGFSLHLLHRA	81.25
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	219	234	16	RCKLFAAATSAGGVID	78.57
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	239	250	12	QPGSIFIDVALP	78.93
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	262	319	58	DDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAETIVLALENRRENFSLGRYLA	84.86
DP00913	A0A0J9X1Q5	Aminotransferase PigE (EC 2.6.1.-)	Serratia sp. (strain FS14)	1	371	322	366	45	KVLEIGEIAERHGFFAYPLASYGERIDRQSVTNLKRYYHHDIYAG	82.07
DP00915	Q5JH72	PCNA-inhibitor (Thermococcales inhibitor of PCNA) (TIP)	Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1))	1	27	4	11	8	KLDEFIGD	89.97
DP00918	A0MHA3	Patellamide protein	uncultured Prochloron sp.	36	64	38	53	16	GLEASVTACITFCAYD	88.52
DP00919	C6KEI3	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus 1	1	75	6	17	12	SKSSIVGWPAIR	76.25
DP00919	C6KEI3	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus 1	1	75	49	61	13	HGALTSSNTDTTN	75.25
DP00919	C6KEI3	"Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein"	Human immunodeficiency virus 1	152	180	153	160	8	GEVEEATE	75.17
DP00922	P67966	Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1)	Gallus gallus (Chicken)	67	115	76	83	8	GAGTLSTD	74.58
DP00922	P67966	Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1)	Gallus gallus (Chicken)	67	115	88	94	7	LGIKYEE	80.94
DP00926	Q9BQB4	Sclerostin	Homo sapiens (Human)	25	79	25	42	18	GWQAFKNDATEIIPELGE	80.12
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	1	72	2	36	35	KQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEA	79.73
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	1	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	32	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	37	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	41	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	46	72	53	67	15	AEVARFIEMNGSFAD	78.64
DP00928	P62552	Antitoxin CcdA (LynA) (Protein H) (Protein LetA)	Escherichia coli (strain K12)	46	71	53	66	14	AEVARFIEMNGSFA	78.74
DP00929	P04608	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	1	86	34	49	16	CQVCFITKALGISYGR	82.38
DP00929	P04608	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	1	86	65	71	7	HQASLSK	74.44
DP00929	P04608	Protein Tat (Transactivating regulatory protein)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	50	86	65	71	7	HQASLSK	74.44
DP00931	Q5ZYC9	IcmR	Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)	1	27	1	16	16	MGNNTDDSARNPFGFY	76.76
DP00932	P35926	Recombination enhancement function protein	Escherichia phage P1 (Bacteriophage P1)	1	76	4	15	12	IEQKIEQCRKWQ	85.28
DP00934	P61925	cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform)	Homo sapiens (Human)	1	76	2	15	14	TDVETTYADFIASG	79.34
DP00934	P61925	cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform)	Homo sapiens (Human)	1	76	22	51	30	AIHDILVSSASGNSNELALKLAGLDINKTE	77.65
DP00937	Q12972	Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1)	Homo sapiens (Human)	144	225	163	172	10	LDNLTEFNTA	85.82
DP00937	Q12972	Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1)	Homo sapiens (Human)	144	225	176	190	15	RISTLTIEEGNLDIQ	80.25
DP00937	Q12972	Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1)	Homo sapiens (Human)	144	225	199	211	13	SRVTFSEDDEIIN	90.17
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	13	21	9	TDFLEEWKA	78.3
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	51	65	15	LAQTTAAGTSELNHG	77.95
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	156	171	16	GVVNIPAAECLDEYED	90.05
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	181	197	17	REDAITQQNTIQNEAAS	80.64
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	218	233	16	YKSTISAPEEEILNRY	79.08
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	250	265	16	APANFASSSTLEKRIE	76.71
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	332	295	305	11	LKEEIDLLNRD	75.31
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	13	21	9	TDFLEEWKA	78.3
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	51	65	15	LAQTTAAGTSELNHG	77.95
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	156	171	16	GVVNIPAAECLDEYED	90.05
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	181	197	17	REDAITQQNTIQNEAAS	80.64
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	218	233	16	YKSTISAPEEEILNRY	79.08
DP00940	Q62627	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR)	Rattus norvegicus (Rat)	1	290	250	265	16	APANFASSSTLEKRIE	76.71
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	1	154	19	29	11	HRSAYEAGIQA	78.78
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	1	154	57	67	11	IKSMFLQMGTT	75.55
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	1	154	109	124	16	ALLKLGTSVSERVSRF	74.16
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	417	494	447	468	22	RKIHFSTAPIQVFSTYSNEDYD	80.1
DP00943	O35274	Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130)	Rattus norvegicus (Rat)	417	494	478	487	10	AASAEYELEK	76.69
DP00944	P12736	50S ribosomal protein L32e (Hl5)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	1	94	10	21	12	AEEEYTELTDIS	77.87
DP00944	P12736	50S ribosomal protein L32e (Hl5)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	1	94	34	41	8	AGFESVED	79.93
DP00944	P12736	50S ribosomal protein L32e (Hl5)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	1	94	46	65	20	DQSALADVSGIGNALAARIK	77.26
DP00944	P12736	50S ribosomal protein L32e (Hl5)	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)	1	94	71	84	14	LEVESETEAEVEEE	76.54
DP00947	O10609	Protein E7	Human papillomavirus 45	1	41	7	16	10	TLQEIVLHLE	80.43
DP00947	O10609	Protein E7	Human papillomavirus 45	1	41	24	36	13	VDLLCYEQLSESE	79.78
DP00947	O10609	Protein E7	Human papillomavirus 45	72	106	72	81	10	RIELTVESSA	78.36
DP00947	O10609	Protein E7	Human papillomavirus 45	72	106	86	101	16	TLQQLFLSTLSFVCPW	83.36
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	161	210	169	176	8	PKGFYAEG	78.43
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	168	208	169	176	8	PKGFYAEG	78.43
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	182	247	218	226	9	TALALLLLD	85.88
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	182	247	228	234	7	LNQLESK	73.96
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	343	402	348	364	17	KDNVILLNKHIDAYKTF	80.86
DP00948	P59595	Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)	Severe acute respiratory syndrome coronavirus (SARS-CoV)	366	422	407	413	7	QLQNSMS	84.62
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	430	486	455	481	27	EGGIWEDEDARNFYENLIDLKAFVPAI	81.79
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	481	530	517	525	9	DLELELENL	80.45
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	1105	1129	1110	1118	9	DEDFIQALD	80.16
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	1167	1207	1181	1187	7	QQFKILN	82.61
DP00949	Q9HAU5	Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2)	Homo sapiens (Human)	1167	1207	1195	1202	8	AANHWNQQ	79.52
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	16	22	7	DDQKIEQ	83.61
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	34	47	14	AATKIQASFRGHIT	77.81
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	59	67	9	VQAAEAEAN	77.26
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	116	122	7	GDAATEQ	75.25
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	172	182	11	AAVTAAAATTP	78.96
DP00951	P17677	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)	Homo sapiens (Human)	1	238	203	213	11	SQAEENIEAVD	77.14
DP00953	Q9H832	Ubiquitin-conjugating enzyme E2 Z (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme Z) (Uba6-specific E2 conjugating enzyme 1) (Use1) (Ubiquitin carrier protein Z) (Ubiquitin-protein ligase Z)	Homo sapiens (Human)	1	99	76	84	9	GAALLSHWD	79.86
DP00954	Q9YGY0	Axin-1 (Axis inhibition protein 1) (xAxin)	Xenopus laevis (African clawed frog)	435	465	445	455	11	HHFNSRYSETG	78.29
DP00955	P06836	Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43)	Bos taurus (Bovine)	1	242	16	22	7	EDQKIEQ	82.61
DP00955	P06836	Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43)	Bos taurus (Bovine)	1	242	34	47	14	AATKIQASFRGHIT	77.81
DP00955	P06836	Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43)	Bos taurus (Bovine)	1	242	61	77	17	AAEAEANEKDEAAVAEG	78.32
DP00955	P06836	Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43)	Bos taurus (Bovine)	1	242	176	185	10	AAVTAAAATA	79.06
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	265	272	8	DAELIARA	92.64
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	331	341	11	QTVTTAELSST	80.05
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	352	365	14	LKVALSKLVLDETN	78.93
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	415	422	8	EEVLVNRK	74.92
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	437	445	9	KRNEYWNDA	77.07
DP00957	C0J347	SBDS-like protein	Trypanosoma cruzi	264	464	448	456	9	DDYDYGYED	74.73
DP00958	P46984	EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	13	19	7	GVEKSFA	75.35
DP00958	P46984	EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	61	87	27	GSQLTYLGQLRTQLTGLQDDINEFLTG	78.67
DP00958	P46984	EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	123	105	115	11	IQEEINQLLDG	83.34
DP00958	P46984	EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	65	113	77	87	11	LQDDINEFLTG	82.61
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	301	313	13	VNPYYVNAGYALA	79.21
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	322	328	7	EQQSLSS	81.08
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	330	337	8	ADTLSLTD	79.43
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	384	394	11	EPQKFAEELIH	81.88
DP00959	O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	Homo sapiens (Human)	295	500	466	472	7	NPESILD	75.92
DP00961	P52630	Signal transducer and activator of transcription 2 (p113)	Homo sapiens (Human)	786	816	802	811	10	PMEIFRNCVK	82.14
DP00961	P52630	Signal transducer and activator of transcription 2 (p113)	Homo sapiens (Human)	817	838	824	833	10	AGQNTVDEVY	80.2
DP00962	P42224	Signal transducer and activator of transcription 1-alpha/beta (Transcription factor ISGF-3 components p91/p84)	Homo sapiens (Human)	720	750	733	745	13	EVSRIVGSVEFDS	84.44
DP00965	P0C6L3	Small delta antigen (S-HDAg) (p24)	Hepatitis delta virus genotype I (isolate D380) (HDV)	12	60	14	23	10	EEVLEQWVSG	77.86
DP00968	Q60795	Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2)	Mus musculus (Mouse)	1	98	16	29	14	DMDLIDILWRQDID	76.73
DP00968	Q60795	Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2)	Mus musculus (Mouse)	1	98	33	41	9	SREVFDFSQ	78.6
DP00968	Q60795	Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2)	Mus musculus (Mouse)	1	98	66	93	28	QEKAFFAQFQLDEETGEFLPIQPAQHIQ	79.23
DP00969	Q02548	Paired box protein Pax-5 (B-cell-specific transcription factor) (BSAP)	Homo sapiens (Human)	1	30	18	25	8	GGVNQLGG	76.09
DP00970	P0ABD8	Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)	Escherichia coli (strain K12)	1	77	2	25	24	DIRKIKKLIELVEESGISELEISE	76
DP00970	P0ABD8	Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)	Escherichia coli (strain K12)	1	77	44	52	9	MQQAYAAPM	77.74
DP00970	P0ABD8	Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)	Escherichia coli (strain K12)	1	77	57	70	14	AQSNAAAPATVPSM	77.26
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	10	16	7	RSSWYWG	87.58
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	22	29	8	EAVALLQG	80.89
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	31	43	13	RHGVFLVRDSSTS	84.46
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	45	54	10	GDYVLSVSEN	78.46
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	56	64	9	RVSHYIINS	84.36
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	90	117	28	GDQEFDSLPALLEFYKIHYLDTTTLIEP	83.6
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	124	146	23	GSGVILRQEEAEYVRALFDFNGN	81.42
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	166	174	9	EEQWWNAED	85.43
DP00973	P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	Homo sapiens (Human)	1	204	182	191	10	IPVPYVEKYR	78.8
DP00974	P42866	Mu-type opioid receptor (M-OR-1) (MOR-1)	Mus musculus (Mouse)	1	51	26	34	9	PGSWLNLSH	74.69
DP00974	P42866	Mu-type opioid receptor (M-OR-1) (MOR-1)	Mus musculus (Mouse)	361	398	384	393	10	NHQLENLEAE	77.06
DP00975	Q86FP9	Thrombin inhibitor madanin 1	Haemaphysalis longicornis (Bush tick)	20	79	47	56	10	GDADYDEYEE	77.26
DP00975	Q86FP9	Thrombin inhibitor madanin 1	Haemaphysalis longicornis (Bush tick)	50	73	50	56	7	DYDEYEE	77.26
DP00976	P04578	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	127	196	136	149	14	NDTNTNSSSGRMIM	79.93
DP00976	P04578	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	127	196	155	165	11	KNCSFNISTSI	81.42
DP00976	P04578	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	127	196	169	185	17	VQKEYAFFYKLDIIPID	81.57
DP00976	P04578	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)	297	331	315	324	10	RAFVTIGKIG	86.66
DP00977	Q86FP8	Thrombin inhibitor madanin 2	Haemaphysalis longicornis (Bush tick)	20	80	41	58	18	VQERYQGNQGDYDEYDQD	81.03
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	34	41	8	WVTVYYGV	79.47
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	48	71	24	TTTLFCASDAKAYDTEVHNVWATH	79.89
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	81	114	34	QEVKLENVTENFNMWKNNMVEQMHEDIISLWDQS	82.85
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	124	132	9	LCVTLNCTD	86.96
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	135	147	13	NATNTTSSSWETM	77.05
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	153	165	13	KNCSFNITTSIRD	77.03
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	167	200	34	VQKEYALFYNLDVVPIDNASYRLISCNTSVITQA	81.71
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	217	230	14	AGFAILKCNDKKFN	79.55
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	236	246	11	TNVSTVQCTHG	77.26
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	252	293	42	STQLLLNGSLAEEEIVIRSENFTNNAKTIIVQLNESVVINCT	82.54
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	308	322	15	GRALYTTGEIIGDIR	85.26
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	324	359	36	AHCNLSKTQWENTLEQIAIKLKEQFGNNKTIIFNPS	81.41
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	362	391	30	GDPEIVTHSFNCGGEFFYCNSTQLFTWNDT	85.65
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	393	403	11	KLNNTGRNITL	77.17
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	407	423	17	IKQIINMWQEVGKAMYA	77
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	432	441	10	CSSNITGLLL	79.26
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	33	498	467	479	13	RSELYKYKVVKIE	85.16
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	127	193	135	147	13	NATNTTSSSWETM	77.05
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	127	193	153	165	13	KNCSFNITTSIRD	77.03
DP00978	P35961	Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)	Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)	127	193	167	188	22	VQKEYALFYNLDVVPIDNASYR	81.83
DP00980	P36595	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (DNA-directed RNA polymerases I; II; and III 15 kDa polypeptide) (RPC16)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	59	14	28	15	GAVMEEEVDELEMID	77.26
DP00980	P36595	DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (DNA-directed RNA polymerases I; II; and III 15 kDa polypeptide) (RPC16)	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)	1	59	44	54	11	STTVITEDVAS	81.33
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	70	164	73	99	27	PSLVISLSTGLSLFLGRFVFFNFQREN	82.26
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	70	164	109	117	9	GMSHFEAGD	82.61
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	70	164	119	130	12	RAKEYVSLLKSN	77.01
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	70	164	133	159	27	VGFNIVDVLAWGSIGHIVAYYILATAS	82.87
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	73	167	73	99	27	PSLVISLSTGLSLFLGRFVFFNFQREN	82.26
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	73	167	109	117	9	GMSHFEAGD	82.61
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	73	167	119	130	12	RAKEYVSLLKSN	77.01
DP00984	P12357	Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein)	Spinacia oleracea (Spinach)	73	167	133	162	30	VGFNIVDVLAWGSIGHIVAYYILATASNGY	82.11
DP00985	Q87WW0	Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) (SAT)	Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)	217	305	219	236	18	NGTLIMIDDERILEHLTD	79.1
DP00985	Q87WW0	Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) (SAT)	Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)	217	305	259	280	22	GAVESEATSLTDIIQEMLLTRT	77.55
DP00986	Q8QWD4	VP4 (Fragment)	Human enterovirus D68 (EV68) (EV-68)	2	29	14	24	11	ENANIATNGSH	84.16
DP00990	P12355	Photosystem I reaction center subunit III; chloroplastic (Light-harvesting complex I 17 kDa protein) (PSI-F)	Spinacia oleracea (Spinach)	1	77	1	11	11	MSFTIPTNLYK	82.82
DP00990	P12355	Photosystem I reaction center subunit III; chloroplastic (Light-harvesting complex I 17 kDa protein) (PSI-F)	Spinacia oleracea (Spinach)	1	77	54	70	17	AAAALALSSVLLSSWSV	79.38
DP00992	P27356	Methane monooxygenase regulatory protein B	Methylosinus trichosporium	1	35	4	30	27	AHNAYNAGIMQKTGKAFADEFFAEENQ	80.04
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	253	25	35	11	RAQQIAFEQAL	79.2
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	253	50	60	11	GDETTEAAATA	74.7
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	253	191	197	7	TAQASVQ	80.27
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	1	253	242	248	7	GDRLLAR	75.59
DP00993	Q9I332	Translocation protein in type III secretion	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	20	40	25	35	11	RAQQIAFEQAL	79.2
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	142	168	146	163	18	TAQLSLQDYLNQQANNQF	80.01
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	177	273	202	234	33	KTKEYLEFDATFVESNTRKNFGDRNNNSRNNFN	86.43
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	177	273	244	268	25	KGNNTANATNSANTVQKNRNIDVSN	77.95
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	273	202	234	33	KTKEYLEFDATFVESNTRKNFGDRNNNSRNNFN	86.43
DP00994	P39015	Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	195	273	244	268	25	KGNNTANATNSANTVQKNRNIDVSN	77.95
DP00995	P01097	ATPase inhibitor; mitochondrial (ATP synthase F1 subunit epsilon)	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	28	50	35	43	9	SEDSFVKRE	73.91
DP00997	P0A4T9	HTH-type transcriptional activator TipA	Streptomyces lividans	111	159	111	127	17	GINLTPEEKFEVFGDFD	79.82
DP00997	P0A4T9	HTH-type transcriptional activator TipA	Streptomyces lividans	111	159	141	147	7	NTDAYRQ	74.58
DP00998	Q05127	Polymerase cofactor VP35 (Ebola VP35) (eVP35)	Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)	20	48	25	36	12	LSGWISEQLMTG	80.85
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	131	137	7	GYACLVG	73.91
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	146	152	7	VKGVIDN	73.96
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	156	174	19	AKLAFKKSSKYDLECAQIP	79.93
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	189	210	22	PEGHYNWHHGAVQYSGGRFTIP	81.06
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	229	241	13	RVVAIVLGGANEG	83.71
DP00999	P03315	Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein)	Semliki forest virus (SFV)	119	260	246	255	10	LSVVTWNKDM	90.13
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	340	354	15	LRSLFGITKGVESTG	80.4
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	367	383	17	SACPFNKGISQGDLKTD	75.66
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	387	393	7	LAGNYGQ	91.3
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	400	407	8	DVSNFAMG	91.97
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	427	436	10	RRSVIFSASA	81.04
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	444	454	11	VHSYSAVSNLD	79.72
DP01009	P97303	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	Mus musculus (Mouse)	331	520	475	483	9	SSQAYSHSG	75.77
DP01011	P68390	Ovomucoid	Meleagris gallopavo (Wild turkey)	1	65	17	25	9	KDVLVCTED	75.62
DP01011	P68390	Ovomucoid	Meleagris gallopavo (Wild turkey)	1	65	38	55	18	SECLLCAYNIEYGTNISK	79.58
DP01014	O94742	26S proteasome complex subunit SEM1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	89	3	18	16	TDVAAAQAQSKIDLTK	84.34
DP01014	O94742	26S proteasome complex subunit SEM1	"Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)"	1	89	36	65	30	EDFPIDTWANGETIKSNAVTQTNIWEENWD	81.56
DP01015	Q83AR4	Elongation factor P (EF-P)	Coxiella burnetii (strain RSA 493 / Nine Mile phase I)	132	188	159	176	18	GAVVRVPLFLNEGEIIKV	78.86
DP01016	Q20MD5	Matrix protein 2 (Fragment)	Influenza A virus (strain A/Udorn/1972 H3N2)	1	21	1	10	10	MSLLTEVETP	77.06
DP01022	Q6URW6	Myosin-14 (Myosin heavy chain 14) (Myosin heavy chain; non-muscle IIc) (Non-muscle myosin heavy chain IIc) (NMHC II-C)	Mus musculus (Mouse)	1954	2000	1961	1978	18	VRQVFRLEEGVASDEEEA	76.14
DP01025	P02619	Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2)	Esox lucius (Northern pike)	1	107	8	39	32	ADVAAALAACSAADSFKHKEFFAKVGLASKSL	75.56
DP01025	P02619	Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2)	Esox lucius (Northern pike)	1	107	43	51	9	KKAFYVIDQ	82.09
DP01025	P02619	Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2)	Esox lucius (Northern pike)	1	107	53	88	36	KSGFIEEDELKLFLQNFSPSARALTDAETKAFLADG	77.19
DP01025	P02619	Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2)	Esox lucius (Northern pike)	1	107	92	102	11	GDGMIGVDEFA	79.93
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2131	2145	15	AVAHILGIRDVASIN	81.03
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2155	2169	15	LDSLMGVEVRQILER	73.58
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2171	2177	7	HDLVLSM	85.67
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2180	2196	17	VRQLSLRKLQELSSKTS	78.52
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2213	2228	16	RQQATLNLSTLLVNPE	80.1
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2251	2277	27	IEGSITVFHGLAAKLSIPTYGLQCTGA	75.87
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2280	2296	17	LDSIQSLASYYIECIRQ	80.56
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2301	2320	20	GPYRIAGYSYGACVAFEMCS	78.11
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2332	2354	23	NHSLFLFDGSHTFVLAYTQSVRA	87.09
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2359	2379	21	GCEAEAEAKAMYFFVQQFTDM	78.26
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2382	2407	26	GKVLEALIPLQGLEARVAATVDLITQ	81.98
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2415	2449	35	HALSFAARSFYQKLRAAENYWPQATYHGNVTLLRA	82.7
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2459	2467	9	LGADYNLSQ	79.82
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2474	2480	7	SVHVIEG	79.55
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2112	2512	2490	2501	12	GLESILSIIHSC	88.46
DP01026	A5YV76	3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase)	Sus scrofa (Pig)	2188	2212	2188	2196	9	LQELSSKTS	82.61
DP01028	Q59471	Diol dehydrase beta subunit (EC 4.2.1.28)	Klebsiella oxytoca	1	45	7	19	13	LLRQIIEDVLSEM	79.5
DP01028	Q59471	Diol dehydrase beta subunit (EC 4.2.1.28)	Klebsiella oxytoca	1	45	24	35	12	KPVSFNAPAASA	81.61
DP01029	Q59472	Diol dehydrase gamma subunit (EC 4.2.1.28) (Propanediol dehydratase) (Propanediol dehydratase small subunit PduE)	Klebsiella oxytoca	1	36	2	16	15	NTDAIESMVRDVLSR	77.61
DP01031	Q99IB8	Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)	Hepatitis C virus genotype 2a (isolate JFH-1) (HCV)	2224	2317	2231	2246	16	VDANLLMEGGVAQTEP	80.27
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	815	831	17	GENNLGGQSEEITITED	81.84
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	855	873	19	SQEDIVLGGPGQVIDFTED	77.57
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	882	889	8	NSHTITED	79.93
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	895	901	7	EDEVIIG	94.46
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	903	912	10	QGQVIDFTED	80
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	926	932	7	GTVLEED	80.27
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	938	944	7	EDEVIIG	94.46
DP01032	Q06556	Fibronectin binding protein	Streptococcus dysgalactiae	810	969	946	955	10	QGQVIDFTED	80
DP01033	Q91006	Tropomodulin	Gallus gallus (Chicken)	1	92