| DisProt ID | UniProt Acc | Protein | Organism | Start (IDR) |
End (IDR) |
Start (CAR) |
End (CAR) |
CAR Length | Sequence | Waltz Score |
|---|---|---|---|---|---|---|---|---|---|---|
| DP00003 | P03265 | DNA-binding protein (DBP) (Early 2A protein) (Early E2A DNA-binding protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 294 | 334 | 294 | 304 | 11 | EHVIEMDVTSE | 79.93 |
| DP00004 | P49913 | Cathelicidin antimicrobial peptide (18 kDa cationic antimicrobial protein) (CAP-18) (hCAP-18) Cleaved into: Antibacterial peptide FALL-39 (FALL-39 peptide antibiotic); Antibacterial peptide LL-37 | Homo sapiens (Human) | 134 | 170 | 134 | 141 | 8 | LLGDFFRK | 76.25 |
| DP00004 | P49913 | Cathelicidin antimicrobial peptide (18 kDa cationic antimicrobial protein) (CAP-18) (hCAP-18) Cleaved into: Antibacterial peptide FALL-39 (FALL-39 peptide antibiotic); Antibacterial peptide LL-37 | Homo sapiens (Human) | 134 | 170 | 149 | 165 | 17 | EFKRIVQRIKDFLRNLV | 76.79 |
| DP00005 | P03045 | Antitermination protein N (Regulatory protein N) (PN) | Escherichia phage lambda (Bacteriophage lambda) | 1 | 107 | 15 | 30 | 16 | QAQWKAANPLLVGVSA | 77.17 |
| DP00005 | P03045 | Antitermination protein N (Regulatory protein N) (PN) | Escherichia phage lambda (Bacteriophage lambda) | 1 | 107 | 48 | 76 | 29 | VESALNPIDLTVLAEYHKQIESNLQRIER | 80.83 |
| DP00005 | P03045 | Antitermination protein N (Regulatory protein N) (PN) | Escherichia phage lambda (Bacteriophage lambda) | 1 | 36 | 15 | 30 | 16 | QAQWKAANPLLVGVSA | 77.17 |
| DP00006 | P00004 | Cytochrome c | Equus caballus (Horse) | 1 | 104 | 7 | 21 | 15 | GKKIFVQKCAQCHTV | 80.6 |
| DP00006 | P00004 | Cytochrome c | Equus caballus (Horse) | 1 | 104 | 45 | 76 | 32 | PGFTYTDANKNKGITWKEETLMEYLENPKKYI | 80.04 |
| DP00006 | P00004 | Cytochrome c | Equus caballus (Horse) | 1 | 104 | 78 | 87 | 10 | GTKMIFAGIK | 76.22 |
| DP00006 | P00004 | Cytochrome c | Equus caballus (Horse) | 1 | 104 | 92 | 99 | 8 | REDLIAYL | 81.52 |
| DP00008 | Q64693 | POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) | Mus musculus (Mouse) | 1 | 256 | 48 | 54 | 7 | TAVVLPH | 75.25 |
| DP00008 | Q64693 | POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) | Mus musculus (Mouse) | 1 | 256 | 56 | 63 | 8 | PLATYSTV | 76.05 |
| DP00008 | Q64693 | POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) | Mus musculus (Mouse) | 1 | 256 | 84 | 90 | 7 | CAGWLSQ | 84.33 |
| DP00008 | Q64693 | POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) | Mus musculus (Mouse) | 1 | 256 | 104 | 124 | 21 | PYTEYVSHEAVSCPYSTDMYV | 77.26 |
| DP00008 | Q64693 | POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) | Mus musculus (Mouse) | 1 | 256 | 137 | 150 | 14 | SSVLTYASPPLITN | 91.81 |
| DP00008 | Q64693 | POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) | Mus musculus (Mouse) | 1 | 256 | 189 | 195 | 7 | SSLQYQP | 76.25 |
| DP00008 | Q64693 | POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) | Mus musculus (Mouse) | 1 | 256 | 206 | 213 | 8 | VQLPISIP | 80.6 |
| DP00008 | Q64693 | POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) | Mus musculus (Mouse) | 1 | 256 | 226 | 251 | 26 | AISSLTIDKLLLEEEESNTYELNHTL | 78.69 |
| DP00008 | Q64693 | POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1) | Mus musculus (Mouse) | 1 | 65 | 48 | 54 | 7 | TAVVLPH | 75.25 |
| DP00011 | P0DMM9 | Sulfotransferase 1A3 (ST1A3) (EC 2.8.2.1) (Aryl sulfotransferase 1A3/1A4) (Catecholamine-sulfating phenol sulfotransferase) (HAST3) (M-PST) (Monoamine-sulfating phenol sulfotransferase) (Placental estrogen sulfotransferase) (Sulfotransferase 1A3/1A4) (Sulfotransferase; monoamine-preferring) (Thermolabile phenol sulfotransferase) (TL-PST) | Homo sapiens (Human) | 215 | 260 | 223 | 232 | 10 | MVQHTSFKEM | 74.75 |
| DP00011 | P0DMM9 | Sulfotransferase 1A3 (ST1A3) (EC 2.8.2.1) (Aryl sulfotransferase 1A3/1A4) (Catecholamine-sulfating phenol sulfotransferase) (HAST3) (M-PST) (Monoamine-sulfating phenol sulfotransferase) (Placental estrogen sulfotransferase) (Sulfotransferase 1A3/1A4) (Sulfotransferase; monoamine-preferring) (Thermolabile phenol sulfotransferase) (TL-PST) | Homo sapiens (Human) | 215 | 260 | 236 | 255 | 20 | PMTNYTTVPQELMDHSISPF | 78.04 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 654 | 838 | 659 | 673 | 15 | NSILTETLHRFSLEG | 75.18 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 654 | 838 | 675 | 682 | 8 | APVSWTET | 76.25 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 654 | 838 | 698 | 718 | 21 | KNSILNPINSIRKFSIVQKTP | 77.51 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 654 | 838 | 744 | 758 | 15 | QGEAILPRISVISTG | 78.64 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 654 | 838 | 766 | 774 | 9 | RQSVLNLMT | 77.52 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 654 | 838 | 779 | 785 | 7 | QGQNIHR | 84.62 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 654 | 838 | 799 | 810 | 12 | QANLTELDIYSR | 77.17 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 654 | 838 | 816 | 833 | 18 | TGLEISEEINEEDLKECF | 85.01 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 708 | 831 | 709 | 718 | 10 | RKFSIVQKTP | 74.55 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 708 | 831 | 744 | 758 | 15 | QGEAILPRISVISTG | 78.64 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 708 | 831 | 766 | 774 | 9 | RQSVLNLMT | 77.52 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 708 | 831 | 779 | 785 | 7 | QGQNIHR | 84.62 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 708 | 831 | 799 | 810 | 12 | QANLTELDIYSR | 77.17 |
| DP00012 | P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | Homo sapiens (Human) | 708 | 831 | 816 | 826 | 11 | TGLEISEEINE | 84.68 |
| DP00014 | P05371 | Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain | Rattus norvegicus (Rat) | 66 | 97 | 68 | 76 | 9 | SLLNSLEEA | 80.27 |
| DP00014 | P05371 | Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain | Rattus norvegicus (Rat) | 386 | 447 | 403 | 409 | 7 | VVVKLFD | 84.71 |
| DP00014 | P05371 | Clusterin (Dimeric acid glycoprotein) (DAG) (Sulfated glycoprotein 2) (SGP-2) (Testosterone repressed prostate message 2) (TRPM-2) Cleaved into: Clusterin beta chain; Clusterin alpha chain | Rattus norvegicus (Rat) | 386 | 447 | 436 | 442 | 7 | ALQEYRR | 90.64 |
| DP00015 | P61926 | cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform) | Oryctolagus cuniculus (Rabbit) | 1 | 76 | 2 | 15 | 14 | TDVETTYADFIASG | 79.34 |
| DP00015 | P61926 | cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform) | Oryctolagus cuniculus (Rabbit) | 1 | 76 | 22 | 51 | 30 | AIHDILVSSASGNSNELALKLAGLDINKTE | 77.65 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 1 | 164 | 38 | 44 | 7 | MAGCIQE | 79.93 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 1 | 164 | 47 | 57 | 11 | ERWNFDFVTET | 81.57 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 1 | 164 | 61 | 68 | 8 | GDFAWERV | 77.55 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 1 | 164 | 111 | 120 | 10 | VDLSLSCTLV | 74.88 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 1 | 164 | 147 | 159 | 13 | MTDFYHSKRRLIF | 80.86 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 1 | 94 | 38 | 44 | 7 | MAGCIQE | 79.93 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 1 | 94 | 47 | 57 | 11 | ERWNFDFVTET | 81.57 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 1 | 94 | 61 | 68 | 8 | GDFAWERV | 77.55 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 9 | 84 | 38 | 44 | 7 | MAGCIQE | 79.93 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 9 | 84 | 47 | 57 | 11 | ERWNFDFVTET | 81.57 |
| DP00016 | P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | Homo sapiens (Human) | 9 | 84 | 61 | 68 | 8 | GDFAWERV | 77.55 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 1 | 316 | 23 | 35 | 13 | VLVRTSACRSLFG | 75.61 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 1 | 316 | 49 | 66 | 18 | RLAELNAEDQNRWDYDFQ | 75.4 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 1 | 316 | 76 | 82 | 7 | RLQWTEV | 86.62 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 1 | 316 | 86 | 95 | 10 | SVPAFYRETV | 78.09 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 1 | 316 | 109 | 117 | 9 | VAVAVAVSP | 74.73 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 1 | 316 | 173 | 181 | 9 | VAVAVLAPA | 77.03 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 1 | 316 | 239 | 248 | 10 | ADQLHSGISG | 74.98 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 1 | 316 | 254 | 278 | 25 | TAAASANGAAIKKLSGPLISDFFAK | 78.13 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 27 | 97 | 49 | 66 | 18 | RLAELNAEDQNRWDYDFQ | 75.4 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 27 | 97 | 76 | 82 | 7 | RLQWTEV | 86.62 |
| DP00017 | P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | Homo sapiens (Human) | 27 | 97 | 86 | 92 | 7 | SVPAFYR | 78.02 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 1 | 198 | 28 | 34 | 7 | ACRNLFG | 75.35 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 1 | 198 | 56 | 68 | 13 | SQRKWNFDFQNHK | 80.55 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 1 | 198 | 70 | 81 | 12 | LEGKYEWQEVEK | 75.42 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 1 | 50 | 28 | 34 | 7 | ACRNLFG | 75.35 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 22 | 105 | 28 | 34 | 7 | ACRNLFG | 75.35 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 22 | 105 | 56 | 68 | 13 | SQRKWNFDFQNHK | 80.55 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 22 | 105 | 70 | 81 | 12 | LEGKYEWQEVEK | 75.42 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 22 | 97 | 28 | 34 | 7 | ACRNLFG | 75.35 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 22 | 97 | 56 | 68 | 13 | SQRKWNFDFQNHK | 80.55 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 22 | 97 | 70 | 81 | 12 | LEGKYEWQEVEK | 75.42 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 25 | 93 | 28 | 34 | 7 | ACRNLFG | 75.35 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 25 | 93 | 56 | 68 | 13 | SQRKWNFDFQNHK | 80.55 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 25 | 93 | 70 | 81 | 12 | LEGKYEWQEVEK | 75.42 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 55 | 95 | 56 | 68 | 13 | SQRKWNFDFQNHK | 80.55 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 55 | 95 | 70 | 81 | 12 | LEGKYEWQEVEK | 75.42 |
| DP00018 | P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | Homo sapiens (Human) | 66 | 88 | 70 | 81 | 12 | LEGKYEWQEVEK | 75.42 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 123 | 5 | 15 | 11 | DDFETAPAEYV | 81.57 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 123 | 40 | 60 | 21 | AEVKANQNEENTGATAAETSE | 75.94 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 123 | 78 | 88 | 11 | VGVTTTTPSIA | 79.93 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 123 | 92 | 106 | 15 | ATANIASTSGASVTE | 77.12 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 210 | 359 | 229 | 238 | 10 | GVDNSNSNSD | 74.98 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 210 | 359 | 246 | 264 | 19 | KTEIISTNTNGATEDSTSE | 76.98 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 210 | 359 | 279 | 296 | 18 | QAQLLRQHVSSTASITSG | 80.49 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 210 | 359 | 300 | 306 | 7 | DLVQIEQ | 81.08 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 210 | 359 | 313 | 320 | 8 | NNNNSNVN | 79.93 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 210 | 359 | 339 | 351 | 13 | GNASFQAQRSMIS | 75.3 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 594 | 674 | 598 | 604 | 7 | RARNYSS | 76.64 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 594 | 674 | 612 | 634 | 23 | ANAASANAAAAAAAAASNSYAIP | 77.74 |
| DP00020 | P11938 | DNA-binding protein RAP1 (Repressor/activator site-binding protein) (SBF-E) (TUF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 594 | 674 | 642 | 669 | 28 | DTMNFISSLKNDLSNISNSLPFEYPHEI | 80.76 |
| DP00021 | P13551 | Elongation factor G (EF-G) | Thermus thermophilus | 40 | 67 | 43 | 57 | 15 | GEVHEGAATMDFMEQ | 74.31 |
| DP00021 | P13551 | Elongation factor G (EF-G) | Thermus thermophilus | 40 | 64 | 43 | 57 | 15 | GEVHEGAATMDFMEQ | 74.31 |
| DP00024 | P03129 | Protein E7 | Human papillomavirus type 16 | 1 | 40 | 7 | 14 | 8 | TLHEYMLD | 86.96 |
| DP00024 | P03129 | Protein E7 | Human papillomavirus type 16 | 1 | 40 | 19 | 35 | 17 | TTDLYCYEQLNDSSEEE | 80.17 |
| DP00024 | P03129 | Protein E7 | Human papillomavirus type 16 | 16 | 40 | 19 | 35 | 17 | TTDLYCYEQLNDSSEEE | 80.17 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 745 | 874 | 749 | 756 | 8 | GNQSFEED | 80.02 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 745 | 874 | 766 | 778 | 13 | QGGNIVDIDFDSV | 80.73 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 745 | 874 | 787 | 794 | 8 | GNQSFEED | 80.02 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 745 | 874 | 804 | 816 | 13 | HGGNIIDIDFDSV | 79.42 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 745 | 874 | 818 | 832 | 15 | HIHGFNKHTEIIEED | 76.77 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 745 | 874 | 846 | 853 | 8 | NSVDFEED | 76.92 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 746 | 858 | 749 | 756 | 8 | GNQSFEED | 80.02 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 746 | 858 | 766 | 778 | 13 | QGGNIVDIDFDSV | 80.73 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 746 | 858 | 787 | 794 | 8 | GNQSFEED | 80.02 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 746 | 858 | 804 | 816 | 13 | HGGNIIDIDFDSV | 79.42 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 746 | 858 | 818 | 832 | 15 | HIHGFNKHTEIIEED | 76.77 |
| DP00025 | P14738 | Fibronectin-binding protein A (FnbpA) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 746 | 858 | 846 | 853 | 8 | NSVDFEED | 76.92 |
| DP00026 | P06179 | Flagellin (Phase 1-I flagellin) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 65 | 1 | 41 | 41 | MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSA | 80.89 |
| DP00026 | P06179 | Flagellin (Phase 1-I flagellin) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 65 | 46 | 60 | 15 | AGQAIANRFTANIKG | 83.21 |
| DP00026 | P06179 | Flagellin (Phase 1-I flagellin) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 455 | 494 | 455 | 489 | 35 | EDSDYATEVSNMSRAQILQQAGTSVLAQANQVPQN | 76.88 |
| DP00027 | P26477 | Negative regulator of flagellin synthesis (Anti-sigma-28 factor) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 97 | 36 | 51 | 16 | ATSASVTLSDAQAKLM | 79.35 |
| DP00027 | P26477 | Negative regulator of flagellin synthesis (Anti-sigma-28 factor) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 97 | 54 | 61 | 8 | GVSDINME | 80.94 |
| DP00027 | P26477 | Negative regulator of flagellin synthesis (Anti-sigma-28 factor) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 97 | 78 | 92 | 15 | DTGKIADSLIREAQS | 85.95 |
| DP00027 | P26477 | Negative regulator of flagellin synthesis (Anti-sigma-28 factor) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 41 | 97 | 54 | 61 | 8 | GVSDINME | 80.94 |
| DP00027 | P26477 | Negative regulator of flagellin synthesis (Anti-sigma-28 factor) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 41 | 97 | 78 | 92 | 15 | DTGKIADSLIREAQS | 85.95 |
| DP00028 | Q13541 | Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) | Homo sapiens (Human) | 1 | 118 | 32 | 47 | 16 | GDYSTTPGGTLFSTTP | 76.02 |
| DP00028 | Q13541 | Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) | Homo sapiens (Human) | 1 | 118 | 49 | 62 | 14 | GTRIIYDRKFLMEC | 82.68 |
| DP00028 | Q13541 | Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) | Homo sapiens (Human) | 1 | 55 | 32 | 47 | 16 | GDYSTTPGGTLFSTTP | 76.02 |
| DP00028 | Q13541 | Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) | Homo sapiens (Human) | 5 | 118 | 32 | 47 | 16 | GDYSTTPGGTLFSTTP | 76.02 |
| DP00028 | Q13541 | Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) | Homo sapiens (Human) | 5 | 118 | 49 | 62 | 14 | GTRIIYDRKFLMEC | 82.68 |
| DP00028 | Q13541 | Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) | Homo sapiens (Human) | 49 | 83 | 49 | 62 | 14 | GTRIIYDRKFLMEC | 82.68 |
| DP00028 | Q13541 | Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) | Homo sapiens (Human) | 50 | 84 | 50 | 62 | 13 | TRIIYDRKFLMEC | 82.3 |
| DP00030 | P04150 | Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) | Homo sapiens (Human) | 77 | 262 | 80 | 91 | 12 | KAVSLSMGLYMG | 88.04 |
| DP00030 | P04150 | Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) | Homo sapiens (Human) | 77 | 262 | 106 | 114 | 9 | QQGQISLSS | 81.05 |
| DP00030 | P04150 | Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) | Homo sapiens (Human) | 77 | 262 | 117 | 135 | 19 | TDLKLLEESIANLNRSTSV | 82.47 |
| DP00030 | P04150 | Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) | Homo sapiens (Human) | 77 | 262 | 179 | 202 | 24 | GNVKLYTTDQSTFDILQDLEFSSG | 78.34 |
| DP00030 | P04150 | Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) | Homo sapiens (Human) | 77 | 262 | 215 | 227 | 13 | SDLLIDENCLLSP | 83.33 |
| DP00030 | P04150 | Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) | Homo sapiens (Human) | 77 | 262 | 232 | 244 | 13 | DDSFLLEGNSNED | 77.98 |
| DP00032 | P56206 | Glycine--tRNA ligase (EC 6.1.1.14) (Glycyl-tRNA synthetase) (GlyRS) | Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) | 85 | 170 | 119 | 134 | 16 | MEVEEENLHALVQAMM | 75.08 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 271 | 299 | 29 | IIFGIFGLTVMLFVFLFSKQQRIKMLILP | 84.02 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 320 | 330 | 11 | EEVNTILAIHD | 87.35 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 341 | 351 | 11 | SWVEFIELDID | 78.9 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 362 | 369 | 8 | TDRLLSSD | 73.91 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 393 | 407 | 15 | DILETDFNANDIHEG | 78.93 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 421 | 428 | 8 | ADLLCLDQ | 77.26 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 445 | 453 | 9 | QPSVIQAEK | 75.25 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 469 | 494 | 26 | QAAHIQLSNPSSLSNIDFYAQVSDIT | 83.32 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 497 | 503 | 7 | GSVVLSP | 78.93 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 524 | 539 | 16 | CQENFLMDNAYFCEAD | 82.48 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 561 | 575 | 15 | NQEDIYITTESLTTA | 80.91 |
| DP00033 | P10912 | Growth hormone receptor (GH receptor) (Somatotropin receptor) Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein) | Homo sapiens (Human) | 270 | 620 | 596 | 613 | 18 | TSIHIVQSPQGLILNATA | 83.02 |
| DP00036 | P22121 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) | 1 | 195 | 5 | 22 | 18 | DSVETMDEISNPNNILLP | 82.72 |
| DP00036 | P22121 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) | 1 | 195 | 30 | 41 | 12 | ATGISGSQEPYG | 74.58 |
| DP00036 | P22121 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) | 1 | 195 | 58 | 69 | 12 | DEPLIEDIVNPS | 80.52 |
| DP00036 | P22121 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) | 1 | 195 | 89 | 101 | 13 | LQQPISLDHVITR | 78.29 |
| DP00036 | P22121 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) | 1 | 195 | 105 | 136 | 32 | AGGVYSIGNSSTSSAAKLSDGDLTNATDPLLN | 76.41 |
| DP00037 | Q9Y9L0 | Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin) | Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) | 197 | 250 | 207 | 216 | 10 | CLDWWFCWDT | 81.81 |
| DP00037 | Q9Y9L0 | Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin) | Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) | 197 | 250 | 221 | 230 | 10 | DDVEEARRYL | 76.25 |
| DP00037 | Q9Y9L0 | Peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (ApTPx) (Thioredoxin-dependent peroxiredoxin) | Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) | 197 | 250 | 238 | 245 | 8 | AKLLYEEA | 77.97 |
| DP00041 | P07746 | High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) | 1 | 204 | 11 | 22 | 12 | KMSSYAYFVQTR | 81.1 |
| DP00041 | P07746 | High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) | 1 | 204 | 33 | 41 | 9 | ASVNFSEFS | 89.37 |
| DP00041 | P07746 | High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) | 1 | 204 | 97 | 107 | 11 | PSSAFFIFCAD | 82.7 |
| DP00041 | P07746 | High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) | 1 | 204 | 128 | 144 | 17 | LGEKWNNLTAEDKVPYE | 79.58 |
| DP00041 | P07746 | High mobility group-T protein (HMG-T) (HMG-T1) (HMG-1) | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) | 1 | 204 | 157 | 163 | 7 | DITAYRN | 79.93 |
| DP00043 | P02929 | Protein TonB | Escherichia coli (strain K12) | 103 | 151 | 138 | 146 | 9 | ATAATSKPV | 75.59 |
| DP00047 | P02687 | Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) | Bos taurus (Bovine) | 1 | 169 | 8 | 20 | 13 | QRSKYLASASTMD | 77.46 |
| DP00047 | P02687 | Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) | Bos taurus (Bovine) | 1 | 169 | 38 | 46 | 9 | SLGRFFGSD | 79.04 |
| DP00047 | P02687 | Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) | Bos taurus (Bovine) | 1 | 169 | 84 | 93 | 10 | PVVHFFKNIV | 86.76 |
| DP00047 | P02687 | Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) | Bos taurus (Bovine) | 1 | 169 | 107 | 117 | 11 | GLSLSRFSWGA | 76.28 |
| DP00047 | P02687 | Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) | Bos taurus (Bovine) | 1 | 169 | 145 | 156 | 12 | AQGTLSKIFKLG | 79.68 |
| DP00047 | P02687 | Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) | Bos taurus (Bovine) | 1 | 109 | 8 | 20 | 13 | QRSKYLASASTMD | 77.46 |
| DP00047 | P02687 | Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) | Bos taurus (Bovine) | 1 | 109 | 38 | 46 | 9 | SLGRFFGSD | 79.04 |
| DP00047 | P02687 | Myelin basic protein (MBP) (20 kDa microtubule-stabilizing protein) (Myelin A1 protein) | Bos taurus (Bovine) | 1 | 109 | 84 | 93 | 10 | PVVHFFKNIV | 86.76 |
| DP00048 | P03406 | "Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein" | Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) (HIV-1) | 149 | 178 | 158 | 166 | 9 | KGENTSLLH | 75.7 |
| DP00048 | P03406 | "Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein" | Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) (HIV-1) | 149 | 177 | 158 | 166 | 9 | KGENTSLLH | 75.7 |
| DP00049 | P70475 | Myelin transcription factor 1-like protein | Rattus norvegicus | 487 | 606 | 558 | 565 | 8 | GHVNSNRN | 86.62 |
| DP00051 | P07805 | Ornithine decarboxylase (ODC) (EC 4.1.1.17) | Trypanosoma brucei brucei | 1 | 35 | 9 | 21 | 13 | LSCRFLEGFNTRD | 78.72 |
| DP00051 | P07805 | Ornithine decarboxylase (ODC) (EC 4.1.1.17) | Trypanosoma brucei brucei | 1 | 35 | 23 | 30 | 8 | LCKKISMN | 76.25 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 22 | 39 | 18 | TEVAEEIVEEETVVEETG | 79.08 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 47 | 69 | 23 | VQVEMGEFEDGAEETVEEVVADN | 75.24 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 103 | 128 | 26 | PIGEFEKVCSNDNKTFDSSCHFFATK | 78.52 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 140 | 152 | 13 | LHLDYIGPCKYIA | 80.65 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 155 | 163 | 9 | LDSELTEFP | 74.21 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 167 | 180 | 14 | RDWLKNVLVTLYER | 83.09 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 183 | 190 | 8 | GNNLLTEK | 78.18 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 219 | 250 | 32 | FEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTE | 81.52 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 265 | 273 | 9 | TTRFFETCD | 79.52 |
| DP00052 | P07214 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | Mus musculus (Mouse) | 18 | 302 | 276 | 297 | 22 | NDKYIALEEWAGCFGIKEQDIN | 81.73 |
| DP00053 | P27001 | Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) | Thermus thermophilus | 1 | 101 | 2 | 20 | 19 | LEEALAAIQNARDLEELKA | 77.29 |
| DP00053 | P27001 | Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) | Thermus thermophilus | 1 | 101 | 29 | 35 | 7 | KGLLTQE | 75.92 |
| DP00053 | P27001 | Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) | Thermus thermophilus | 1 | 101 | 51 | 69 | 19 | GQELNAIKAALEAALEARE | 78.17 |
| DP00053 | P27001 | Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) | Thermus thermophilus | 1 | 84 | 2 | 20 | 19 | LEEALAAIQNARDLEELKA | 77.29 |
| DP00053 | P27001 | Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) | Thermus thermophilus | 1 | 84 | 29 | 35 | 7 | KGLLTQE | 75.92 |
| DP00053 | P27001 | Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) | Thermus thermophilus | 1 | 84 | 51 | 69 | 19 | GQELNAIKAALEAALEARE | 78.17 |
| DP00054 | P78356 | Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta) | Homo sapiens (Human) | 1 | 33 | 9 | 18 | 10 | TAVAVAPLSA | 74.58 |
| DP00054 | P78356 | Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta) | Homo sapiens (Human) | 304 | 342 | 313 | 322 | 10 | GGNLLCSYGT | 83.95 |
| DP00054 | P78356 | Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta) | Homo sapiens (Human) | 304 | 342 | 328 | 337 | 10 | GNLLSFPRFF | 80.87 |
| DP00055 | P10688 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1) | Rattus norvegicus (Rat) | 130 | 202 | 140 | 147 | 8 | KLQHWIHS | 79.06 |
| DP00055 | P10688 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1) | Rattus norvegicus (Rat) | 130 | 202 | 158 | 165 | 8 | NKMNFKEL | 74.25 |
| DP00055 | P10688 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1) | Rattus norvegicus (Rat) | 130 | 202 | 170 | 188 | 19 | KELNIQVDDGYARKIFREC | 78.51 |
| DP00055 | P10688 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1) | Rattus norvegicus (Rat) | 445 | 482 | 463 | 470 | 8 | VEAAEMED | 73.91 |
| DP00061 | P27694 | Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) Cleaved into: Replication protein A 70 kDa DNA-binding subunit; N-terminally processed | Homo sapiens (Human) | 105 | 180 | 108 | 119 | 12 | VGVKIGNPVPYN | 83.61 |
| DP00061 | P27694 | Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) Cleaved into: Replication protein A 70 kDa DNA-binding subunit; N-terminally processed | Homo sapiens (Human) | 105 | 180 | 155 | 166 | 12 | VSKAYGASKTFG | 75.14 |
| DP00061 | P27694 | Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) Cleaved into: Replication protein A 70 kDa DNA-binding subunit; N-terminally processed | Homo sapiens (Human) | 109 | 168 | 155 | 163 | 9 | VSKAYGASK | 75.33 |
| DP00062 | P19793 | Retinoic acid receptor RXR-alpha (Nuclear receptor subfamily 2 group B member 1) (Retinoid X receptor alpha) | Homo sapiens (Human) | 1 | 130 | 9 | 21 | 13 | LDFSTQVNSSLTS | 80.63 |
| DP00062 | P19793 | Retinoic acid receptor RXR-alpha (Nuclear receptor subfamily 2 group B member 1) (Retinoid X receptor alpha) | Homo sapiens (Human) | 1 | 130 | 84 | 96 | 13 | TLGFSTGSPQLSS | 75.59 |
| DP00063 | P49799 | Regulator of G-protein signaling 4 (RGP4) (RGS4) | Rattus norvegicus (Rat) | 1 | 50 | 22 | 31 | 10 | RLGFLLQKSD | 74.98 |
| DP00064 | P03607 | Capsid protein (Coat protein) | Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea)) | 1 | 64 | 1 | 8 | 8 | MSGLFHHR | 77.26 |
| DP00064 | P03607 | Capsid protein (Coat protein) | Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea)) | 1 | 64 | 13 | 25 | 13 | EIRAFVMATRLTK | 76.79 |
| DP00064 | P03607 | Capsid protein (Coat protein) | Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea)) | 1 | 64 | 28 | 36 | 9 | LAQAIQNTL | 87.55 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 571 | 580 | 10 | KIGNYVWEDT | 90.77 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 584 | 590 | 7 | GVQELGE | 75.25 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 593 | 606 | 14 | VGNVTVTVFDNNTN | 79.77 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 616 | 624 | 9 | EDGSYLIPN | 84.76 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 630 | 638 | 9 | YRVEFSNLP | 77 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 659 | 666 | 8 | LSSVITVN | 84.95 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 668 | 692 | 25 | KDNLSADLGIYKPKYNLGDYVWEDT | 84.78 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 708 | 735 | 28 | VTVTLKDENGNVLKTVTTDADGKYKFTD | 77.26 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 737 | 752 | 16 | DNGNYKVEFTTPEGYT | 77.63 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 754 | 763 | 10 | TTVTSGSDIE | 75.59 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 767 | 803 | 37 | NGLTTTGVINGADNMTLDSGFYKTPKYNLGNYVWEDT | 82.3 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 819 | 835 | 17 | VTVTLKNENGEVLQTTK | 76.35 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 838 | 863 | 26 | KDGKYQFTGLENGTYKVEFETPSGYT | 75.89 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 871 | 888 | 18 | TDEGIDSNGTSTTGVIKD | 75.92 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 894 | 913 | 20 | IDSGFYKPTYNLGDYVWEDT | 80.55 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 939 | 973 | 35 | KVLKTVTTDENGKYQFTDLNNGTYKVEFETPSGYT | 76.29 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 988 | 1023 | 36 | NGLTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYD | 78.2 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 1040 | 1056 | 17 | VKVTLLNEKGEVIGTTK | 76.08 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 1059 | 1079 | 21 | ENGKYCFDNLDSGKYKVIFEK | 80.97 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 1102 | 1108 | 7 | VDVTITD | 97.32 |
| DP00065 | O86488 | Serine-aspartate repeat-containing protein D | Staphylococcus aureus (strain Newman) | 569 | 1123 | 1110 | 1118 | 9 | DDFTLDNGY | 78.93 |
| DP00066 | P27285 | Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) | Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus) | 1 | 113 | 2 | 10 | 9 | NRGFFNMLG | 87.18 |
| DP00066 | P27285 | Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) | Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus) | 1 | 113 | 38 | 57 | 20 | LASQIQQLTTAVSALVIGQA | 81.59 |
| DP00067 | Q57733 | Small heat shock protein HSP16.5 | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) | 1 | 32 | 7 | 27 | 21 | FDSLFERMFKEFFATPMTGTT | 83.9 |
| DP00068 | P60881 | Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) | Rattus norvegicus (Rat) | 1 | 206 | 18 | 28 | 11 | ADQLADESLES | 74.03 |
| DP00068 | P60881 | Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) | Rattus norvegicus (Rat) | 1 | 206 | 33 | 51 | 19 | LQLVEESKDAGIRTLVMLD | 78.31 |
| DP00068 | P60881 | Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) | Rattus norvegicus (Rat) | 1 | 206 | 56 | 70 | 15 | QLERIEEGMDQINKD | 76.72 |
| DP00068 | P60881 | Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) | Rattus norvegicus (Rat) | 1 | 206 | 80 | 89 | 10 | DLGKFCGLCV | 79.93 |
| DP00068 | P60881 | Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) | Rattus norvegicus (Rat) | 1 | 206 | 125 | 136 | 12 | EQMAISGGFIRR | 81.3 |
| DP00068 | P60881 | Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) | Rattus norvegicus (Rat) | 1 | 206 | 146 | 161 | 16 | MDENLEQVSGIIGNLR | 82.32 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 140 | 14 | 29 | 16 | GVVAAAEKTKQGVAEA | 76.42 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 140 | 35 | 41 | 7 | EGVLYVG | 97.32 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 140 | 50 | 66 | 17 | HGVATVAEKTKEQVTNV | 76.53 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 140 | 68 | 82 | 15 | GAVVTGVTAVAQKTV | 78.51 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 140 | 84 | 98 | 15 | GAGSIAAATGFVKKD | 79.53 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 140 | 109 | 116 | 8 | QEGILEDM | 74.92 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 140 | 121 | 127 | 7 | DNEAYEM | 80.12 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 140 | 129 | 135 | 7 | SEEGYQD | 78.02 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 103 | 14 | 29 | 16 | GVVAAAEKTKQGVAEA | 76.42 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 103 | 35 | 41 | 7 | EGVLYVG | 97.32 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 103 | 50 | 66 | 17 | HGVATVAEKTKEQVTNV | 76.53 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 103 | 68 | 82 | 15 | GAVVTGVTAVAQKTV | 78.51 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 103 | 84 | 98 | 15 | GAGSIAAATGFVKKD | 79.53 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 102 | 14 | 29 | 16 | GVVAAAEKTKQGVAEA | 76.42 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 102 | 35 | 41 | 7 | EGVLYVG | 97.32 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 102 | 50 | 66 | 17 | HGVATVAEKTKEQVTNV | 76.53 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 102 | 68 | 82 | 15 | GAVVTGVTAVAQKTV | 78.51 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 1 | 102 | 84 | 97 | 14 | GAGSIAAATGFVKK | 79.84 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 42 | 92 | 50 | 66 | 17 | HGVATVAEKTKEQVTNV | 76.53 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 42 | 92 | 68 | 82 | 15 | GAVVTGVTAVAQKTV | 78.51 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 61 | 95 | 68 | 82 | 15 | GAVVTGVTAVAQKTV | 78.51 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 61 | 95 | 84 | 90 | 7 | GAGSIAA | 84.42 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 101 | 140 | 109 | 116 | 8 | QEGILEDM | 74.92 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 101 | 140 | 121 | 127 | 7 | DNEAYEM | 80.12 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 101 | 140 | 129 | 135 | 7 | SEEGYQD | 78.02 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 103 | 140 | 109 | 116 | 8 | QEGILEDM | 74.92 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 103 | 140 | 121 | 127 | 7 | DNEAYEM | 80.12 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 103 | 140 | 129 | 135 | 7 | SEEGYQD | 78.02 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 104 | 140 | 109 | 116 | 8 | QEGILEDM | 74.92 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 104 | 140 | 121 | 127 | 7 | DNEAYEM | 80.12 |
| DP00070 | P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | Homo sapiens (Human) | 104 | 140 | 129 | 135 | 7 | SEEGYQD | 78.02 |
| DP00071 | P23441 | Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) | Rattus norvegicus (Rat) | 1 | 156 | 12 | 25 | 14 | SVSDILSPLEESYK | 77.78 |
| DP00071 | P23441 | Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) | Rattus norvegicus (Rat) | 1 | 156 | 37 | 43 | 7 | PLAAYRQ | 76.92 |
| DP00071 | P23441 | Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) | Rattus norvegicus (Rat) | 1 | 156 | 62 | 72 | 11 | GAVTAAYHMTA | 75.83 |
| DP00071 | P23441 | Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) | Rattus norvegicus (Rat) | 1 | 156 | 77 | 95 | 19 | QLSHSAVGGYCNGNLGNMS | 75.04 |
| DP00071 | P23441 | Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) | Rattus norvegicus (Rat) | 1 | 156 | 121 | 129 | 9 | RFPAISRFM | 84.84 |
| DP00071 | P23441 | Homeobox protein Nkx-2.1 (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) | Rattus norvegicus (Rat) | 58 | 78 | 62 | 72 | 11 | GAVTAAYHMTA | 75.83 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 9951 | 9960 | 10 | APEIIDVSSK | 86.96 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 9962 | 9970 | 9 | EEVKIMTIT | 88.52 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 9979 | 9985 | 7 | KEAVYEK | 78.6 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 9993 | 10023 | 31 | KRVFIESFEEPYDELEVEPYTEPFEQPYYEE | 80.65 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10027 | 10033 | 7 | DYEEIKV | 80.6 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10039 | 10061 | 23 | VHEEWEEDFEEGQEYYEREEGYD | 87.97 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10063 | 10088 | 26 | GEEEWEEAYQEREVIQVQKEVYEESH | 80.98 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10112 | 10120 | 9 | VIEKIEKTS | 78.37 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10151 | 10159 | 9 | QEEVIEVKV | 83.02 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10166 | 10188 | 23 | KMVISEEKMFFASHTEEEVSVTV | 78.1 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10191 | 10208 | 18 | VQKEIVTEEKIHVAISKR | 78.3 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10305 | 10318 | 14 | GVVTEEKITIVTQR | 80.72 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10394 | 10405 | 12 | RFVAEEKLSFAV | 76.42 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10418 | 10438 | 21 | AEEEWSYSEEEEGVSISVYRE | 87.69 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10447 | 10474 | 28 | AEVTEYEVMEEPEEYVVEEKLHIISKRV | 81.63 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10479 | 10492 | 14 | AEVTERQEKKIVLK | 76.97 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10567 | 10582 | 16 | HMQITQEEKVLVAVTK | 78.07 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10617 | 10623 | 7 | AKVTEFR | 75.25 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10630 | 10636 | 7 | EKVSIEA | 79.55 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10653 | 10666 | 14 | KERAYTLEEEAVSV | 80.27 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10668 | 10715 | 48 | REEEYEEYEEYDYKEFEEYEPTEEYDQYEEYEEREYERYEEHEEYITE | 79.87 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10774 | 10784 | 11 | FEEKIRISITK | 76.65 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 10833 | 10875 | 43 | EEVAFEEEVVTHVEEYLVEEEEEYIHEEEEFITEEEVVPVIPV | 81.43 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11032 | 11041 | 10 | EEVLFEEEIV | 86.92 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11124 | 11130 | 7 | KKVVIPK | 77.26 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11271 | 11283 | 13 | RTVLEEKVSVAFR | 80.65 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11291 | 11336 | 46 | RLELEVVEAEVEEIPEEEEFHEVEEYFEEGEFHEVEEFIKLEQHRV | 80.6 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11345 | 11360 | 16 | VHRVIEVFEAEEVEVF | 78.11 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11402 | 11408 | 7 | KIVVEEK | 77.26 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11597 | 11603 | 7 | EEVALEE | 76.25 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11606 | 11612 | 7 | AEVVEEP | 76.25 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11733 | 11744 | 12 | EPEEIAPEEEIA | 76.59 |
| DP00072 | Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | Homo sapiens (Human) | 9880 | 12031 | 11820 | 11830 | 11 | VKEKIFQLKAI | 77.77 |
| DP00074 | P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | Homo sapiens (Human) | 1 | 184 | 12 | 25 | 14 | MALLHQIQGNELEP | 75.92 |
| DP00074 | P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | Homo sapiens (Human) | 1 | 184 | 39 | 46 | 8 | LGEVYLDS | 87.5 |
| DP00074 | P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | Homo sapiens (Human) | 1 | 184 | 48 | 75 | 28 | KPAVYNYPEGAAYEFNAAAAANAQVYGQ | 83.25 |
| DP00074 | P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | Homo sapiens (Human) | 1 | 184 | 85 | 92 | 8 | EAAAFGSN | 77.01 |
| DP00074 | P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | Homo sapiens (Human) | 1 | 184 | 126 | 136 | 11 | QQVPYYLENEP | 78.84 |
| DP00075 | P11387 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) | Homo sapiens (Human) | 1 | 206 | 8 | 19 | 12 | NDSQIEADFRLN | 77.45 |
| DP00075 | P11387 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) | Homo sapiens (Human) | 1 | 206 | 106 | 112 | 7 | KENGFSS | 73.91 |
| DP00075 | P11387 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) | Homo sapiens (Human) | 1 | 174 | 8 | 19 | 12 | NDSQIEADFRLN | 77.45 |
| DP00075 | P11387 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) | Homo sapiens (Human) | 1 | 174 | 106 | 112 | 7 | KENGFSS | 73.91 |
| DP00075 | P11387 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) | Homo sapiens (Human) | 175 | 214 | 201 | 209 | 9 | QKWKWWEEE | 77.18 |
| DP00075 | P11387 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) | Homo sapiens (Human) | 636 | 712 | 639 | 652 | 14 | TFEKSMMNLQTKID | 78.12 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 631 | 651 | 638 | 644 | 7 | IDLAFSK | 91.97 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 634 | 681 | 638 | 644 | 7 | IDLAFSK | 91.97 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 634 | 681 | 651 | 658 | 8 | KEWLRQYE | 75.33 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 634 | 681 | 666 | 676 | 11 | TLKEIPISDFI | 76.95 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1070 | 1105 | 1075 | 1085 | 11 | IAEQINDVKGA | 75.55 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1071 | 1105 | 1075 | 1085 | 11 | IAEQINDVKGA | 75.55 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1203 | 1428 | 1222 | 1239 | 18 | EDKNFERILLEQKLVTKS | 77.16 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1203 | 1428 | 1269 | 1277 | 9 | SSSSIFDIK | 81.53 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1203 | 1428 | 1285 | 1301 | 17 | ELSKISNKFKKISTIFD | 81.43 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1203 | 1428 | 1318 | 1329 | 12 | DDVATKKNQTTA | 75.25 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1203 | 1428 | 1348 | 1354 | 7 | KVVELSG | 77.64 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1203 | 1428 | 1356 | 1366 | 11 | SDLEILDSYTD | 81.39 |
| DP00076 | P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1203 | 1428 | 1397 | 1417 | 21 | SYVETLELSDDSFIEDDEEEN | 77.66 |
| DP00078 | P01100 | Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) | Homo sapiens (Human) | 216 | 380 | 216 | 225 | 10 | MSVASLDLTG | 77.26 |
| DP00078 | P01100 | Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) | Homo sapiens (Human) | 216 | 380 | 235 | 245 | 11 | SEEAFTLPLLN | 75.13 |
| DP00078 | P01100 | Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) | Homo sapiens (Human) | 216 | 380 | 270 | 278 | 9 | DDFLFPASS | 91.97 |
| DP00078 | P01100 | Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) | Homo sapiens (Human) | 216 | 380 | 294 | 306 | 13 | LSGSFYAADWEPL | 77.18 |
| DP00078 | P01100 | Proto-oncogene c-Fos (Cellular oncogene fos) (G0/G1 switch regulatory protein 7) | Homo sapiens (Human) | 216 | 380 | 333 | 346 | 14 | SCTAYTSSFVFTYP | 87.03 |
| DP00079 | Q92731 | Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) | Homo sapiens (Human) | 1 | 103 | 12 | 24 | 13 | SPSSYNCSQSILP | 78.06 |
| DP00079 | Q92731 | Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) | Homo sapiens (Human) | 1 | 103 | 26 | 37 | 12 | EHGSIYIPSSYV | 83 |
| DP00079 | Q92731 | Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) | Homo sapiens (Human) | 1 | 103 | 44 | 67 | 24 | PAMTFYSPAVMNYSIPSNVTNLEG | 77.66 |
| DP00081 | P51123 | Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230) | Drosophila melanogaster (Fruit fly) | 11 | 77 | 20 | 29 | 10 | LTGILFGNID | 88.96 |
| DP00081 | P51123 | Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230) | Drosophila melanogaster (Fruit fly) | 11 | 77 | 52 | 63 | 12 | LRENIGSLSKLG | 80.94 |
| DP00081 | P51123 | Transcription initiation factor TFIID subunit 1 (EC 2.7.11.1) (TAFII250) (TBP-associated factor 230 kDa) (p230) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230) | Drosophila melanogaster (Fruit fly) | 11 | 77 | 66 | 72 | 7 | SMLLEVI | 78.26 |
| DP00082 | P39935 | Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 393 | 490 | 393 | 401 | 9 | LEAEIETTT | 76.33 |
| DP00082 | P39935 | Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 393 | 490 | 410 | 420 | 11 | TVSHILNVLKD | 75.8 |
| DP00082 | P39935 | Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 393 | 490 | 424 | 434 | 11 | IEDVFSFNYPE | 88.08 |
| DP00082 | P39935 | Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 393 | 490 | 446 | 462 | 17 | EHVKYTYGPTFLLQFKD | 80.01 |
| DP00082 | P39935 | Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 393 | 490 | 468 | 481 | 14 | ADAEWVQSTASKIV | 83.42 |
| DP00083 | P03069 | General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 101 | 134 | 106 | 115 | 10 | PMFEYENLED | 78.86 |
| DP00083 | P03069 | General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 101 | 134 | 118 | 129 | 12 | KEWTSLFDNDIP | 89.19 |
| DP00083 | P03069 | General control transcription factor GCN4 (Amino acid biosynthesis regulatory protein) (General control protein GCN4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 225 | 281 | 257 | 274 | 18 | VEELLSKNYHLENEVARL | 77 |
| DP00084 | P61244 | Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) | Homo sapiens (Human) | 2 | 110 | 60 | 75 | 16 | RAQILDKATEYIQYMR | 79.58 |
| DP00084 | P61244 | Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) | Homo sapiens (Human) | 2 | 110 | 90 | 101 | 12 | RQNALLEQQVRA | 79.77 |
| DP00085 | Q04206 | Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) | Homo sapiens (Human) | 428 | 551 | 437 | 447 | 11 | SEALLQLQFDD | 82.67 |
| DP00085 | Q04206 | Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) | Homo sapiens (Human) | 428 | 551 | 451 | 458 | 8 | GALLGNST | 76.17 |
| DP00085 | Q04206 | Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) | Homo sapiens (Human) | 428 | 551 | 460 | 484 | 25 | PAVFTDLASVDNSEFQQLLNQGIPV | 77.79 |
| DP00085 | Q04206 | Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) | Homo sapiens (Human) | 428 | 551 | 492 | 507 | 16 | MLMEYPEAITRLVTGA | 80.18 |
| DP00085 | Q04206 | Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) | Homo sapiens (Human) | 428 | 551 | 525 | 546 | 22 | NGLLSGDEDFSSIADMDFSALL | 79.45 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 1 | 93 | 14 | 26 | 13 | LSQETFSDLWKLL | 84.56 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 1 | 93 | 49 | 56 | 8 | DIEQWFTE | 78.6 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 1 | 73 | 14 | 26 | 13 | LSQETFSDLWKLL | 84.56 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 1 | 73 | 49 | 56 | 8 | DIEQWFTE | 78.6 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 1 | 39 | 14 | 26 | 13 | LSQETFSDLWKLL | 84.56 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 14 | 60 | 14 | 26 | 13 | LSQETFSDLWKLL | 84.56 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 14 | 60 | 49 | 55 | 7 | DIEQWFT | 79.31 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 20 | 73 | 49 | 56 | 8 | DIEQWFTE | 78.6 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 41 | 62 | 49 | 56 | 8 | DIEQWFTE | 78.6 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 320 | 393 | 323 | 352 | 30 | LDGEYFTLQIRGRERFEMFRELNEALELKD | 76.74 |
| DP00086 | P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | Homo sapiens (Human) | 325 | 356 | 325 | 351 | 27 | GEYFTLQIRGRERFEMFRELNEALELK | 75.86 |
| DP00087 | P68336 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) | 350 | 394 | 367 | 380 | 14 | TRNNYGSTIEGLLD | 80.65 |
| DP00087 | P68336 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) | 413 | 490 | 417 | 432 | 16 | TDVSLGDELRLDGEEV | 75.92 |
| DP00087 | P68336 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) | 413 | 490 | 461 | 469 | 9 | DPVSYGALD | 77.26 |
| DP00087 | P68336 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) | 413 | 490 | 471 | 485 | 15 | DDFEFEQMFTDAMGI | 76.32 |
| DP00088 | P0ABI8 | Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) | Escherichia coli (strain K12) | 1 | 51 | 17 | 46 | 30 | VMVTIAGIILGGLALVGLITYFGKWTYLWK | 83.99 |
| DP00088 | P0ABI8 | Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) | Escherichia coli (strain K12) | 553 | 663 | 561 | 568 | 8 | RDAFWEMK | 80.85 |
| DP00088 | P0ABI8 | Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) | Escherichia coli (strain K12) | 553 | 663 | 579 | 585 | 7 | HYEEIHM | 75.49 |
| DP00088 | P0ABI8 | Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome b562-o complex subunit I) (Cytochrome o ubiquinol oxidase subunit 1) (Cytochrome o subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase chain A) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) | Escherichia coli (strain K12) | 553 | 663 | 591 | 658 | 68 | AGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPVAEIEKLENQHFDEITKAG | 83.22 |
| DP00089 | P0ABJ1 | Cytochrome bo(3) ubiquinol oxidase subunit 2 (Cytochrome b562-o complex subunit II) (Cytochrome o ubiquinol oxidase subunit 2) (Cytochrome o subunit 2) (Oxidase bo(3) subunit 2) (Ubiquinol oxidase chain B) (Ubiquinol oxidase polypeptide II) (Ubiquinol oxidase subunit 2) | Escherichia coli (strain K12) | 1 | 26 | 2 | 21 | 20 | RLRKYNKSLGWLSLFAGTVL | 86.07 |
| DP00090 | Q14722 | Voltage-gated potassium channel subunit beta-1 (EC 1.1.1.-) (K(+) channel subunit beta-1) (Kv-beta-1) | Homo sapiens (Human) | 1 | 62 | 9 | 19 | 11 | AGSQISEENTK | 77.26 |
| DP00090 | Q14722 | Voltage-gated potassium channel subunit beta-1 (EC 1.1.1.-) (K(+) channel subunit beta-1) (Kv-beta-1) | Homo sapiens (Human) | 1 | 62 | 22 | 28 | 7 | RQSGFSV | 75.59 |
| DP00091 | P27088 | DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog) | Xenopus laevis (African clawed frog) | 1 | 84 | 14 | 28 | 15 | EEEKILSAAVRAKIE | 77.86 |
| DP00091 | P27088 | DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog) | Xenopus laevis (African clawed frog) | 1 | 84 | 66 | 76 | 11 | GGGFFIEEEEA | 78.63 |
| DP00091 | P27088 | DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog) | Xenopus laevis (African clawed frog) | 181 | 265 | 184 | 197 | 14 | SLEVWGSEEALEEA | 79.74 |
| DP00091 | P27088 | DNA repair protein complementing XP-A cells homolog (Xeroderma pigmentosum group A-complementing protein homolog) | Xenopus laevis (African clawed frog) | 181 | 265 | 253 | 260 | 8 | KTCITCGY | 77.38 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 373 | 521 | 393 | 424 | 32 | KEVIRNKIRAIGKMARVFSVLREESESVLTLK | 80.19 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 373 | 521 | 444 | 462 | 19 | LQSATVEAIEADEAIKGFS | 84.99 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 373 | 521 | 466 | 473 | 8 | KITSFEEA | 74.25 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 373 | 521 | 492 | 508 | 17 | SDANLNSINKALTSETN | 83.99 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 373 | 468 | 393 | 424 | 32 | KEVIRNKIRAIGKMARVFSVLREESESVLTLK | 80.19 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 373 | 468 | 444 | 462 | 19 | LQSATVEAIEADEAIKGFS | 84.99 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 373 | 466 | 393 | 424 | 32 | KEVIRNKIRAIGKMARVFSVLREESESVLTLK | 80.19 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 373 | 466 | 444 | 461 | 18 | LQSATVEAIEADEAIKGF | 84.82 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 374 | 468 | 393 | 424 | 32 | KEVIRNKIRAIGKMARVFSVLREESESVLTLK | 80.19 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 374 | 468 | 444 | 462 | 19 | LQSATVEAIEADEAIKGFS | 84.99 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 390 | 414 | 393 | 409 | 17 | KEVIRNKIRAIGKMARV | 80.27 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 467 | 521 | 492 | 508 | 17 | SDANLNSINKALTSETN | 83.99 |
| DP00092 | Q08209 | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) | Homo sapiens (Human) | 487 | 521 | 492 | 508 | 17 | SDANLNSINKALTSETN | 83.99 |
| DP00094 | P04177 | Tyrosine 3-monooxygenase (EC 1.14.16.2) (Tyrosine 3-hydroxylase) (TH) | Rattus norvegicus (Rat) | 1 | 71 | 26 | 36 | 11 | AEAVTSPRFIG | 74.58 |
| DP00094 | P04177 | Tyrosine 3-monooxygenase (EC 1.14.16.2) (Tyrosine 3-hydroxylase) (TH) | Rattus norvegicus (Rat) | 1 | 71 | 38 | 44 | 7 | RQSLIED | 91.97 |
| DP00097 | P10922 | "Histone H1.0 (Histone H1) (Histone H1(0)) (MyD196) Cleaved into: Histone H1.0; N-terminally processed" | Mus musculus (Mouse) | 1 | 30 | 1 | 8 | 8 | MTENSTSA | 73.91 |
| DP00097 | P10922 | "Histone H1.0 (Histone H1) (Histone H1(0)) (MyD196) Cleaved into: Histone H1.0; N-terminally processed" | Mus musculus (Mouse) | 96 | 193 | 103 | 110 | 8 | RSVAFKKT | 80.6 |
| DP00099 | P50440 | Glycine amidinotransferase; mitochondrial (EC 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) | Homo sapiens (Human) | 38 | 63 | 39 | 46 | 8 | TQAATASS | 80.27 |
| DP00100 | P0A6H5 | ATP-dependent protease ATPase subunit HslU (Heat shock protein HslU) (Unfoldase HslU) | Escherichia coli (strain K12) | 175 | 209 | 182 | 188 | 7 | MGVEIMA | 81.37 |
| DP00103 | P09372 | Protein GrpE (HSP-70 cofactor) (HSP24) (Heat shock protein B25.3) | Escherichia coli (strain K12) | 1 | 32 | 13 | 27 | 15 | APEEIIMDQHEEIEA | 82.16 |
| DP00104 | P32773 | Transcription initiation factor IIA large subunit (TFIIA large subunit) (TFIIA 32 kDa subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 210 | 240 | 227 | 234 | 8 | DDYLISEG | 81.73 |
| DP00107 | P69924 | Ribonucleoside-diphosphate reductase 1 subunit beta (EC 1.17.4.1) (Protein B2) (Protein R2) (Ribonucleotide reductase 1) | Escherichia coli (strain K12) | 342 | 376 | 352 | 364 | 13 | VEVSSYLVGQIDS | 79.21 |
| DP00110 | P40881 | Carbonic anhydrase (EC 4.2.1.1) | Methanosarcina thermophila | 1 | 37 | 4 | 27 | 24 | NKQIFTILILSLSLALAGSGCISE | 79.29 |
| DP00111 | P27577 | Protein C-ets-1 (p54) | Mus musculus (Mouse) | 244 | 301 | 248 | 260 | 13 | GQDSFESVESYDS | 79.52 |
| DP00111 | P27577 | Protein C-ets-1 (p54) | Mus musculus (Mouse) | 244 | 301 | 264 | 278 | 15 | LTQSWSSQSSFNSLQ | 81.34 |
| DP00111 | P27577 | Protein C-ets-1 (p54) | Mus musculus (Mouse) | 244 | 301 | 282 | 292 | 11 | SYDSFDYEDYP | 74.46 |
| DP00112 | P22239 | Desiccation-related protein clone PCC6-19 (CDET6-19) | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 155 | 13 | 22 | 10 | HTDEYGNPIQ | 73.91 |
| DP00112 | P22239 | Desiccation-related protein clone PCC6-19 (CDET6-19) | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 155 | 121 | 128 | 8 | DQQQYGTA | 76.46 |
| DP00113 | P31109 | Synaptobrevin homolog 1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 93 | 32 | 51 | 20 | LQAEIDDTVGIMRDNINKVA | 82.84 |
| DP00113 | P31109 | Synaptobrevin homolog 1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 93 | 64 | 75 | 12 | ADNLAVSAQGFK | 75.59 |
| DP00116 | P81455 | Osteocalcin (Bone Gla protein) (BGP) (Gamma-carboxyglutamic acid-containing protein) | Canis lupus familiaris (Dog) (Canis familiaris) | 1 | 49 | 32 | 44 | 13 | LADHIGFQEAYQR | 84.05 |
| DP00118 | P05059 | Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor | Bos taurus (Bovine) | 1 | 449 | 4 | 24 | 21 | AAVLALLLCAGQVIALPVNSP | 83.09 |
| DP00118 | P05059 | Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor | Bos taurus (Bovine) | 1 | 449 | 32 | 44 | 13 | VMKCIVEVISDTL | 82.76 |
| DP00118 | P05059 | Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor | Bos taurus (Bovine) | 1 | 449 | 62 | 85 | 24 | GDERILSILRHQNLLKELQDLALQ | 77.76 |
| DP00118 | P05059 | Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor | Bos taurus (Bovine) | 1 | 449 | 96 | 110 | 15 | KHSSYEDELSEVLEK | 77.93 |
| DP00118 | P05059 | Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor | Bos taurus (Bovine) | 1 | 449 | 118 | 126 | 9 | KEVTEEVSS | 74.58 |
| DP00118 | P05059 | Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor | Bos taurus (Bovine) | 1 | 449 | 306 | 312 | 7 | PQVLFRG | 87.96 |
| DP00118 | P05059 | Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) Cleaved into: Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor | Bos taurus (Bovine) | 1 | 449 | 423 | 444 | 22 | DQELESLSAIEAELEKVAHQLE | 78.46 |
| DP00119 | P10163 | Basic salivary proline-rich protein 4 (Salivary proline-rich protein Po) (Parotid o protein) (Salivary proline-rich protein II-1) Cleaved into: Protein N1; Glycosylated protein A; Peptide P-D (Proline-rich peptide IB-5) | Homo sapiens (Human) | 17 | 310 | 24 | 34 | 11 | SQEESLFLISG | 85.74 |
| DP00120 | P12957 | Caldesmon (CDM) | Gallus gallus (Chicken) | 636 | 771 | 636 | 647 | 12 | RLEQYTSAVVGN | 78.15 |
| DP00120 | P12957 | Caldesmon (CDM) | Gallus gallus (Chicken) | 636 | 771 | 700 | 710 | 11 | VSSRINEWLTK | 82.73 |
| DP00120 | P12957 | Caldesmon (CDM) | Gallus gallus (Chicken) | 636 | 771 | 733 | 744 | 12 | KRNLWEKQSVEK | 75.92 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 1 | 135 | 16 | 22 | 7 | SASLTEA | 77.26 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 1 | 135 | 63 | 69 | 7 | SQGTYSD | 90.64 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 1 | 135 | 71 | 108 | 38 | KENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKG | 79.04 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 136 | 297 | 146 | 156 | 11 | TAALEEDLLTA | 77.68 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 136 | 297 | 226 | 256 | 31 | FAQTFGTNLEDIKQITEPSITVPSIGLSAEP | 78.03 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 136 | 297 | 262 | 270 | 9 | QKDWFIEMP | 81.46 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 298 | 467 | 318 | 325 | 8 | HGGSFTLP | 77.01 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 298 | 467 | 337 | 349 | 13 | GSQPFAPVFFQSD | 78.42 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 298 | 467 | 386 | 410 | 25 | SEATTVLGDVHSPAVEGFVGENISG | 76.84 |
| DP00122 | P15146 | Microtubule-associated protein 2 (MAP-2) | Rattus norvegicus (Rat) | 298 | 467 | 441 | 454 | 14 | KLEETSKVSIEETV | 75.97 |
| DP00123 | P01730 | T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4) | Homo sapiens (Human) | 398 | 458 | 398 | 421 | 24 | ALIVLGGVAGLLLFIGLGIFFCVR | 83.4 |
| DP00125 | P63292 | Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH) | Bos taurus (Bovine) | 30 | 60 | 31 | 41 | 11 | YADAIFTNSYR | 81.06 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 403 | 414 | 12 | GYKTFEEIQKEE | 89.05 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 425 | 436 | 12 | AVDEIKQEIKFT | 80.16 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 439 | 448 | 10 | SSVASTRNTL | 74.25 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 457 | 463 | 7 | AGMNTLG | 73.91 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 470 | 480 | 11 | EQLNNVEGNLD | 74.58 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 499 | 513 | 15 | LNRSILAVHVSNPFN | 74.72 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 540 | 568 | 29 | SQQLSQSTQRIEGAMNANNNISEVRERYQ | 77.33 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 570 | 585 | 16 | KNVLEKAKRYQFENDE | 74.46 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 590 | 608 | 19 | MELEIDRNLDQIQQVSNRL | 81.83 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 610 | 616 | 7 | KMALTTG | 75.54 |
| DP00128 | P40357 | Protein transport protein SEC9 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 401 | 651 | 625 | 645 | 21 | RLNNIEESTDDLDINLHMNTN | 76.25 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 9 | 21 | 13 | ARVALLLLLVLGS | 80.27 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 40 | 67 | 28 | VDRVINVNAKNYKNVFKKYEVLALLYHE | 80.84 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 81 | 106 | 26 | MEELILELAAQVLEDKGVGFGLVDSE | 80.06 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 114 | 160 | 47 | KLGLTEEDSIYVFKEDEVIEYDGEFSADTLVEFLLDVLEDPVELIEG | 82.04 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 163 | 209 | 47 | ELQAFENIEDEIKLIGYFKNKDSEHYKAFKEAAEEFHPYIPFFATFD | 83.35 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 216 | 237 | 22 | LTLKLNEIDFYEAFMEEPVTIP | 83.9 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 242 | 253 | 12 | SEEEIVNFVEEH | 84.36 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 266 | 272 | 7 | MYETWED | 82.61 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 275 | 286 | 12 | DGIHIVAFAEEA | 83.86 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 289 | 317 | 29 | DGYEFLEILKSVAQDNTDNPDLSIIWIDP | 78.06 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 322 | 355 | 34 | LLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEM | 76.8 |
| DP00132 | P07221 | Calsequestrin-1 (Aspartactin) (Calsequestrin; skeletal muscle isoform) (Laminin-binding protein) | Oryctolagus cuniculus (Rabbit) | 1 | 395 | 364 | 383 | 20 | AEELEDWLEDVLEGEINTED | 80.27 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 300 | 12 | 18 | 7 | GLECIRA | 79.93 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 300 | 25 | 41 | 17 | GSLAIEEAMAAWSEISD | 76.84 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 300 | 64 | 72 | 9 | CLSAIGSTE | 81.94 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 300 | 99 | 115 | 17 | NLQASSTGLQCYYVYDH | 85.58 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 300 | 125 | 131 | 7 | DADSIMV | 79.84 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 300 | 161 | 167 | 7 | EGYAITD | 83.18 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 300 | 235 | 253 | 19 | RLASFGTEIASLLTGGATQ | 77.28 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 300 | 278 | 287 | 10 | NAALIQEWTP | 81.34 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 230 | 12 | 18 | 7 | GLECIRA | 79.93 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 230 | 25 | 41 | 17 | GSLAIEEAMAAWSEISD | 76.84 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 230 | 64 | 72 | 9 | CLSAIGSTE | 81.94 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 230 | 99 | 115 | 17 | NLQASSTGLQCYYVYDH | 85.58 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 230 | 125 | 131 | 7 | DADSIMV | 79.84 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 230 | 161 | 167 | 7 | EGYAITD | 83.18 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 229 | 12 | 18 | 7 | GLECIRA | 79.93 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 229 | 25 | 41 | 17 | GSLAIEEAMAAWSEISD | 76.84 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 229 | 64 | 72 | 9 | CLSAIGSTE | 81.94 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 229 | 99 | 115 | 17 | NLQASSTGLQCYYVYDH | 85.58 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 229 | 125 | 131 | 7 | DADSIMV | 79.84 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 229 | 161 | 167 | 7 | EGYAITD | 83.18 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 50 | 12 | 18 | 7 | GLECIRA | 79.93 |
| DP00133 | P03422 | Phosphoprotein (Protein P) | Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus) | 1 | 50 | 25 | 41 | 17 | GSLAIEEAMAAWSEISD | 76.84 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 281 | 422 | 282 | 288 | 7 | AEDVIQV | 79.93 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 281 | 422 | 300 | 309 | 10 | NGKLIQEIVD | 91.84 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 281 | 422 | 314 | 325 | 12 | VRVRIEAENEKN | 75.5 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 281 | 422 | 356 | 366 | 11 | LDIKENSTHFS | 75.13 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 281 | 422 | 376 | 388 | 13 | VLVASSVVAGESQ | 85.62 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 281 | 422 | 397 | 417 | 21 | GMVPFVFVGTKDSIANATVLL | 82.18 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 444 | 632 | 457 | 465 | 9 | KEKSYVTDD | 77.26 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 444 | 632 | 493 | 504 | 12 | NSEASNASETES | 73.91 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 444 | 632 | 507 | 516 | 10 | RDELSDWSLA | 77.39 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 444 | 632 | 577 | 587 | 11 | SLQIRVDCNNE | 76.25 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 444 | 632 | 594 | 600 | 7 | TLQNTSS | 80.7 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 445 | 632 | 457 | 465 | 9 | KEKSYVTDD | 77.26 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 445 | 632 | 493 | 504 | 12 | NSEASNASETES | 73.91 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 445 | 632 | 507 | 516 | 10 | RDELSDWSLA | 77.39 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 445 | 632 | 577 | 587 | 11 | SLQIRVDCNNE | 76.25 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 445 | 632 | 594 | 600 | 7 | TLQNTSS | 80.7 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 516 | 632 | 577 | 587 | 11 | SLQIRVDCNNE | 76.25 |
| DP00134 | Q06787 | Synaptic functional regulator FMR1 (Fragile X mental retardation protein 1) (FMRP) (Protein FMR-1) | Homo sapiens (Human) | 516 | 632 | 594 | 600 | 7 | TLQNTSS | 80.7 |
| DP00135 | P10961 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 167 | 3 | 16 | 14 | NAANTGTTNESNVS | 75.44 |
| DP00135 | P10961 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 167 | 31 | 45 | 15 | DIEKILQPNDIFTTD | 84.3 |
| DP00135 | P10961 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 167 | 48 | 62 | 15 | DASTTSSTAIEDIIN | 80.18 |
| DP00135 | P10961 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 167 | 76 | 83 | 8 | SSSFFHDS | 77.93 |
| DP00135 | P10961 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 167 | 98 | 108 | 11 | PLGIYQTNLYG | 87.23 |
| DP00135 | P10961 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 167 | 119 | 127 | 9 | STLLSSKLL | 75.92 |
| DP00135 | P10961 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 167 | 142 | 148 | 7 | QHAVYRA | 79.79 |
| DP00135 | P10961 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 260 | 332 | 268 | 274 | 7 | LLEKIIR | 80.98 |
| DP00135 | P10961 | Heat shock transcription factor (HSTF) (Heat shock factor protein) (HSF) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 260 | 332 | 304 | 327 | 24 | GSNNSNNNISSSNSFFNNGHLLQG | 78.62 |
| DP00136 | P15865 | Histone H1.4 (H1d) | Rattus norvegicus (Rat) | 31 | 119 | 40 | 52 | 13 | VSELITKAVAASK | 76.33 |
| DP00136 | P15865 | Histone H1.4 (H1d) | Rattus norvegicus (Rat) | 31 | 119 | 56 | 63 | 8 | GVSLAALK | 73.91 |
| DP00136 | P15865 | Histone H1.4 (H1d) | Rattus norvegicus (Rat) | 31 | 119 | 67 | 81 | 15 | AAAGYDVEKNNSRIK | 75.52 |
| DP00138 | P12272 | Parathyroid hormone-related protein (PTH-rP) (PTHrP) (Parathyroid hormone-like protein) (PLP) Cleaved into: PTHrP1-36; PTHrP38-94; Osteostatin (PTHrP107-139) | Homo sapiens (Human) | 68 | 144 | 68 | 76 | 9 | HTAEIRATS | 77.26 |
| DP00138 | P12272 | Parathyroid hormone-related protein (PTH-rP) (PTHrP) (Parathyroid hormone-like protein) (PLP) Cleaved into: PTHrP1-36; PTHrP38-94; Osteostatin (PTHrP107-139) | Homo sapiens (Human) | 68 | 144 | 99 | 115 | 17 | DEGRYLTQETNKVETYK | 79.26 |
| DP00140 | P0A7L8 | 50S ribosomal protein L27 (Large ribosomal subunit protein bL27) | Escherichia coli (strain K12) | 1 | 85 | 28 | 38 | 11 | GESVLAGSIIV | 87.44 |
| DP00140 | P0A7L8 | 50S ribosomal protein L27 (Large ribosomal subunit protein bL27) | Escherichia coli (strain K12) | 1 | 85 | 56 | 63 | 8 | DHTLFAKA | 75.92 |
| DP00140 | P0A7L8 | 50S ribosomal protein L27 (Large ribosomal subunit protein bL27) | Escherichia coli (strain K12) | 1 | 85 | 65 | 71 | 7 | GKVKFEV | 80.27 |
| DP00141 | O95405 | Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation) | Homo sapiens (Human) | 663 | 751 | 676 | 682 | 7 | GQFGISA | 82.7 |
| DP00141 | O95405 | Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation) | Homo sapiens (Human) | 663 | 751 | 710 | 716 | 7 | ARFTFTK | 88.96 |
| DP00141 | O95405 | Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation) | Homo sapiens (Human) | 663 | 751 | 737 | 743 | 7 | CKLLYMD | 77.16 |
| DP00145 | P0A7S3 | 30S ribosomal protein S12 (Small ribosomal subunit protein uS12) | Escherichia coli (strain K12) | 1 | 27 | 2 | 8 | 7 | ATVNQLV | 79.93 |
| DP00146 | P0A7T7 | 30S ribosomal protein S18 (Small ribosomal subunit protein bS18) | Escherichia coli (strain K12) | 1 | 75 | 9 | 15 | 7 | KFCRFTA | 80.6 |
| DP00146 | P0A7T7 | 30S ribosomal protein S18 (Small ribosomal subunit protein bS18) | Escherichia coli (strain K12) | 1 | 75 | 17 | 45 | 29 | GVQEIDYKDIATLKNYITESGKIVPSRIT | 77.6 |
| DP00146 | P0A7T7 | 30S ribosomal protein S18 (Small ribosomal subunit protein bS18) | Escherichia coli (strain K12) | 1 | 75 | 55 | 70 | 16 | LARAIKRARYLSLLPY | 78.49 |
| DP00148 | P03347 | Gag polyprotein (Pr55Gag) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Spacer peptide 2 (SP2) (p1); p6-gag | Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1) | 378 | 432 | 389 | 396 | 8 | MVKCFNCG | 75.92 |
| DP00151 | P02547 | Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein) | Sus scrofa (Pig) | 444 | 549 | 448 | 460 | 13 | QEEQIEVEETIEA | 82.97 |
| DP00151 | P02547 | Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein) | Sus scrofa (Pig) | 444 | 549 | 497 | 512 | 16 | AQEEEEAAEKEESEEA | 74.25 |
| DP00152 | Q13426 | DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4) | Homo sapiens (Human) | 178 | 202 | 178 | 187 | 10 | KRFILVLNEK | 76.56 |
| DP00152 | Q13426 | DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4) | Homo sapiens (Human) | 203 | 265 | 213 | 221 | 9 | GETAICSEM | 77.59 |
| DP00152 | Q13426 | DNA repair protein XRCC4 (X-ray repair cross-complementing protein 4) | Homo sapiens (Human) | 203 | 265 | 254 | 260 | 7 | DDSIISS | 93.65 |
| DP00154 | P29353 | SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1) | Homo sapiens (Human) | 127 | 151 | 130 | 144 | 15 | GGEEWTRHGSFVNKP | 75.25 |
| DP00154 | P29353 | SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1) | Homo sapiens (Human) | 127 | 149 | 130 | 144 | 15 | GGEEWTRHGSFVNKP | 75.25 |
| DP00156 | P54725 | UV excision repair protein RAD23 homolog A (HR23A) (hHR23A) | Homo sapiens (Human) | 283 | 316 | 290 | 296 | 7 | ELADISD | 73.91 |
| DP00156 | P54725 | UV excision repair protein RAD23 homolog A (HR23A) (hHR23A) | Homo sapiens (Human) | 283 | 316 | 300 | 311 | 12 | EVGAIGEEAPQM | 79.85 |
| DP00157 | P0CL52 | Cell invasion protein SipA (Effector protein SipA) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 425 | 512 | 462 | 470 | 9 | QTAEIVNVK | 75.96 |
| DP00157 | P0CL52 | Cell invasion protein SipA (Effector protein SipA) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 425 | 512 | 490 | 497 | 8 | DTTVITGN | 81.9 |
| DP00157 | P0CL52 | Cell invasion protein SipA (Effector protein SipA) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 446 | 512 | 462 | 470 | 9 | QTAEIVNVK | 75.96 |
| DP00157 | P0CL52 | Cell invasion protein SipA (Effector protein SipA) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 446 | 512 | 490 | 497 | 8 | DTTVITGN | 81.9 |
| DP00157 | P0CL52 | Cell invasion protein SipA (Effector protein SipA) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 658 | 684 | 658 | 666 | 9 | AGPAYESYL | 83.61 |
| DP00157 | P0CL52 | Cell invasion protein SipA (Effector protein SipA) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 658 | 684 | 671 | 679 | 9 | VDRVITTVD | 76.44 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 732 | 884 | 751 | 759 | 9 | RDNVYYYDE | 96.84 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 732 | 884 | 765 | 773 | 9 | EDQDFDLSQ | 73.58 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 732 | 884 | 808 | 818 | 11 | EIGNFIDENLK | 80.36 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 732 | 884 | 829 | 839 | 11 | YDSLLVFDYEG | 85.01 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 732 | 884 | 844 | 854 | 11 | AASLSSLNSSE | 76.53 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 732 | 884 | 857 | 872 | 16 | QDQDYDYLNEWGNRFK | 79.54 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 736 | 884 | 751 | 759 | 9 | RDNVYYYDE | 96.84 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 736 | 884 | 765 | 773 | 9 | EDQDFDLSQ | 73.58 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 736 | 884 | 808 | 818 | 11 | EIGNFIDENLK | 80.36 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 736 | 884 | 829 | 839 | 11 | YDSLLVFDYEG | 85.01 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 736 | 884 | 844 | 854 | 11 | AASLSSLNSSE | 76.53 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 736 | 884 | 857 | 872 | 16 | QDQDYDYLNEWGNRFK | 79.54 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 778 | 884 | 808 | 818 | 11 | EIGNFIDENLK | 80.36 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 778 | 884 | 829 | 839 | 11 | YDSLLVFDYEG | 85.01 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 778 | 884 | 844 | 854 | 11 | AASLSSLNSSE | 76.53 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 778 | 884 | 857 | 872 | 16 | QDQDYDYLNEWGNRFK | 79.54 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 784 | 852 | 808 | 818 | 11 | EIGNFIDENLK | 80.36 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 784 | 852 | 829 | 839 | 11 | YDSLLVFDYEG | 85.01 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 812 | 884 | 829 | 839 | 11 | YDSLLVFDYEG | 85.01 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 812 | 884 | 844 | 854 | 11 | AASLSSLNSSE | 76.53 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 812 | 884 | 857 | 872 | 16 | QDQDYDYLNEWGNRFK | 79.54 |
| DP00159 | P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3 | Mus musculus (Mouse) | 855 | 881 | 857 | 872 | 16 | QDQDYDYLNEWGNRFK | 79.54 |
| DP00162 | O75324 | Stannin (AG8_1) | Homo sapiens (Human) | 34 | 59 | 37 | 43 | 7 | RLQRISQ | 76.49 |
| DP00163 | Q03768 | Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 265 | 8 | 30 | 23 | KQELEVLESIYPDELRIINDEYP | 88.12 |
| DP00163 | Q03768 | Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 265 | 34 | 68 | 35 | FEVAIKLELDTGDSTSVLTKEHTIIAEFKLPENYP | 79.03 |
| DP00163 | Q03768 | Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 265 | 70 | 89 | 20 | EPCLISLEAQEVALNDNEED | 79.08 |
| DP00163 | Q03768 | Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 265 | 106 | 153 | 48 | VLKKFENLPDLISFKGYLPELTVQLESQIETDMLLGMQMCFALISSIK | 78.76 |
| DP00163 | Q03768 | Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 265 | 156 | 175 | 20 | CEQWYSEQLNKLEKQYELEA | 84.88 |
| DP00163 | Q03768 | Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 265 | 192 | 210 | 19 | TRESYLEWRSKFRQELKLD | 76.18 |
| DP00163 | Q03768 | Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 265 | 227 | 233 | 7 | GKQMFEQ | 75.25 |
| DP00163 | Q03768 | Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 265 | 238 | 244 | 7 | TGDEYME | 75.54 |
| DP00164 | P05318 | 60S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 106 | 3 | 34 | 32 | TESALSYAALILADSEIEISSEKLLTLTNAAN | 80.47 |
| DP00164 | P05318 | 60S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 106 | 36 | 48 | 13 | PVENIWADIFAKA | 85.75 |
| DP00164 | P05318 | 60S acidic ribosomal protein P1-alpha (A1) (L12eIIA) (Large ribosomal subunit protein P1-A) (P1A) (YP1alpha) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 106 | 55 | 65 | 11 | KDLLVNFSAGA | 80.81 |
| DP00166 | P19429 | Troponin I; cardiac muscle (Cardiac troponin I) | Homo sapiens (Human) | 163 | 210 | 191 | 200 | 10 | WRKNIDALSG | 75.25 |
| DP00168 | Q9NVS9 | "Pyridoxine-5-phosphate oxidase (EC 1.4.3.5) (Pyridoxamine-phosphate oxidase)" | Homo sapiens (Human) | 1 | 48 | 1 | 13 | 13 | MTCWLRGVTATFG | 78.34 |
| DP00173 | O00273 | DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD) | Homo sapiens (Human) | 1 | 116 | 33 | 41 | 9 | GVAASCLED | 73.8 |
| DP00173 | O00273 | DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD) | Homo sapiens (Human) | 1 | 116 | 45 | 70 | 26 | KACDILAIDKSLTPVTLVLAEDGTIV | 83.88 |
| DP00173 | O00273 | DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD) | Homo sapiens (Human) | 1 | 116 | 72 | 100 | 29 | DDDYFLCLPSNTKFVALASNEKWAYNNSD | 81.49 |
| DP00173 | O00273 | DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD) | Homo sapiens (Human) | 1 | 116 | 102 | 111 | 10 | GTAWISQESF | 87.06 |
| DP00174 | P16949 | Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17) | Homo sapiens (Human) | 1 | 149 | 16 | 26 | 11 | SGQAFELILSP | 82.55 |
| DP00174 | P16949 | Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17) | Homo sapiens (Human) | 1 | 149 | 44 | 51 | 8 | DLSLEEIQ | 84.03 |
| DP00174 | P16949 | Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17) | Homo sapiens (Human) | 1 | 149 | 66 | 75 | 10 | AEVLKQLAEK | 76.25 |
| DP00174 | P16949 | Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17) | Homo sapiens (Human) | 1 | 149 | 83 | 102 | 20 | LQKAIEENNNFSKMAEEKLT | 76.87 |
| DP00174 | P16949 | Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17) | Homo sapiens (Human) | 1 | 149 | 126 | 133 | 8 | KDKHIEEV | 75.25 |
| DP00175 | Q9NQB0 | Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) | Homo sapiens (Human) | 1 | 130 | 15 | 23 | 9 | NDELISFKD | 81.23 |
| DP00175 | Q9NQB0 | Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) | Homo sapiens (Human) | 1 | 130 | 42 | 60 | 19 | ADVKSSLVNESETNQNSSS | 78.52 |
| DP00175 | Q9NQB0 | Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) | Homo sapiens (Human) | 1 | 130 | 102 | 109 | 8 | GYPFIMIP | 77.42 |
| DP00175 | Q9NQB0 | Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) | Homo sapiens (Human) | 1 | 56 | 15 | 23 | 9 | NDELISFKD | 81.23 |
| DP00175 | Q9NQB0 | Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) | Homo sapiens (Human) | 1 | 56 | 42 | 51 | 10 | ADVKSSLVNE | 80.8 |
| DP00175 | Q9NQB0 | Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) | Homo sapiens (Human) | 1 | 53 | 15 | 23 | 9 | NDELISFKD | 81.23 |
| DP00175 | Q9NQB0 | Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) | Homo sapiens (Human) | 1 | 53 | 42 | 48 | 7 | ADVKSSL | 81.22 |
| DP00179 | P01094 | Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 68 | 7 | 16 | 10 | KVSEIFQSSK | 88.46 |
| DP00179 | P01094 | Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 68 | 49 | 61 | 13 | EKHNYQEQYNKLK | 86.36 |
| DP00179 | P01094 | Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 2 | 34 | 7 | 16 | 10 | KVSEIFQSSK | 88.46 |
| DP00179 | P01094 | Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 2 | 32 | 7 | 16 | 10 | KVSEIFQSSK | 88.46 |
| DP00179 | P01094 | Protease A inhibitor 3 (Proteinase inhibitor I(A)3) (Proteinase yscA-inhibitor) (Saccharopepsin inhibitor) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 33 | 68 | 49 | 61 | 13 | EKHNYQEQYNKLK | 86.36 |
| DP00180 | P19972 | Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain) | Millerozyma farinosa (Yeast) (Pichia farinosa) | 146 | 222 | 146 | 154 | 9 | GEATTIWGV | 79 |
| DP00180 | P19972 | Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain) | Millerozyma farinosa (Yeast) (Pichia farinosa) | 146 | 222 | 169 | 180 | 12 | DLQNMSADLAKN | 75.25 |
| DP00180 | P19972 | Salt-mediated killer protoxin 1 Cleaved into: Salt-mediated killer toxin 1 alpha chain (SMK toxin alpha chain); Salt-mediated killer toxin 1 gamma chain (SMK toxin gamma chain); Salt-mediated killer toxin 1 beta chain (SMK toxin beta chain) | Millerozyma farinosa (Yeast) (Pichia farinosa) | 146 | 222 | 198 | 209 | 12 | KDVYMIKFSLAG | 83.97 |
| DP00181 | P08775 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit) | Mus musculus (Mouse) | 1529 | 1959 | 1542 | 1550 | 9 | GAAGFSPSA | 77.26 |
| DP00184 | P11473 | Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) | Homo sapiens (Human) | 16 | 125 | 32 | 40 | 9 | TGFHFNAMT | 78.82 |
| DP00184 | P11473 | Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) | Homo sapiens (Human) | 16 | 125 | 54 | 69 | 16 | RKALFTCPFNGDCRIT | 78.2 |
| DP00184 | P11473 | Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) | Homo sapiens (Human) | 16 | 125 | 83 | 97 | 15 | RCVDIGMMKEFILTD | 78.82 |
| DP00184 | P11473 | Vitamin D3 receptor (VDR) (1;25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1) | Homo sapiens (Human) | 120 | 164 | 127 | 152 | 26 | EQQRIIAILLDAHHKTYDPTYSDFCQ | 79.39 |
| DP00186 | Q95V77 | Late embryogenesis abundant protein 1 (Aavlea1) | Aphelenchus avenae (Mycophagous nematode worm) | 1 | 143 | 3 | 10 | 8 | SQQNQNRQ | 79.93 |
| DP00186 | Q95V77 | Late embryogenesis abundant protein 1 (Aavlea1) | Aphelenchus avenae (Mycophagous nematode worm) | 1 | 143 | 14 | 20 | 7 | QEQGYME | 80.6 |
| DP00186 | Q95V77 | Late embryogenesis abundant protein 1 (Aavlea1) | Aphelenchus avenae (Mycophagous nematode worm) | 1 | 143 | 26 | 33 | 8 | VVNAWEST | 80.56 |
| DP00186 | Q95V77 | Late embryogenesis abundant protein 1 (Aavlea1) | Aphelenchus avenae (Mycophagous nematode worm) | 1 | 143 | 36 | 53 | 18 | TLSSTAQAAAEKTAEFRD | 74.93 |
| DP00186 | Q95V77 | Late embryogenesis abundant protein 1 (Aavlea1) | Aphelenchus avenae (Mycophagous nematode worm) | 1 | 143 | 69 | 76 | 8 | KGQEFKER | 77.26 |
| DP00186 | Q95V77 | Late embryogenesis abundant protein 1 (Aavlea1) | Aphelenchus avenae (Mycophagous nematode worm) | 1 | 143 | 109 | 115 | 7 | KMEEYKQ | 79.93 |
| DP00187 | P04273 | Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230) | Mesocricetus auratus (Golden hamster) | 23 | 106 | 29 | 39 | 11 | GGWNTGGSRYP | 80.94 |
| DP00187 | P04273 | Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230) | Mesocricetus auratus (Golden hamster) | 23 | 106 | 95 | 101 | 7 | THNQWNK | 74.25 |
| DP00187 | P04273 | Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230) | Mesocricetus auratus (Golden hamster) | 90 | 126 | 95 | 101 | 7 | THNQWNK | 74.25 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 88 | 103 | 16 | KRLTYDEIQSKTYLEV | 77.42 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 125 | 138 | 14 | KPGKYTAKKFCLEP | 77.45 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 144 | 150 | 7 | KAEGISK | 75.92 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 155 | 161 | 7 | DFQNTKL | 79.93 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 163 | 174 | 12 | TRLTYTLDEIEG | 77.15 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 176 | 187 | 12 | FEVSSDGTVKFE | 80.77 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 194 | 200 | 7 | YAAVTVQ | 75.54 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 207 | 220 | 14 | VPFLFTIKQLVASG | 86.5 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 253 | 259 | 7 | NAVALPA | 79.93 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 274 | 290 | 17 | KNVASSKGTITLSVTSS | 76.73 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 294 | 306 | 13 | TGEVIGVFQSLQP | 80.7 |
| DP00188 | P12359 | Oxygen-evolving enhancer protein 1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (OEC 33 kDa subunit) | Spinacia oleracea (Spinach) | 85 | 332 | 317 | 327 | 11 | KDVKIEGVWYA | 85.25 |
| DP00190 | P38038 | Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) | Escherichia coli (strain K12) | 52 | 224 | 62 | 74 | 13 | PGITIISASQTGN | 78.83 |
| DP00190 | P38038 | Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) | Escherichia coli (strain K12) | 52 | 224 | 87 | 118 | 32 | LAAKLNVKLVNAGDYKFKQIASEKLLIVVTST | 78.07 |
| DP00190 | P38038 | Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) | Escherichia coli (strain K12) | 52 | 224 | 130 | 138 | 9 | ALHKFLFSK | 80.16 |
| DP00190 | P38038 | Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) | Escherichia coli (strain K12) | 52 | 224 | 142 | 165 | 24 | KLENTAFAVFSLGDSSYEFFCQSG | 79.7 |
| DP00190 | P38038 | Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) | Escherichia coli (strain K12) | 52 | 224 | 168 | 176 | 9 | FDSKLAELG | 74.25 |
| DP00190 | P38038 | Sulfite reductase NADPH flavoprotein alpha-component (SiR-FP) (EC 1.8.1.2) | Escherichia coli (strain K12) | 52 | 224 | 186 | 199 | 14 | ADVEYQAAASEWRA | 88.8 |
| DP00192 | P02668 | Kappa-casein Cleaved into: Casoxin-C; Casoxin-6; Casoxin-A; Casoxin-B; Casoplatelin | Bos taurus (Bovine) | 1 | 21 | 1 | 16 | 16 | MMKSFFLVVTILALTL | 79.95 |
| DP00193 | P02754 | Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) | Bos taurus (Bovine) | 1 | 178 | 2 | 22 | 21 | KCLLLALALTCGAQALIVTQT | 82 |
| DP00193 | P02754 | Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) | Bos taurus (Bovine) | 1 | 178 | 31 | 49 | 19 | VAGTWYSLAMAASDISLLD | 80.2 |
| DP00193 | P02754 | Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) | Bos taurus (Bovine) | 1 | 178 | 54 | 63 | 10 | PLRVYVEELK | 79.2 |
| DP00193 | P02754 | Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) | Bos taurus (Bovine) | 1 | 178 | 68 | 79 | 12 | GDLEILLQKWEN | 81.1 |
| DP00193 | P02754 | Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) | Bos taurus (Bovine) | 1 | 178 | 83 | 91 | 9 | AQKKIIAEK | 79.45 |
| DP00193 | P02754 | Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) | Bos taurus (Bovine) | 1 | 178 | 96 | 127 | 32 | AVFKIDALNENKVLVLDTDYKKYLLFCMENSA | 80.88 |
| DP00193 | P02754 | Beta-lactoglobulin (Beta-LG) (allergen Bos d 5) | Bos taurus (Bovine) | 1 | 178 | 162 | 173 | 12 | HIRLSFNPTQLE | 78.12 |
| DP00194 | P0AFZ3 | Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB) | Escherichia coli (strain K12) | 111 | 165 | 112 | 118 | 7 | EDTSIMN | 74.1 |
| DP00194 | P0AFZ3 | Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB) | Escherichia coli (strain K12) | 111 | 165 | 124 | 135 | 12 | ADNETVMSVIDG | 83.58 |
| DP00194 | P0AFZ3 | Stringent starvation protein B (Adapter protein SspB) (Specificity-enhancing factor SspB) | Escherichia coli (strain K12) | 118 | 165 | 124 | 135 | 12 | ADNETVMSVIDG | 83.58 |
| DP00196 | P20810 | Calpastatin (Calpain inhibitor) (Sperm BS-17 component) | Homo sapiens (Human) | 137 | 277 | 153 | 165 | 13 | MDAALDDLIDTLG | 82.69 |
| DP00196 | P20810 | Calpastatin (Calpain inhibitor) (Sperm BS-17 component) | Homo sapiens (Human) | 137 | 277 | 171 | 179 | 9 | EEENTTYTG | 76.59 |
| DP00196 | P20810 | Calpastatin (Calpain inhibitor) (Sperm BS-17 component) | Homo sapiens (Human) | 137 | 277 | 186 | 195 | 10 | MSSTYIEELG | 77.26 |
| DP00196 | P20810 | Calpastatin (Calpain inhibitor) (Sperm BS-17 component) | Homo sapiens (Human) | 137 | 277 | 232 | 242 | 11 | IDALSSDFTCG | 78.93 |
| DP00196 | P20810 | Calpastatin (Calpain inhibitor) (Sperm BS-17 component) | Homo sapiens (Human) | 137 | 277 | 257 | 271 | 15 | TEVLKAQSAGTVRSA | 75.59 |
| DP00200 | P20963 | T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) | Homo sapiens (Human) | 28 | 60 | 30 | 55 | 26 | KLCYLLDGILFIYGVILTALFLRVKF | 84.69 |
| DP00200 | P20963 | T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) | Homo sapiens (Human) | 52 | 164 | 67 | 86 | 20 | GQNQLYNELNLGRREEYDVL | 78.13 |
| DP00200 | P20963 | T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) | Homo sapiens (Human) | 52 | 164 | 107 | 115 | 9 | QEGLYNELQ | 81.57 |
| DP00200 | P20963 | T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) | Homo sapiens (Human) | 52 | 164 | 119 | 127 | 9 | MAEAYSEIG | 89.07 |
| DP00200 | P20963 | T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) | Homo sapiens (Human) | 52 | 164 | 138 | 159 | 22 | HDGLYQGLSTATKDTYDALHMQ | 80.42 |
| DP00201 | P02721 | ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) | Bos taurus (Bovine) | 33 | 108 | 39 | 51 | 13 | VQKLFVDKIREYR | 85.18 |
| DP00201 | P02721 | ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) | Bos taurus (Bovine) | 33 | 108 | 63 | 83 | 21 | AGPEYQQDLDRELFKLKQMYG | 75.16 |
| DP00201 | P02721 | ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) | Bos taurus (Bovine) | 33 | 108 | 85 | 97 | 13 | ADMNTFPNFTFED | 77.57 |
| DP00201 | P02721 | ATP synthase-coupling factor 6; mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) | Bos taurus (Bovine) | 84 | 108 | 85 | 97 | 13 | ADMNTFPNFTFED | 77.57 |
| DP00205 | Q82S91 | Metal-binding protein SmbP | Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) | 1 | 117 | 2 | 29 | 28 | KTTLIKVIAASVTALFLSMQVYASGHTA | 81.09 |
| DP00205 | Q82S91 | Metal-binding protein SmbP | Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) | 1 | 117 | 50 | 57 | 8 | TDQLLEHA | 80.27 |
| DP00205 | Q82S91 | Metal-binding protein SmbP | Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) | 1 | 117 | 102 | 110 | 9 | AQEAIEHLR | 94.31 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 528 | 535 | 8 | ALATFAMP | 93.31 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 570 | 585 | 16 | LLSRFFGALKALFSGG | 77.38 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 646 | 653 | 8 | AQQQTAET | 77.26 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 657 | 665 | 9 | RQQAEVTEK | 76.37 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 697 | 709 | 13 | LNVEEQSVQETEQ | 74.84 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 727 | 760 | 34 | QKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPA | 77.58 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 779 | 786 | 8 | EQQEENNA | 76.25 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 828 | 835 | 8 | LTVACASP | 73.91 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 840 | 849 | 10 | GKVWIRYPIV | 81.37 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 876 | 882 | 7 | VAAAIEP | 76.25 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 908 | 946 | 39 | EVVETTHPEVIAAAVTEQPQVITESDVAVAQEVAEQAEP | 77.45 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 955 | 971 | 17 | ADIEEVVETAEVVVAEP | 77.65 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 980 | 1008 | 29 | PVVAEVAAEVETVAAVEPEVTVEHNHATA | 79.17 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 498 | 1061 | 1031 | 1037 | 7 | PTFAFEG | 77.74 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 603 | 850 | 646 | 653 | 8 | AQQQTAET | 77.26 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 603 | 850 | 657 | 665 | 9 | RQQAEVTEK | 76.37 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 603 | 850 | 697 | 709 | 13 | LNVEEQSVQETEQ | 74.84 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 603 | 850 | 727 | 760 | 34 | QKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPA | 77.58 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 603 | 850 | 779 | 786 | 8 | EQQEENNA | 76.25 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 603 | 850 | 828 | 835 | 8 | LTVACASP | 73.91 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 628 | 843 | 646 | 653 | 8 | AQQQTAET | 77.26 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 628 | 843 | 657 | 665 | 9 | RQQAEVTEK | 76.37 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 628 | 843 | 697 | 709 | 13 | LNVEEQSVQETEQ | 74.84 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 628 | 843 | 727 | 760 | 34 | QKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPA | 77.58 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 628 | 843 | 779 | 786 | 8 | EQQEENNA | 76.25 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 628 | 843 | 828 | 835 | 8 | LTVACASP | 73.91 |
| DP00207 | P21513 | Ribonuclease E (RNase E) (EC 3.1.26.12) | Escherichia coli (strain K12) | 816 | 850 | 828 | 835 | 8 | LTVACASP | 73.91 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 2 | 19 | 18 | RIAVICFCLLGITCAIPV | 79.52 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 29 | 46 | 18 | EKQLYNKYPDAVATWLNP | 84.17 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 59 | 75 | 17 | NAVSSEETNDFKQETLP | 75.92 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 99 | 108 | 10 | SQDSIDSNDS | 75.92 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 142 | 149 | 8 | ATEVFTPV | 80.77 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 161 | 169 | 9 | DSVVYGLRS | 77.41 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 185 | 191 | 7 | TDEDITS | 75.92 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 198 | 206 | 9 | LNGAYKAIP | 80.04 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 222 | 229 | 8 | KDSYETSQ | 74.75 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 258 | 268 | 11 | SDVIDSQELSK | 75.25 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 1 | 314 | 296 | 309 | 14 | KHLKFRISHELDSA | 78.02 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 29 | 46 | 18 | EKQLYNKYPDAVATWLNP | 84.17 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 59 | 75 | 17 | NAVSSEETNDFKQETLP | 75.92 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 99 | 108 | 10 | SQDSIDSNDS | 75.92 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 142 | 149 | 8 | ATEVFTPV | 80.77 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 161 | 169 | 9 | DSVVYGLRS | 77.41 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 185 | 191 | 7 | TDEDITS | 75.92 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 198 | 206 | 9 | LNGAYKAIP | 80.04 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 222 | 229 | 8 | KDSYETSQ | 74.75 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 258 | 268 | 11 | SDVIDSQELSK | 75.25 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 17 | 314 | 296 | 309 | 14 | KHLKFRISHELDSA | 78.02 |
| DP00214 | P10451 | Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP-1) (Urinary stone protein) (Uropontin) | Homo sapiens (Human) | 85 | 116 | 99 | 108 | 10 | SQDSIDSNDS | 75.92 |
| DP00217 | P05221 | Nucleoplasmin | Xenopus laevis (African clawed frog) | 120 | 200 | 120 | 131 | 12 | MEEDYSWAEEED | 76.14 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 14 | 23 | 10 | LKRWIGSETD | 79.93 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 34 | 61 | 28 | TKVKFDDGAVFLAACSSGDTEEVLRLLE | 78.94 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 64 | 84 | 21 | ADINYANVDGLTALHQACIDD | 80.75 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 87 | 101 | 15 | DMVKFLVENGANINQ | 79.84 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 104 | 110 | 7 | NEGWIPL | 87.96 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 114 | 139 | 26 | ASCGYLDIAEYLISQGAHVGAVNSEG | 82.33 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 150 | 168 | 19 | AMEELLQNEVNRQGVDIEA | 77.7 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 181 | 196 | 16 | ARQWLNSGHINDVRHA | 82.69 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 212 | 235 | 24 | TEVLKLLIQARYDVNIKDYDGWTP | 83.26 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 246 | 257 | 12 | EACRILVENLCD | 78.99 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 259 | 284 | 26 | EAVNKVGQTAFDVADEDILGYLEELQ | 79.17 |
| DP00218 | Q90623 | Protein phosphatase 1 regulatory subunit 12A (130 kDa myosin-binding subunit of smooth muscle myosin phosphatase) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (PP1M subunit M110) (Protein phosphatase myosin-binding subunit) | Gallus gallus (Chicken) | 1 | 299 | 286 | 293 | 8 | KQNLLHSE | 74.92 |
| DP00219 | O60927 | E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3) | Homo sapiens (Human) | 1 | 126 | 5 | 22 | 18 | GAGLSETVTETTVTVTTE | 78.3 |
| DP00219 | O60927 | E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3) | Homo sapiens (Human) | 1 | 126 | 39 | 46 | 8 | KKVEWTSD | 80.02 |
| DP00219 | O60927 | E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3) | Homo sapiens (Human) | 1 | 126 | 59 | 65 | 7 | KCCCIYE | 86.29 |
| DP00219 | O60927 | E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3) | Homo sapiens (Human) | 1 | 126 | 69 | 76 | 8 | AFGESSTE | 76.25 |
| DP00220 | P17810 | Peripherin-2 (Retinal degeneration slow protein) | Bos taurus (Bovine) | 284 | 346 | 284 | 292 | 9 | RYLHTALEG | 75.25 |
| DP00220 | P17810 | Peripherin-2 (Retinal degeneration slow protein) | Bos taurus (Bovine) | 284 | 346 | 303 | 323 | 21 | SEGWLLEKSVPETWKAFLESV | 79.44 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 2 | 12 | 11 | SQQHTLPVTLS | 76.35 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 16 | 23 | 8 | SQELLKTV | 75.5 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 83 | 103 | 21 | QEQELQQQHWEQHEEYQKAEN | 79.31 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 149 | 156 | 8 | KEQLLELP | 79.68 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 241 | 248 | 8 | GQLELSEQ | 78.22 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 251 | 258 | 8 | GQLELSEQ | 78.22 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 281 | 288 | 8 | GQLKYLEQ | 94.31 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 333 | 339 | 7 | LEQLEEQ | 76.92 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 367 | 376 | 10 | EQQVLQLKQL | 81.57 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 487 | 493 | 7 | EAQLELP | 75.54 |
| DP00221 | P07476 | Involucrin | Homo sapiens (Human) | 1 | 585 | 563 | 569 | 7 | GEVLLPV | 80.27 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 6 | 20 | 15 | ADAQIQRETYDSNES | 80.91 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 63 | 73 | 11 | QASSFSFLNRA | 79.81 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 94 | 103 | 10 | KALNLQFKAK | 75.12 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 119 | 140 | 22 | LFTRYELYIKNILEAPVKSIEN | 79.52 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 174 | 180 | 7 | PKFTIDA | 76.25 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 185 | 192 | 8 | SDSVFSFG | 86.33 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 214 | 230 | 17 | PEFKFSGTVSSDVFKLN | 79.78 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 245 | 257 | 13 | KPFSFSSATSTTE | 74.38 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 275 | 288 | 14 | VDNNSKAEASFTFG | 83.33 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 300 | 306 | 7 | PSFVFGQ | 77.07 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 315 | 326 | 12 | KSSFTFGSTTIE | 81.13 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 329 | 338 | 10 | NDENSTSNSK | 79.93 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 350 | 358 | 9 | PSFSFSIPS | 79.78 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 383 | 390 | 8 | KPVFSFGA | 75.84 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 414 | 423 | 10 | PAFNLISNAG | 82.07 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 436 | 446 | 11 | PAFSFGISNGS | 81.7 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 472 | 484 | 13 | PAFSFGINTNTTK | 79.73 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 489 | 506 | 18 | KAPTFTFGSSALADNKED | 75.75 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 509 | 517 | 9 | KPFSFGTSQ | 76.25 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 548 | 557 | 10 | TGFKFSLPFE | 76.45 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 560 | 582 | 23 | GSQTTTNDSKEESTTEATGNESQ | 74.55 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 605 | 613 | 9 | DEVALFSQK | 81.46 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 615 | 627 | 13 | KLMTFNAETKSYD | 81.71 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 656 | 671 | 16 | GNVLLNATVVDSFKYE | 82.25 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 720 | 688 | 700 | 13 | ADGKLVTYIVKFK | 88.53 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 185 | 192 | 8 | SDSVFSFG | 86.33 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 214 | 230 | 17 | PEFKFSGTVSSDVFKLN | 79.78 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 245 | 257 | 13 | KPFSFSSATSTTE | 74.38 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 275 | 288 | 14 | VDNNSKAEASFTFG | 83.33 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 300 | 306 | 7 | PSFVFGQ | 77.07 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 315 | 326 | 12 | KSSFTFGSTTIE | 81.13 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 329 | 338 | 10 | NDENSTSNSK | 79.93 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 350 | 358 | 9 | PSFSFSIPS | 79.78 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 383 | 390 | 8 | KPVFSFGA | 75.84 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 414 | 423 | 10 | PAFNLISNAG | 82.07 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 436 | 446 | 11 | PAFSFGISNGS | 81.7 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 472 | 484 | 13 | PAFSFGINTNTTK | 79.73 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 489 | 506 | 18 | KAPTFTFGSSALADNKED | 75.75 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 527 | 509 | 517 | 9 | KPFSFGTSQ | 76.25 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 562 | 720 | 605 | 613 | 9 | DEVALFSQK | 81.46 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 562 | 720 | 615 | 627 | 13 | KLMTFNAETKSYD | 81.71 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 562 | 720 | 656 | 671 | 16 | GNVLLNATVVDSFKYE | 82.25 |
| DP00222 | P32499 | Nucleoporin NUP2 (Nuclear pore protein NUP2) (p95) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 562 | 720 | 688 | 700 | 13 | ADGKLVTYIVKFK | 88.53 |
| DP00223 | P14635 | G2/mitotic-specific cyclin-B1 | Homo sapiens (Human) | 1 | 78 | 7 | 22 | 16 | RNSKINAENKAKINMA | 80.06 |
| DP00223 | P14635 | G2/mitotic-specific cyclin-B1 | Homo sapiens (Human) | 1 | 78 | 44 | 52 | 9 | ALGDIGNKV | 75.25 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 329 | 343 | 15 | DIFATASAAAPVSSA | 86.62 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 373 | 392 | 20 | GATAWGDLLGEDSLAALSSV | 76.51 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 417 | 444 | 28 | SASASATTAVTAATTEVDLFGDAFAASP | 75.37 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 463 | 469 | 7 | VAAALDA | 75.59 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 488 | 495 | 8 | ELDLFAMK | 75.38 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 525 | 553 | 29 | AVAATAATTTAAAAATTTATTSAAAATTA | 76.48 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 558 | 569 | 12 | ALDIFGDLFDSA | 81.94 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 583 | 592 | 10 | SIDLFGTDAF | 79.63 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 604 | 614 | 11 | ESSLTADLLSG | 77.38 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 625 | 640 | 16 | HVPLFFTAVDAFAAPS | 83.55 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 652 | 671 | 20 | SSGVIDLFGDAFGSSASETQ | 79.33 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 675 | 696 | 22 | QAVSSSSASADLLAGFGGSFMA | 77.41 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 705 | 722 | 18 | AQNNLLQPNFEAAFGTTP | 78.21 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 769 | 786 | 18 | LDSSLASLVGNLGISGTT | 75.68 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 790 | 797 | 8 | GDLQWNAG | 79.56 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 896 | 803 | 809 | 7 | GGANWQP | 80.94 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 329 | 343 | 15 | DIFATASAAAPVSSA | 86.62 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 373 | 392 | 20 | GATAWGDLLGEDSLAALSSV | 76.51 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 417 | 444 | 28 | SASASATTAVTAATTEVDLFGDAFAASP | 75.37 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 463 | 469 | 7 | VAAALDA | 75.59 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 488 | 495 | 8 | ELDLFAMK | 75.38 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 525 | 553 | 29 | AVAATAATTTAAAAATTTATTSAAAATTA | 76.48 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 558 | 569 | 12 | ALDIFGDLFDSA | 81.94 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 583 | 592 | 10 | SIDLFGTDAF | 79.63 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 604 | 614 | 11 | ESSLTADLLSG | 77.38 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 625 | 640 | 16 | HVPLFFTAVDAFAAPS | 83.55 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 652 | 671 | 20 | SSGVIDLFGDAFGSSASETQ | 79.33 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 675 | 696 | 22 | QAVSSSSASADLLAGFGGSFMA | 77.41 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 328 | 745 | 705 | 722 | 18 | AQNNLLQPNFEAAFGTTP | 78.21 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 745 | 896 | 769 | 786 | 18 | LDSSLASLVGNLGISGTT | 75.68 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 745 | 896 | 790 | 797 | 8 | GDLQWNAG | 79.56 |
| DP00225 | Q05140 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) | Rattus norvegicus (Rat) | 745 | 896 | 803 | 809 | 7 | GGANWQP | 80.94 |
| DP00226 | Q9CXW3 | Calcyclin-binding protein (CacyBP) (Siah-interacting protein) | Mus musculus (Mouse) | 178 | 229 | 195 | 202 | 8 | VLKKIYED | 77.63 |
| DP00226 | Q9CXW3 | Calcyclin-binding protein (CacyBP) (Siah-interacting protein) | Mus musculus (Mouse) | 178 | 229 | 207 | 219 | 13 | MKRTINKAWVESR | 77 |
| DP00229 | P05455 | Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B) | Homo sapiens (Human) | 326 | 408 | 353 | 359 | 7 | GKVQFQG | 79.26 |
| DP00229 | P05455 | Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B) | Homo sapiens (Human) | 326 | 408 | 397 | 403 | 7 | KQQKTEN | 73.91 |
| DP00230 | Q14449 | Growth factor receptor-bound protein 14 (GRB14 adapter protein) | Homo sapiens (Human) | 361 | 435 | 361 | 367 | 7 | SSQSISP | 75.97 |
| DP00230 | Q14449 | Growth factor receptor-bound protein 14 (GRB14 adapter protein) | Homo sapiens (Human) | 361 | 435 | 375 | 382 | 8 | SLVAMDFS | 75.92 |
| DP00230 | Q14449 | Growth factor receptor-bound protein 14 (GRB14 adapter protein) | Homo sapiens (Human) | 361 | 435 | 386 | 408 | 23 | SRVIENPTEALSVAVEEGLAWRK | 77.5 |
| DP00231 | P14859 | POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) | Homo sapiens (Human) | 1 | 200 | 35 | 50 | 16 | VGGAISTAQAQAFLGH | 79.18 |
| DP00231 | P14859 | POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) | Homo sapiens (Human) | 1 | 200 | 52 | 75 | 24 | HQVQLAGTSLQAAAQSLNVQSKSN | 79.95 |
| DP00231 | P14859 | POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) | Homo sapiens (Human) | 1 | 200 | 93 | 157 | 65 | VQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASA | 78.89 |
| DP00231 | P14859 | POU domain; class 2; transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1) | Homo sapiens (Human) | 1 | 200 | 176 | 195 | 20 | LQQLQQLQQQNLNLQQFVLV | 77.76 |
| DP00233 | P14448 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Gallus gallus (Chicken) | 238 | 504 | 248 | 256 | 9 | AMSAFNNIK | 93.65 |
| DP00233 | P14448 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Gallus gallus (Chicken) | 238 | 504 | 258 | 264 | 7 | MQVVLER | 80.03 |
| DP00233 | P14448 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Gallus gallus (Chicken) | 238 | 504 | 282 | 289 | 8 | TGKLITSS | 76.13 |
| DP00233 | P14448 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Gallus gallus (Chicken) | 238 | 504 | 349 | 357 | 9 | EGSTYHFSG | 81.46 |
| DP00233 | P14448 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Gallus gallus (Chicken) | 238 | 504 | 370 | 384 | 15 | DLESFFTHDSVSTSS | 78.97 |
| DP00233 | P14448 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Gallus gallus (Chicken) | 238 | 504 | 440 | 451 | 12 | KTVLTSSSSSFN | 79.1 |
| DP00233 | P14448 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Gallus gallus (Chicken) | 238 | 504 | 453 | 461 | 9 | GGSTFETKS | 83.95 |
| DP00236 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 134 | 304 | 144 | 156 | 13 | HGSKYLATASTMD | 81.04 |
| DP00236 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 134 | 304 | 171 | 180 | 10 | ILDSIGRFFG | 76.52 |
| DP00236 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 134 | 304 | 219 | 228 | 10 | PVVHFFKNIV | 86.76 |
| DP00236 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 134 | 304 | 242 | 252 | 11 | GLSLSRFSWGA | 76.28 |
| DP00236 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 134 | 304 | 280 | 291 | 12 | AQGTLSKIFKLG | 79.68 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 100 | 108 | 9 | EYANSYNFA | 88.33 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 120 | 134 | 15 | DEVSIIQSMGYRNRA | 91.66 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 146 | 165 | 20 | SLQETSLSVQLSNLGTVRTL | 79.15 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 175 | 184 | 10 | KTSVYIELGS | 78.73 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 192 | 209 | 18 | NKATYCSVGDQELLQITP | 80.1 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 213 | 220 | 8 | RDEISLDS | 76.25 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 224 | 237 | 14 | AACEFSETDVTNTE | 76.09 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 244 | 250 | 7 | NDLNTTE | 82.61 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 257 | 271 | 15 | HPEKYQGSSVSNLHV | 75.59 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 282 | 294 | 13 | SLQHENSSLLLTK | 76.59 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 369 | 394 | 26 | DVPWITLNSSIQKVNEWFSRSDELLG | 79.57 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 410 | 435 | 26 | ADVLDVLNEVDEYSGSSEKIDLLASD | 77.73 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 437 | 445 | 9 | HEALICKSE | 91.64 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 450 | 466 | 17 | KSVESNIEDKIFGKTYR | 79.87 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 475 | 494 | 20 | SHVTENLIIGAFVTEPQIIQ | 82.31 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 544 | 552 | 9 | QVMNITNSG | 85.62 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 559 | 567 | 9 | GDSIQNEKN | 76.29 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 576 | 604 | 29 | KESAFKTKAEPISSSISNMELELNIHNSK | 77.51 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 621 | 632 | 12 | HALELVVSRNLS | 76.56 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 637 | 643 | 7 | TELQIDS | 80.27 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 646 | 656 | 11 | SSEEIKKKKYN | 75.25 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 665 | 671 | 7 | NLQLMEG | 77.26 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 711 | 725 | 15 | KCSNTSELKEFVNPS | 76.59 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 765 | 772 | 8 | ESSSISLV | 74.33 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 779 | 792 | 14 | TQESISLLEVSTLG | 79.53 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 804 | 812 | 9 | QCAAFENPK | 85.95 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 852 | 862 | 11 | LDAQYLQNTFK | 86.11 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 865 | 874 | 10 | KRQSFAPFSN | 76.45 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 880 | 889 | 10 | EECATFSAHS | 82.71 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 897 | 905 | 9 | PKVTFECEQ | 74.58 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 921 | 927 | 7 | QTVNITA | 86.96 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 948 | 959 | 12 | GGSRFCLSSQFR | 78.6 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 962 | 969 | 8 | ETGLITPN | 85.28 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 997 | 1008 | 12 | NLLEENFEEHSM | 88.29 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1015 | 1062 | 48 | GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIG | 82.01 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1064 | 1073 | 10 | SDENIQAELG | 83.78 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1109 | 1135 | 27 | KKQEYEEVVQTVNTDFSPYLISDNLEQ | 77.62 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1155 | 1181 | 27 | DDGEIKEDTSFAENDIKESSAVFSKSV | 77.37 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1198 | 1204 | 7 | LAQGYRR | 75.92 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1212 | 1220 | 9 | SEENLSSED | 75.36 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1225 | 1238 | 14 | CFQHLLFGKVNNIP | 85.98 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1245 | 1254 | 10 | STVATECLSK | 76.25 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1256 | 1267 | 12 | TEENLLSLKNSL | 75.64 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1271 | 1279 | 9 | SNQVILAKA | 94.02 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1292 | 1320 | 29 | SASLFSSQCSELEDLTANTNTQDPFLIGS | 80.15 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1326 | 1337 | 12 | HQSESQGVGLSD | 75.59 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1361 | 1371 | 11 | MDSNLGEAASG | 77.26 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1387 | 1395 | 9 | SQSDILTTQ | 78.15 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1400 | 1420 | 21 | MQHNLIKLQQEMAELEAVLEQ | 78.79 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1452 | 1466 | 15 | KAVLTSQKSSEYPIS | 77.61 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1476 | 1486 | 11 | KFEVSADSSTS | 75.55 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1505 | 1513 | 9 | DDRWYMHSC | 91.97 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1516 | 1543 | 28 | SLQNRNYPSQEELIKVVDVEEQQLEESG | 79.57 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1545 | 1554 | 10 | HDLTETSYLP | 78.33 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1564 | 1573 | 10 | LESGISLFSD | 91.3 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 100 | 1649 | 1615 | 1632 | 18 | AAAHTTDTAGYNAMEESV | 75.03 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 175 | 303 | 175 | 184 | 10 | KTSVYIELGS | 78.73 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 175 | 303 | 192 | 209 | 18 | NKATYCSVGDQELLQITP | 80.1 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 175 | 303 | 213 | 220 | 8 | RDEISLDS | 76.25 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 175 | 303 | 224 | 237 | 14 | AACEFSETDVTNTE | 76.09 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 175 | 303 | 244 | 250 | 7 | NDLNTTE | 82.61 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 175 | 303 | 257 | 271 | 15 | HPEKYQGSSVSNLHV | 75.59 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 175 | 303 | 282 | 294 | 13 | SLQHENSSLLLTK | 76.59 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 219 | 498 | 224 | 237 | 14 | AACEFSETDVTNTE | 76.09 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 219 | 498 | 244 | 250 | 7 | NDLNTTE | 82.61 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 219 | 498 | 257 | 271 | 15 | HPEKYQGSSVSNLHV | 75.59 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 219 | 498 | 282 | 294 | 13 | SLQHENSSLLLTK | 76.59 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 219 | 498 | 369 | 394 | 26 | DVPWITLNSSIQKVNEWFSRSDELLG | 79.57 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 219 | 498 | 410 | 435 | 26 | ADVLDVLNEVDEYSGSSEKIDLLASD | 77.73 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 219 | 498 | 437 | 445 | 9 | HEALICKSE | 91.64 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 219 | 498 | 450 | 466 | 17 | KSVESNIEDKIFGKTYR | 79.87 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 219 | 498 | 475 | 493 | 19 | SHVTENLIIGAFVTEPQII | 82.24 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 304 | 394 | 369 | 389 | 21 | DVPWITLNSSIQKVNEWFSRS | 80.44 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 433 | 511 | 437 | 445 | 9 | HEALICKSE | 91.64 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 433 | 511 | 450 | 466 | 17 | KSVESNIEDKIFGKTYR | 79.87 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 433 | 511 | 475 | 494 | 20 | SHVTENLIIGAFVTEPQIIQ | 82.31 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 498 | 663 | 544 | 552 | 9 | QVMNITNSG | 85.62 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 498 | 663 | 559 | 567 | 9 | GDSIQNEKN | 76.29 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 498 | 663 | 576 | 604 | 29 | KESAFKTKAEPISSSISNMELELNIHNSK | 77.51 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 498 | 663 | 621 | 632 | 12 | HALELVVSRNLS | 76.56 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 498 | 663 | 637 | 643 | 7 | TELQIDS | 80.27 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 498 | 663 | 646 | 656 | 11 | SSEEIKKKKYN | 75.25 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 765 | 772 | 8 | ESSSISLV | 74.33 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 779 | 792 | 14 | TQESISLLEVSTLG | 79.53 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 804 | 812 | 9 | QCAAFENPK | 85.95 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 852 | 862 | 11 | LDAQYLQNTFK | 86.11 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 865 | 874 | 10 | KRQSFAPFSN | 76.45 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 880 | 889 | 10 | EECATFSAHS | 82.71 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 897 | 905 | 9 | PKVTFECEQ | 74.58 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 921 | 927 | 7 | QTVNITA | 86.96 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 948 | 959 | 12 | GGSRFCLSSQFR | 78.6 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 962 | 969 | 8 | ETGLITPN | 85.28 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 997 | 1008 | 12 | NLLEENFEEHSM | 88.29 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 1015 | 1062 | 48 | GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIG | 82.01 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 740 | 1083 | 1064 | 1073 | 10 | SDENIQAELG | 83.78 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 765 | 772 | 8 | ESSSISLV | 74.33 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 779 | 792 | 14 | TQESISLLEVSTLG | 79.53 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 804 | 812 | 9 | QCAAFENPK | 85.95 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 852 | 862 | 11 | LDAQYLQNTFK | 86.11 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 865 | 874 | 10 | KRQSFAPFSN | 76.45 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 880 | 889 | 10 | EECATFSAHS | 82.71 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 897 | 905 | 9 | PKVTFECEQ | 74.58 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 921 | 927 | 7 | QTVNITA | 86.96 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 948 | 959 | 12 | GGSRFCLSSQFR | 78.6 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 962 | 969 | 8 | ETGLITPN | 85.28 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 997 | 1008 | 12 | NLLEENFEEHSM | 88.29 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 758 | 1064 | 1015 | 1059 | 45 | GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSIN | 81.66 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 936 | 1057 | 948 | 959 | 12 | GGSRFCLSSQFR | 78.6 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 936 | 1057 | 962 | 969 | 8 | ETGLITPN | 85.28 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 936 | 1057 | 997 | 1008 | 12 | NLLEENFEEHSM | 88.29 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 936 | 1057 | 1015 | 1052 | 38 | GNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTN | 81.01 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 1343 | 1440 | 1361 | 1371 | 11 | MDSNLGEAASG | 77.26 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 1343 | 1440 | 1387 | 1395 | 9 | SQSDILTTQ | 78.15 |
| DP00238 | P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | Homo sapiens (Human) | 1343 | 1440 | 1400 | 1420 | 21 | MQHNLIKLQQEMAELEAVLEQ | 78.79 |
| DP00239 | P31896 | Carbon monoxide dehydrogenase (CODH) (EC 1.2.7.4) | Rhodospirillum rubrum | 1 | 27 | 13 | 22 | 10 | ACATEMLNLA | 76.29 |
| DP00240 | P35611 | Alpha-adducin (Erythrocyte adducin subunit alpha) | Homo sapiens (Human) | 430 | 737 | 444 | 451 | 8 | KTRWLNSG | 75.25 |
| DP00240 | P35611 | Alpha-adducin (Erythrocyte adducin subunit alpha) | Homo sapiens (Human) | 430 | 737 | 485 | 495 | 11 | VPNLFVPLNTN | 79.26 |
| DP00240 | P35611 | Alpha-adducin (Erythrocyte adducin subunit alpha) | Homo sapiens (Human) | 430 | 737 | 507 | 517 | 11 | REQNLQDIKTA | 75.62 |
| DP00240 | P35611 | Alpha-adducin (Erythrocyte adducin subunit alpha) | Homo sapiens (Human) | 430 | 737 | 534 | 560 | 27 | VQGELVTASKAIIEKEYQPHVIVSTTG | 77.12 |
| DP00240 | P35611 | Alpha-adducin (Erythrocyte adducin subunit alpha) | Homo sapiens (Human) | 430 | 737 | 562 | 569 | 8 | NPFTTLTD | 75.25 |
| DP00240 | P35611 | Alpha-adducin (Erythrocyte adducin subunit alpha) | Homo sapiens (Human) | 430 | 737 | 632 | 638 | 7 | SDAATFK | 79.69 |
| DP00241 | P35612 | Beta-adducin (Erythrocyte adducin subunit beta) | Homo sapiens (Human) | 409 | 726 | 430 | 446 | 17 | KTRWLNTPNTYLRVNVA | 79.15 |
| DP00241 | P35612 | Beta-adducin (Erythrocyte adducin subunit beta) | Homo sapiens (Human) | 409 | 726 | 481 | 491 | 11 | NPNQFVPLYTD | 79.96 |
| DP00241 | P35612 | Beta-adducin (Erythrocyte adducin subunit beta) | Homo sapiens (Human) | 409 | 726 | 493 | 503 | 11 | QEVLEMRNKIR | 85.95 |
| DP00241 | P35612 | Beta-adducin (Erythrocyte adducin subunit beta) | Homo sapiens (Human) | 409 | 726 | 516 | 527 | 12 | QSQLLASVIAEK | 76.95 |
| DP00241 | P35612 | Beta-adducin (Erythrocyte adducin subunit beta) | Homo sapiens (Human) | 409 | 726 | 557 | 569 | 13 | FSQLTDQELEEYK | 77.98 |
| DP00241 | P35612 | Beta-adducin (Erythrocyte adducin subunit beta) | Homo sapiens (Human) | 409 | 726 | 657 | 664 | 8 | TAEEILSK | 83.32 |
| DP00242 | P0AG63 | 30S ribosomal protein S17 (Small ribosomal subunit protein uS17) | Escherichia coli (strain K12) | 1 | 83 | 17 | 39 | 23 | MEKSIVVAIERFVKHPIYGKFIK | 81.82 |
| DP00242 | P0AG63 | 30S ribosomal protein S17 (Small ribosomal subunit protein uS17) | Escherichia coli (strain K12) | 1 | 83 | 51 | 63 | 13 | NECGIGDVVEIRE | 81.61 |
| DP00242 | P0AG63 | 30S ribosomal protein S17 (Small ribosomal subunit protein uS17) | Escherichia coli (strain K12) | 1 | 83 | 70 | 76 | 7 | TKSWTLV | 79.31 |
| DP00242 | P0AG63 | 30S ribosomal protein S17 (Small ribosomal subunit protein uS17) | Escherichia coli (strain K12) | 4 | 83 | 17 | 39 | 23 | MEKSIVVAIERFVKHPIYGKFIK | 81.82 |
| DP00242 | P0AG63 | 30S ribosomal protein S17 (Small ribosomal subunit protein uS17) | Escherichia coli (strain K12) | 4 | 83 | 51 | 63 | 13 | NECGIGDVVEIRE | 81.61 |
| DP00242 | P0AG63 | 30S ribosomal protein S17 (Small ribosomal subunit protein uS17) | Escherichia coli (strain K12) | 4 | 83 | 70 | 76 | 7 | TKSWTLV | 79.31 |
| DP00245 | P00514 | cAMP-dependent protein kinase type I-alpha regulatory subunit Cleaved into: cAMP-dependent protein kinase type I-alpha regulatory subunit; N-terminally processed | Bos taurus (Bovine) | 91 | 112 | 95 | 107 | 13 | RRGAISAEVYTEE | 83.77 |
| DP00249 | P63315 | Troponin C; slow skeletal and cardiac muscles (TN-C) | Bos taurus (Bovine) | 103 | 161 | 108 | 130 | 23 | ADGYIDLEELKIMLQATGETITE | 87.06 |
| DP00249 | P63315 | Troponin C; slow skeletal and cardiac muscles (TN-C) | Bos taurus (Bovine) | 103 | 161 | 144 | 156 | 13 | NDGRIDYDEFLEF | 83.41 |
| DP00250 | P01555 | Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 19 | 212 | 44 | 50 | 7 | GQSEYFD | 88.87 |
| DP00250 | P01555 | Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 19 | 212 | 53 | 61 | 9 | TQMNINLYD | 95.62 |
| DP00250 | P01555 | Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 19 | 212 | 66 | 86 | 21 | TQTGFVRHDDGYVSTSISLRS | 75.71 |
| DP00250 | P01555 | Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 19 | 212 | 90 | 122 | 33 | VGQTILSGHSTYYIYVIATAPNMFNVNDVLGAY | 82.39 |
| DP00250 | P01555 | Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 19 | 212 | 135 | 160 | 26 | GGIPYSQIYGWYRVHFGVLDEQLHRN | 77.9 |
| DP00250 | P01555 | Cholera enterotoxin subunit A (Cholera enterotoxin; A chain) Cleaved into: Cholera enterotoxin subunit A1 (EC 2.4.2.-) (Cholera enterotoxin A1 chain) (Cholera enterotoxin alpha chain) (NAD(+)--diphthamide ADP-ribosyltransferase); Cholera enterotoxin subunit A2 (Cholera enterotoxin A2 chain) (Cholera enterotoxin gamma chain) | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 19 | 212 | 164 | 174 | 11 | RDRYYSNLDIA | 76.38 |
| DP00251 | O88339 | Epsin-1 (EPS-15-interacting protein 1) | Rattus norvegicus (Rat) | 144 | 575 | 155 | 166 | 12 | AQTATASSAAVG | 77.26 |
| DP00251 | O88339 | Epsin-1 (EPS-15-interacting protein 1) | Rattus norvegicus (Rat) | 144 | 575 | 173 | 179 | 7 | AEQAWPQ | 80.27 |
| DP00251 | O88339 | Epsin-1 (EPS-15-interacting protein 1) | Rattus norvegicus (Rat) | 144 | 575 | 186 | 195 | 10 | LQLQLALAMS | 76.25 |
| DP00251 | O88339 | Epsin-1 (EPS-15-interacting protein 1) | Rattus norvegicus (Rat) | 144 | 575 | 211 | 221 | 11 | VQLQLALSLSR | 77.32 |
| DP00251 | O88339 | Epsin-1 (EPS-15-interacting protein 1) | Rattus norvegicus (Rat) | 144 | 575 | 238 | 246 | 9 | LQMAIEESK | 87.63 |
| DP00251 | O88339 | Epsin-1 (EPS-15-interacting protein 1) | Rattus norvegicus (Rat) | 144 | 575 | 260 | 267 | 8 | LADVFTTP | 76.88 |
| DP00251 | O88339 | Epsin-1 (EPS-15-interacting protein 1) | Rattus norvegicus (Rat) | 144 | 575 | 421 | 428 | 8 | GELELLAG | 79.43 |
| DP00251 | O88339 | Epsin-1 (EPS-15-interacting protein 1) | Rattus norvegicus (Rat) | 144 | 575 | 525 | 535 | 11 | ATLTLNQLRLS | 80.27 |
| DP00252 | P0A877 | Tryptophan synthase alpha chain (EC 4.2.1.20) | Escherichia coli (strain K12) | 54 | 74 | 63 | 69 | 7 | TIQNATL | 81.08 |
| DP00253 | P26645 | Myristoylated alanine-rich C-kinase substrate (MARCKS) | Mus musculus (Mouse) | 1 | 309 | 1 | 9 | 9 | MGAQFSKTA | 78.6 |
| DP00253 | P26645 | Myristoylated alanine-rich C-kinase substrate (MARCKS) | Mus musculus (Mouse) | 1 | 309 | 88 | 94 | 7 | AAAATEP | 76.92 |
| DP00253 | P26645 | Myristoylated alanine-rich C-kinase substrate (MARCKS) | Mus musculus (Mouse) | 1 | 309 | 118 | 128 | 11 | AEGASASSTSS | 76.71 |
| DP00253 | P26645 | Myristoylated alanine-rich C-kinase substrate (MARCKS) | Mus musculus (Mouse) | 1 | 309 | 158 | 166 | 9 | KLSGFSFKK | 79.12 |
| DP00256 | P40316 | Securin | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 110 | 8 | 24 | 17 | KENNIVYTGNESSGINF | 88.53 |
| DP00256 | P40316 | Securin | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 110 | 51 | 65 | 15 | RDANSNNGNTLKYIQ | 81.54 |
| DP00256 | P40316 | Securin | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 110 | 96 | 104 | 9 | SKSFIFPET | 87.7 |
| DP00260 | P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | Homo sapiens (Human) | 1 | 167 | 3 | 41 | 39 | LNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQ | 83.83 |
| DP00260 | P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | Homo sapiens (Human) | 1 | 167 | 89 | 107 | 19 | GGGSFSTADQLEMVTELLG | 77.59 |
| DP00260 | P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | Homo sapiens (Human) | 1 | 167 | 120 | 154 | 35 | DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQA | 78.4 |
| DP00260 | P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | Homo sapiens (Human) | 1 | 143 | 3 | 41 | 39 | LNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQ | 83.83 |
| DP00260 | P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | Homo sapiens (Human) | 1 | 143 | 89 | 107 | 19 | GGGSFSTADQLEMVTELLG | 77.59 |
| DP00260 | P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | Homo sapiens (Human) | 1 | 143 | 120 | 138 | 19 | DDETFIKNIIIQDCMWSGF | 79.65 |
| DP00260 | P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | Homo sapiens (Human) | 1 | 88 | 3 | 41 | 39 | LNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQ | 83.83 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 403 | 603 | 404 | 437 | 34 | AGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLP | 78.82 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 403 | 603 | 442 | 451 | 10 | KLQNINLAMS | 79.53 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 403 | 603 | 472 | 479 | 8 | QEVALKLE | 77.26 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 403 | 603 | 484 | 491 | 8 | SLELSFTM | 80.98 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 403 | 603 | 515 | 543 | 29 | SPSEYCFYVDSDMVNEFKLELVEKLFAED | 79.23 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 403 | 603 | 571 | 582 | 12 | DFQLRSFDQLSP | 75.59 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 530 | 698 | 535 | 543 | 9 | LVEKLFAED | 80.9 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 530 | 698 | 571 | 582 | 12 | DFQLRSFDQLSP | 75.59 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 530 | 698 | 598 | 609 | 12 | TVTVFQQTQIQE | 76.81 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 530 | 698 | 611 | 627 | 17 | TANATTTTATTDELKTV | 74.11 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 530 | 698 | 633 | 642 | 10 | EDIKILIASP | 78.6 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 530 | 698 | 651 | 657 | 7 | TTSATSS | 74.25 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 530 | 698 | 673 | 682 | 10 | GKGVIEQTEK | 79.33 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 776 | 826 | 792 | 807 | 16 | LPQLTSYDCEVNAPIQ | 79.18 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 776 | 826 | 815 | 821 | 7 | GEELLRA | 73.91 |
| DP00262 | Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | Homo sapiens (Human) | 776 | 813 | 792 | 807 | 16 | LPQLTSYDCEVNAPIQ | 79.18 |
| DP00265 | P04925 | Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230) | Mus musculus (Mouse) | 23 | 120 | 29 | 39 | 11 | GGWNTGGSRYP | 80.94 |
| DP00265 | P04925 | Major prion protein (PrP) (PrP27-30) (PrP33-35C) (CD antigen CD230) | Mus musculus (Mouse) | 23 | 120 | 94 | 100 | 7 | THNQWNK | 74.25 |
| DP00269 | Q24298 | DE-cadherin (Protein shotgun) | Drosophila melanogaster (Fruit fly) | 1350 | 1507 | 1365 | 1374 | 10 | IRETIINYED | 83.31 |
| DP00269 | Q24298 | DE-cadherin (Protein shotgun) | Drosophila melanogaster (Fruit fly) | 1350 | 1507 | 1386 | 1401 | 16 | LNVLRTQPFYEEKLYK | 78.09 |
| DP00269 | Q24298 | DE-cadherin (Protein shotgun) | Drosophila melanogaster (Fruit fly) | 1350 | 1507 | 1418 | 1425 | 8 | DIADFLGD | 78.26 |
| DP00269 | Q24298 | DE-cadherin (Protein shotgun) | Drosophila melanogaster (Fruit fly) | 1350 | 1507 | 1441 | 1462 | 22 | DVRHYAYEGDGNSDGSLSSLAS | 76.39 |
| DP00269 | Q24298 | DE-cadherin (Protein shotgun) | Drosophila melanogaster (Fruit fly) | 1350 | 1507 | 1467 | 1478 | 12 | GDLNFDYLSNFG | 89.91 |
| DP00271 | P02699 | Rhodopsin | Bos taurus (Bovine) | 327 | 348 | 332 | 343 | 12 | EASTTVSKTETS | 76.25 |
| DP00278 | P08050 | Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein) | Rattus norvegicus (Rat) | 255 | 316 | 263 | 271 | 9 | PKYAYFNGC | 83.5 |
| DP00278 | P08050 | Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein) | Rattus norvegicus (Rat) | 255 | 316 | 297 | 311 | 15 | SCRNYNKQASEQNWA | 86.47 |
| DP00282 | Q04656 | Copper-transporting ATPase 1 (EC 7.2.2.8) (Copper pump 1) (Menkes disease-associated protein) | Homo sapiens (Human) | 1125 | 1176 | 1131 | 1171 | 41 | HKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISN | 79.34 |
| DP00284 | P16009 | Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C | Enterobacteria phage T4 (Bacteriophage T4) | 129 | 179 | 136 | 155 | 20 | GEVGYDSSSNVIQDSNLDTA | 82.06 |
| DP00284 | P16009 | Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C | Enterobacteria phage T4 (Bacteriophage T4) | 339 | 389 | 347 | 361 | 15 | ARSLSAMAATVAKSS | 78.04 |
| DP00284 | P16009 | Pre-baseplate central spike protein Gp5 (Pre-Gp5) (Peptidoglycan hydrolase gp5) (EC 3.2.1.17) Cleaved into: Baseplate central spike protein Gp5* (Mature Gp5); Gp5C | Enterobacteria phage T4 (Bacteriophage T4) | 339 | 389 | 370 | 384 | 15 | NDSRILFKEPVSSYK | 80.25 |
| DP00285 | P10388 | Glutenin; high molecular weight subunit DX5 | Triticum aestivum (Wheat) | 147 | 440 | 164 | 170 | 7 | GQPRYYP | 75.25 |
| DP00285 | P10388 | Glutenin; high molecular weight subunit DX5 | Triticum aestivum (Wheat) | 147 | 440 | 201 | 208 | 8 | QPGYYPTS | 77.26 |
| DP00285 | P10388 | Glutenin; high molecular weight subunit DX5 | Triticum aestivum (Wheat) | 147 | 440 | 264 | 278 | 15 | GQQLGQGQQGYYPTS | 84.97 |
| DP00285 | P10388 | Glutenin; high molecular weight subunit DX5 | Triticum aestivum (Wheat) | 147 | 440 | 286 | 308 | 23 | QPGYYPTSLQQLGQGQSGYYPTS | 78.42 |
| DP00285 | P10388 | Glutenin; high molecular weight subunit DX5 | Triticum aestivum (Wheat) | 147 | 440 | 358 | 365 | 8 | QPGYYPTS | 77.26 |
| DP00285 | P10388 | Glutenin; high molecular weight subunit DX5 | Triticum aestivum (Wheat) | 147 | 440 | 373 | 380 | 8 | QPGYYPTS | 77.26 |
| DP00285 | P10388 | Glutenin; high molecular weight subunit DX5 | Triticum aestivum (Wheat) | 147 | 440 | 418 | 425 | 8 | QPGYYPTS | 77.26 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 1 | 59 | 4 | 13 | 10 | RAENWDEAEV | 77.99 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 1 | 59 | 18 | 24 | 7 | AGVEEYG | 86.14 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 54 | 213 | 71 | 80 | 10 | PSQVIFCNRS | 77.49 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 54 | 213 | 85 | 93 | 9 | LPVWLNFDG | 88.37 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 54 | 213 | 114 | 120 | 7 | GHLWLFR | 95.37 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 54 | 213 | 125 | 140 | 16 | HDGLLVNQTELFVPSL | 86.41 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 54 | 213 | 144 | 158 | 15 | GQPIFANITLPVYTL | 83.77 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 54 | 213 | 163 | 187 | 25 | LQVVRSLVKPENYRRLDIVRSLYED | 78.93 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 67 | 117 | 71 | 80 | 10 | PSQVIFCNRS | 77.49 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 67 | 117 | 85 | 93 | 9 | LPVWLNFDG | 88.37 |
| DP00287 | P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | Homo sapiens (Human) | 153 | 184 | 163 | 179 | 17 | LQVVRSLVKPENYRRLD | 75.78 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 73 | 1 | 22 | 22 | MQSINFRTARGNLSEVLNNVEA | 79.9 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 73 | 24 | 30 | 7 | EEVEITR | 90.64 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 73 | 34 | 48 | 15 | EPAVIVSKATFEAYK | 81.74 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 73 | 52 | 64 | 13 | LDAEFASLFDTLD | 89.89 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 58 | 1 | 22 | 22 | MQSINFRTARGNLSEVLNNVEA | 79.9 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 58 | 24 | 30 | 7 | EEVEITR | 90.64 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 58 | 34 | 48 | 15 | EPAVIVSKATFEAYK | 81.74 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 57 | 1 | 22 | 22 | MQSINFRTARGNLSEVLNNVEA | 79.9 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 57 | 24 | 30 | 7 | EEVEITR | 90.64 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 1 | 57 | 34 | 48 | 15 | EPAVIVSKATFEAYK | 81.74 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 41 | 73 | 52 | 64 | 13 | LDAEFASLFDTLD | 89.89 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 51 | 73 | 52 | 64 | 13 | LDAEFASLFDTLD | 89.89 |
| DP00288 | Q06253 | Antitoxin phd (Addiction protein pdh) (Prevent host death protein) | Escherichia phage P1 (Bacteriophage P1) | 52 | 73 | 52 | 64 | 13 | LDAEFASLFDTLD | 89.89 |
| DP00291 | Q9QXT8 | Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) | Mus musculus (Mouse) | 65 | 256 | 66 | 72 | 7 | ELELSTV | 75.39 |
| DP00291 | Q9QXT8 | Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) | Mus musculus (Mouse) | 65 | 256 | 79 | 89 | 11 | LDQLQAQTKFT | 80.45 |
| DP00291 | Q9QXT8 | Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) | Mus musculus (Mouse) | 65 | 256 | 113 | 139 | 27 | TFKLIYSQFFPQGDATTYAHFLFNAFD | 86.52 |
| DP00291 | Q9QXT8 | Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) | Mus musculus (Mouse) | 65 | 256 | 142 | 196 | 55 | GNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGCITKEEMLAIMKSIYD | 84.37 |
| DP00291 | Q9QXT8 | Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) | Mus musculus (Mouse) | 65 | 256 | 214 | 223 | 10 | HVERFFQKMD | 82.98 |
| DP00291 | Q9QXT8 | Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3) | Mus musculus (Mouse) | 65 | 256 | 228 | 251 | 24 | GVVTIDEFLETCQKDENIMNSMQL | 81.27 |
| DP00298 | Q07817 | Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X) | Homo sapiens (Human) | 28 | 80 | 28 | 35 | 8 | SDVEENRT | 79.93 |
| DP00298 | Q07817 | Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X) | Homo sapiens (Human) | 28 | 80 | 47 | 60 | 14 | TPSAINGNPSWHLA | 84.95 |
| DP00298 | Q07817 | Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X) | Homo sapiens (Human) | 71 | 119 | 77 | 92 | 16 | AREVIPMAAVKQALRE | 74.77 |
| DP00298 | Q07817 | Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X) | Homo sapiens (Human) | 71 | 119 | 94 | 114 | 21 | GDEFELRYRRAFSDLTSQLHI | 79.18 |
| DP00303 | P02185 | Myoglobin | Physeter macrocephalus (Sperm whale) (Physeter catodon) | 1 | 153 | 4 | 18 | 15 | SEGEWQLVLHVWAKV | 77.7 |
| DP00303 | P02185 | Myoglobin | Physeter macrocephalus (Sperm whale) (Physeter catodon) | 1 | 153 | 25 | 35 | 11 | HGQDILIRLFK | 82.43 |
| DP00303 | P02185 | Myoglobin | Physeter macrocephalus (Sperm whale) (Physeter catodon) | 1 | 153 | 40 | 48 | 9 | TLEKFDRFK | 85.95 |
| DP00303 | P02185 | Myoglobin | Physeter macrocephalus (Sperm whale) (Physeter catodon) | 1 | 153 | 67 | 77 | 11 | VTVLTALGAIL | 89.84 |
| DP00303 | P02185 | Myoglobin | Physeter macrocephalus (Sperm whale) (Physeter catodon) | 1 | 153 | 100 | 117 | 18 | IPIKYLEFISEAIIHVLH | 79.9 |
| DP00303 | P02185 | Myoglobin | Physeter macrocephalus (Sperm whale) (Physeter catodon) | 1 | 153 | 128 | 140 | 13 | AQGAMNKALELFR | 84.05 |
| DP00304 | P31751 | RAC-beta serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-2) (Protein kinase B beta) (PKB beta) (RAC-PK-beta) | Homo sapiens (Human) | 441 | 481 | 458 | 466 | 9 | SLGLLELDQ | 76.89 |
| DP00304 | P31751 | RAC-beta serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-2) (Protein kinase B beta) (PKB beta) (RAC-PK-beta) | Homo sapiens (Human) | 442 | 480 | 458 | 466 | 9 | SLGLLELDQ | 76.89 |
| DP00306 | Q07108 | Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69) | Homo sapiens (Human) | 1 | 84 | 3 | 14 | 12 | SENCFVAENSSL | 80.13 |
| DP00306 | Q07108 | Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69) | Homo sapiens (Human) | 1 | 84 | 33 | 76 | 44 | HEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPGQYTFSM | 82.35 |
| DP00307 | P51946 | Cyclin-H (MO15-associated protein) (p34) (p37) | Homo sapiens (Human) | 288 | 323 | 310 | 316 | 7 | EEEEWTD | 77.59 |
| DP00314 | Q9UJY5 | ADP-ribosylation factor-binding protein GGA1 (Gamma-adaptin-related protein 1) (Golgi-localized; gamma ear-containing; ARF-binding protein 1) | Homo sapiens (Human) | 166 | 189 | 166 | 172 | 7 | NVIFEDE | 77.26 |
| DP00324 | P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed | Homo sapiens (Human) | 186 | 320 | 186 | 193 | 8 | MASASSSQ | 75.59 |
| DP00324 | P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed | Homo sapiens (Human) | 186 | 320 | 212 | 224 | 13 | GNDNFGRGGNFSG | 78.88 |
| DP00324 | P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed | Homo sapiens (Human) | 186 | 320 | 243 | 254 | 12 | GYNGFGNDGGYG | 75.92 |
| DP00324 | P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed | Homo sapiens (Human) | 186 | 320 | 270 | 292 | 23 | GGQGYGNQGSGYGGSGSYDSYNN | 76.34 |
| DP00324 | P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed | Homo sapiens (Human) | 186 | 320 | 302 | 315 | 14 | SGSNFGGGGSYNDF | 83.8 |
| DP00324 | P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed | Homo sapiens (Human) | 193 | 250 | 212 | 224 | 13 | GNDNFGRGGNFSG | 78.88 |
| DP00324 | P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) Cleaved into: Heterogeneous nuclear ribonucleoprotein A1; N-terminally processed | Homo sapiens (Human) | 257 | 305 | 270 | 292 | 23 | GGQGYGNQGSGYGGSGSYDSYNN | 76.34 |
| DP00325 | P01099 | Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1) | Oryctolagus cuniculus (Rabbit) | 1 | 166 | 9 | 15 | 7 | KIQFTVP | 86.96 |
| DP00325 | P01099 | Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1) | Oryctolagus cuniculus (Rabbit) | 1 | 166 | 37 | 44 | 8 | ATLVLTSD | 77.63 |
| DP00328 | Q08605 | Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein) | Drosophila melanogaster (Fruit fly) | 281 | 348 | 294 | 306 | 13 | ATGEITPAQGATG | 80.86 |
| DP00328 | Q08605 | Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein) | Drosophila melanogaster (Fruit fly) | 281 | 348 | 313 | 319 | 7 | SGVLSTP | 79.93 |
| DP00328 | Q08605 | Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein) | Drosophila melanogaster (Fruit fly) | 310 | 335 | 313 | 319 | 7 | SGVLSTP | 79.93 |
| DP00328 | Q08605 | Transcription factor GAGA (Adh transcription factor 2) (GAGA factor) (GAF) (Neural conserved at 70F) (Trithorax-like protein) | Drosophila melanogaster (Fruit fly) | 368 | 444 | 408 | 418 | 11 | VQSLHTLQGVQ | 75.92 |
| DP00329 | P02666 | Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin | Bos taurus (Bovine) | 1 | 224 | 1 | 75 | 75 | MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVY | 78.57 |
| DP00329 | P02666 | Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin | Bos taurus (Bovine) | 1 | 224 | 137 | 150 | 14 | SQSLTLTDVENLHL | 82.94 |
| DP00329 | P02666 | Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin | Bos taurus (Bovine) | 1 | 224 | 154 | 160 | 7 | LLQSWMH | 76.88 |
| DP00329 | P02666 | Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin | Bos taurus (Bovine) | 1 | 224 | 175 | 182 | 8 | QSVLSLSQ | 80.27 |
| DP00329 | P02666 | Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin | Bos taurus (Bovine) | 1 | 224 | 201 | 212 | 12 | PIQAFLLYQEPV | 79.46 |
| DP00329 | P02666 | Beta-casein Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin | Bos taurus (Bovine) | 1 | 25 | 1 | 20 | 20 | MKVLILACLVALALARELEE | 79.08 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 1 | 317 | 2 | 21 | 20 | KTALILLSILGMACAFSMKN | 82.64 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 1 | 317 | 24 | 54 | 31 | RRVKIEDSEENGVFKYRPRYYLYKHAYFYPH | 84.94 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 1 | 317 | 88 | 97 | 10 | GENNEESNED | 75.25 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 1 | 317 | 101 | 115 | 15 | EAENTTLSATTLGYG | 77.35 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 1 | 317 | 121 | 134 | 14 | GTGYTGLAAIQLPK | 75.44 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 1 | 317 | 169 | 180 | 12 | VDENEQGINGTS | 81.02 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 1 | 317 | 255 | 282 | 28 | TTVEYEGEYEYTGANEYDNGYEIYESEN | 83.03 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 1 | 317 | 287 | 312 | 26 | GDNYRAYEDEYSYFKGQGYDGYDGQN | 83.1 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 258 | 317 | 259 | 282 | 24 | YEGEYEYTGANEYDNGYEIYESEN | 83.54 |
| DP00332 | P21815 | Bone sialoprotein 2 (Bone sialoprotein II) (BSP II) (Cell-binding sialoprotein) (Integrin-binding sialoprotein) | Homo sapiens (Human) | 258 | 317 | 287 | 312 | 26 | GDNYRAYEDEYSYFKGQGYDGYDGQN | 83.1 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 18 | 40 | 23 | EPAVYFKEQFLDGDGWTSRWIES | 79.12 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 45 | 59 | 15 | DFGKFVLSSGKFYGD | 82.03 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 65 | 85 | 21 | GLQTSQDARFYALSASFEPFS | 79.36 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 87 | 105 | 19 | KGQTLVVQFTVKHEQNIDC | 86.8 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 108 | 122 | 15 | GYVKLFPNSLDQTDM | 80.36 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 124 | 133 | 10 | GDSEYNIMFG | 84.18 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 143 | 160 | 18 | KVHVIFNYKGKNVLINKD | 97.21 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 164 | 175 | 12 | KDDEFTHLYTLI | 84.64 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 178 | 205 | 28 | PDNTYEVKIDNSQVESGSLEDDWDFLPP | 82.97 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 286 | 300 | 15 | KGTWIHPEIDNPEYS | 77.26 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 417 | 302 | 357 | 56 | DPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQM | 81.82 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 18 | 40 | 23 | EPAVYFKEQFLDGDGWTSRWIES | 79.12 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 45 | 59 | 15 | DFGKFVLSSGKFYGD | 82.03 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 65 | 85 | 21 | GLQTSQDARFYALSASFEPFS | 79.36 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 87 | 105 | 19 | KGQTLVVQFTVKHEQNIDC | 86.8 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 108 | 122 | 15 | GYVKLFPNSLDQTDM | 80.36 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 124 | 133 | 10 | GDSEYNIMFG | 84.18 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 143 | 160 | 18 | KVHVIFNYKGKNVLINKD | 97.21 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 164 | 175 | 12 | KDDEFTHLYTLI | 84.64 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 178 | 205 | 28 | PDNTYEVKIDNSQVESGSLEDDWDFLPP | 82.97 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 18 | 307 | 286 | 300 | 15 | KGTWIHPEIDNPEYS | 77.26 |
| DP00333 | P27797 | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) | Homo sapiens (Human) | 308 | 417 | 310 | 357 | 48 | NFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQM | 81.36 |
| DP00334 | Q00987 | E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) | Homo sapiens (Human) | 1 | 24 | 12 | 19 | 8 | GAVTTSQI | 86.62 |
| DP00334 | Q00987 | E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) | Homo sapiens (Human) | 210 | 304 | 233 | 270 | 38 | GDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSD | 78.81 |
| DP00334 | Q00987 | E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) | Homo sapiens (Human) | 210 | 304 | 272 | 299 | 28 | DDEVYQVTVYQAGESDTDSFEEDPEISL | 78.2 |
| DP00335 | Q64364 | Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p19ARF) | Mus musculus (Mouse) | 1 | 37 | 4 | 12 | 9 | RFLVTVRIQ | 83.28 |
| DP00335 | Q64364 | Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p19ARF) | Mus musculus (Mouse) | 1 | 37 | 19 | 28 | 10 | QERVFLVKFV | 88.6 |
| DP00340 | P62965 | Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) | Mus musculus (Mouse) | 1 | 137 | 12 | 29 | 18 | SSENFDELLKALGVNAML | 76.9 |
| DP00340 | P62965 | Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) | Mus musculus (Mouse) | 1 | 137 | 32 | 46 | 15 | VAVAAASKPHVEIRQ | 75.14 |
| DP00340 | P62965 | Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) | Mus musculus (Mouse) | 1 | 137 | 48 | 77 | 30 | GDQFYIKTSTTVRTTEINFKVGEGFEEETV | 80.43 |
| DP00340 | P62965 | Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) | Mus musculus (Mouse) | 1 | 137 | 87 | 95 | 9 | TWENENKIH | 78.26 |
| DP00340 | P62965 | Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) | Mus musculus (Mouse) | 1 | 137 | 107 | 113 | 7 | KTYWTRE | 75.25 |
| DP00340 | P62965 | Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I) | Mus musculus (Mouse) | 1 | 137 | 116 | 124 | 9 | NDELILTFG | 89.89 |
| DP00341 | Q02248 | Catenin beta-1 (Beta-catenin) | Mus musculus (Mouse) | 1 | 133 | 21 | 48 | 28 | AVSHWQQQSYLDSGIHSGATTTAPSLSG | 85.2 |
| DP00341 | Q02248 | Catenin beta-1 (Beta-catenin) | Mus musculus (Mouse) | 1 | 133 | 60 | 76 | 17 | SQVLYEWEQGFSQSFTQ | 80.54 |
| DP00341 | Q02248 | Catenin beta-1 (Beta-catenin) | Mus musculus (Mouse) | 1 | 133 | 78 | 89 | 12 | QVADIDGQYAMT | 76.37 |
| DP00341 | Q02248 | Catenin beta-1 (Beta-catenin) | Mus musculus (Mouse) | 17 | 48 | 21 | 43 | 23 | AVSHWQQQSYLDSGIHSGATTTA | 85.11 |
| DP00341 | Q02248 | Catenin beta-1 (Beta-catenin) | Mus musculus (Mouse) | 664 | 781 | 674 | 694 | 21 | LSVELTSSLFRTEPMAWNETA | 78.15 |
| DP00341 | Q02248 | Catenin beta-1 (Beta-catenin) | Mus musculus (Mouse) | 664 | 781 | 769 | 776 | 8 | GDSNQLAW | 79.89 |
| DP00341 | Q02248 | Catenin beta-1 (Beta-catenin) | Mus musculus (Mouse) | 672 | 781 | 674 | 694 | 21 | LSVELTSSLFRTEPMAWNETA | 78.15 |
| DP00341 | Q02248 | Catenin beta-1 (Beta-catenin) | Mus musculus (Mouse) | 672 | 781 | 769 | 776 | 8 | GDSNQLAW | 79.89 |
| DP00342 | P09883 | Colicin-E9 (EC 3.1.-.-) | Escherichia coli | 1 | 83 | 36 | 43 | 8 | GSGWSSEN | 75.25 |
| DP00342 | P09883 | Colicin-E9 (EC 3.1.-.-) | Escherichia coli | 1 | 61 | 36 | 43 | 8 | GSGWSSEN | 75.25 |
| DP00343 | Q9Y6Q9 | Nuclear receptor coactivator 3 (NCoA-3) (EC 2.3.1.48) (ACTR) (Amplified in breast cancer 1 protein) (AIB-1) (CBP-interacting protein) (pCIP) (Class E basic helix-loop-helix protein 42) (bHLHe42) (Receptor-associated coactivator 3) (RAC-3) (Steroid receptor coactivator protein 3) (SRC-3) (Thyroid hormone receptor activator molecule 1) (TRAM-1) | Homo sapiens (Human) | 1018 | 1088 | 1054 | 1065 | 12 | LDQLHTLLSNTD | 79.01 |
| DP00345 | P16535 | Leukotoxin (Lkt) | Mannheimia haemolytica (Pasteurella haemolytica) | 884 | 953 | 884 | 904 | 21 | GNGKITQDELSKVVDNYELLK | 78.56 |
| DP00345 | P16535 | Leukotoxin (Lkt) | Mannheimia haemolytica (Pasteurella haemolytica) | 884 | 953 | 908 | 927 | 20 | NVTNSLDKLISSVSAFTSSN | 78.95 |
| DP00345 | P16535 | Leukotoxin (Lkt) | Mannheimia haemolytica (Pasteurella haemolytica) | 884 | 953 | 940 | 948 | 9 | LDQSLSSLQ | 78.52 |
| DP00347 | P04972 | "Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)" | Bos taurus (Bovine) | 1 | 87 | 46 | 52 | 7 | GVQGFGD | 77.26 |
| DP00347 | P04972 | "Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)" | Bos taurus (Bovine) | 1 | 87 | 63 | 82 | 20 | DITVICPWEAFNHLELHELA | 79.67 |
| DP00347 | P04972 | "Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)" | Bos taurus (Bovine) | 46 | 78 | 46 | 52 | 7 | GVQGFGD | 77.26 |
| DP00347 | P04972 | "Retinal rod rhodopsin-sensitive cGMP 3;5-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)" | Bos taurus (Bovine) | 46 | 78 | 63 | 73 | 11 | DITVICPWEAF | 79.45 |
| DP00348 | P45481 | Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Mus musculus (Mouse) | 2059 | 2118 | 2084 | 2113 | 30 | QQQVLNILKSNPQLMAAFIKQRTAKYVANQ | 80 |
| DP00348 | P45481 | Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Mus musculus (Mouse) | 2059 | 2117 | 2084 | 2112 | 29 | QQQVLNILKSNPQLMAAFIKQRTAKYVAN | 80.21 |
| DP00348 | P45481 | Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Mus musculus (Mouse) | 2113 | 2152 | 2139 | 2147 | 9 | SLQNLNAMQ | 76.07 |
| DP00349 | P06709 | Bifunctional ligase/repressor BirA (Biotin operon repressor) (Biotin--acetyl-CoA-carboxylase ligase) (EC 6.3.4.15) (Biotin--protein ligase) (Biotin-acetyl-CoA carboxylase synthetase) | Escherichia coli (strain K12) | 212 | 234 | 217 | 229 | 13 | SVVNQGWITLQEA | 82.89 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 573 | 579 | 7 | GEGATFD | 79.31 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 592 | 604 | 13 | LLGSFLNTASASS | 80.55 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 624 | 630 | 7 | PAVNIQP | 91.97 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 632 | 641 | 10 | VSGAWDWHTK | 76.92 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 683 | 690 | 8 | GGSSFASK | 80.94 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 721 | 732 | 12 | QGGGYNWQQTQS | 76.48 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 745 | 756 | 12 | NRPNYNVSFSSM | 77.29 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 766 | 772 | 7 | AAANLEG | 79.93 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 780 | 792 | 13 | EDLLSGQGFNAHK | 75.25 |
| DP00351 | Q27974 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | Bos taurus (Bovine) | 547 | 813 | 796 | 803 | 8 | GPRTIAEM | 74.58 |
| DP00352 | O33599 | Glycyl-glycine endopeptidase LytM (EC 3.4.24.75) (Autolysin LytM) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 147 | 182 | 150 | 158 | 9 | NNQAYNSHD | 78.11 |
| DP00352 | O33599 | Glycyl-glycine endopeptidase LytM (EC 3.4.24.75) (Autolysin LytM) | Staphylococcus aureus (strain NCTC 8325 / PS 47) | 147 | 182 | 161 | 167 | 7 | GKVNYPN | 87.29 |
| DP00353 | P23202 | Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 90 | 6 | 64 | 59 | GNQVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQNNNSG | 78.02 |
| DP00353 | P23202 | Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 90 | 68 | 81 | 14 | SQNNDNENNIKNTL | 78.09 |
| DP00353 | P23202 | Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 89 | 6 | 64 | 59 | GNQVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQNNNSG | 78.02 |
| DP00353 | P23202 | Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 89 | 68 | 81 | 14 | SQNNDNENNIKNTL | 78.09 |
| DP00353 | P23202 | Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 273 | 294 | 278 | 286 | 9 | NAAAYSAGT | 85.51 |
| DP00356 | Q99967 | Cbp/p300-interacting transactivator 2 (MSG-related protein 1) (MRG-1) (P35srj) | Homo sapiens (Human) | 220 | 269 | 220 | 241 | 22 | TDFIDEEVLMSLVIEMGLDRIK | 82.43 |
| DP00356 | Q99967 | Cbp/p300-interacting transactivator 2 (MSG-related protein 1) (MRG-1) (P35srj) | Homo sapiens (Human) | 220 | 269 | 243 | 262 | 20 | LPELWLGQNEFDFMTDFVCK | 79.5 |
| DP00357 | P62328 | Thymosin beta-4 (T beta-4) (Fx) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide) | Homo sapiens (Human) | 1 | 44 | 6 | 14 | 9 | DMAEIEKFD | 81.72 |
| DP00357 | P62328 | Thymosin beta-4 (T beta-4) (Fx) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide) | Homo sapiens (Human) | 1 | 44 | 31 | 37 | 7 | SKETIEQ | 75.92 |
| DP00357 | P62328 | Thymosin beta-4 (T beta-4) (Fx) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide) | Homo sapiens (Human) | 17 | 44 | 31 | 37 | 7 | SKETIEQ | 75.92 |
| DP00359 | A6Q0K5 | Calvin cycle protein CP12; chloroplastic (CP12 domain-containing protein) (Chloroplast protein 12) | Chlamydomonas reinhardtii (Chlamydomonas smithii) | 1 | 50 | 5 | 11 | 7 | KSVVISR | 81.08 |
| DP00365 | P53041 | Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) | Homo sapiens (Human) | 19 | 147 | 34 | 41 | 8 | QANDYFKA | 79.97 |
| DP00365 | P53041 | Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) | Homo sapiens (Human) | 19 | 147 | 44 | 101 | 58 | YENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYR | 79.75 |
| DP00365 | P53041 | Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) | Homo sapiens (Human) | 19 | 147 | 103 | 113 | 11 | AASNMALGKFR | 79.93 |
| DP00365 | P53041 | Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) | Homo sapiens (Human) | 19 | 147 | 132 | 142 | 11 | AKMKYQECNKI | 80.12 |
| DP00372 | Q9NR00 | Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) | Homo sapiens (Human) | 1 | 106 | 7 | 18 | 12 | HQAVIMSTSLRV | 83.7 |
| DP00372 | Q9NR00 | Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) | Homo sapiens (Human) | 1 | 106 | 35 | 56 | 22 | AVGNIFENTDQESLERLFRNSG | 80.15 |
| DP00372 | Q9NR00 | Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) | Homo sapiens (Human) | 1 | 106 | 63 | 77 | 15 | RAKIIFAIDQDVEEK | 96.3 |
| DP00372 | Q9NR00 | Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1) | Homo sapiens (Human) | 1 | 106 | 89 | 101 | 13 | KDKLFQFLKLRKY | 80.89 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 153 | 215 | 154 | 163 | 10 | NLQNQQVLTG | 83.68 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 153 | 215 | 167 | 199 | 33 | VMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQD | 79.12 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 153 | 215 | 202 | 210 | 9 | GQIQIIPGA | 92.23 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 342 | 488 | 366 | 382 | 17 | DALNIQQNQTSGGSLQA | 77.1 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 342 | 488 | 391 | 403 | 13 | NQQTQQQQILIQP | 88.6 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 342 | 488 | 408 | 417 | 10 | GGQALQALQA | 76.49 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 342 | 488 | 421 | 442 | 22 | SGQTFTTQAISQETLQNLQLQA | 80.05 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 342 | 488 | 446 | 452 | 7 | SGPIIIR | 79.55 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 342 | 488 | 460 | 483 | 24 | GQVSWQTLQLQNLQVQNPQAQTIT | 77.49 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 349 | 495 | 366 | 382 | 17 | DALNIQQNQTSGGSLQA | 77.1 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 349 | 495 | 391 | 403 | 13 | NQQTQQQQILIQP | 88.6 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 349 | 495 | 408 | 417 | 10 | GGQALQALQA | 76.49 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 349 | 495 | 421 | 442 | 22 | SGQTFTTQAISQETLQNLQLQA | 80.05 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 349 | 495 | 446 | 452 | 7 | SGPIIIR | 79.55 |
| DP00378 | P08047 | Transcription factor Sp1 | Homo sapiens (Human) | 349 | 495 | 460 | 485 | 26 | GQVSWQTLQLQNLQVQNPQAQTITLA | 77.32 |
| DP00381 | P35869 | Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) | Homo sapiens (Human) | 545 | 713 | 557 | 564 | 8 | QNEKFFRN | 77.76 |
| DP00381 | P35869 | Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) | Homo sapiens (Human) | 545 | 713 | 568 | 591 | 24 | GEVDFRDIDLTDEILTYVQDSLSK | 81.05 |
| DP00381 | P35869 | Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) | Homo sapiens (Human) | 545 | 713 | 601 | 611 | 11 | QQQSLALNSSC | 78.93 |
| DP00381 | P35869 | Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) | Homo sapiens (Human) | 545 | 713 | 645 | 663 | 19 | MQVNGMFENWNSNQFVPFN | 82.91 |
| DP00381 | P35869 | Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) | Homo sapiens (Human) | 545 | 713 | 668 | 688 | 21 | DPQQYNVFTDLHGISQEFPYK | 79.36 |
| DP00381 | P35869 | Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76) | Homo sapiens (Human) | 545 | 713 | 696 | 704 | 9 | YTQNFISCN | 83.72 |
| DP00385 | P49841 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | Homo sapiens (Human) | 1 | 34 | 8 | 14 | 7 | TSFAESC | 75.25 |
| DP00385 | P49841 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | Homo sapiens (Human) | 1 | 34 | 19 | 26 | 8 | QPSAFGSM | 76.25 |
| DP00385 | P49841 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | Homo sapiens (Human) | 1 | 33 | 8 | 14 | 7 | TSFAESC | 75.25 |
| DP00385 | P49841 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | Homo sapiens (Human) | 1 | 33 | 19 | 26 | 8 | QPSAFGSM | 76.25 |
| DP00387 | P25814 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | Bacillus subtilis (strain 168) | 1 | 116 | 24 | 34 | 11 | ANRQFVLYTLD | 81.3 |
| DP00387 | P25814 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | Bacillus subtilis (strain 168) | 1 | 116 | 38 | 58 | 21 | NDELRVGLSVSKKIGNAVMRN | 74.71 |
| DP00387 | P25814 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | Bacillus subtilis (strain 168) | 1 | 116 | 64 | 72 | 9 | IRQAFLEEK | 76.63 |
| DP00387 | P25814 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | Bacillus subtilis (strain 168) | 1 | 116 | 78 | 85 | 8 | KDYIIIAR | 96.82 |
| DP00387 | P25814 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | Bacillus subtilis (strain 168) | 1 | 116 | 88 | 97 | 10 | ASQLTYEETK | 90.87 |
| DP00387 | P25814 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | Bacillus subtilis (strain 168) | 1 | 116 | 99 | 111 | 13 | SLQHLFRKSSLYK | 85.03 |
| DP00389 | P09983 | Hemolysin; chromosomal | Escherichia coli | 962 | 1023 | 962 | 994 | 33 | DALAYGSQGNLNPLINEISKIISAAGNFDVKEE | 81.23 |
| DP00389 | P09983 | Hemolysin; chromosomal | Escherichia coli | 962 | 1023 | 996 | 1018 | 23 | AAASLLQLSGNASDFSYGRNSIT | 81.34 |
| DP00396 | O74718 | Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF3) (ERF2) (Polypeptide release factor 3) (Translation release factor 3) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 280 | 307 | 282 | 296 | 15 | KESWYLSWALDSTSE | 78.97 |
| DP00398 | P07342 | Acetolactate synthase catalytic subunit; mitochondrial (EC 2.2.1.6) (Acetohydroxy-acid synthase catalytic subunit) (AHAS) (ALS) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 647 | 687 | 660 | 668 | 9 | GLDEFINFD | 90.71 |
| DP00399 | P50097 | "Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" | Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) | 102 | 221 | 112 | 124 | 13 | PDQTFADVLAISQ | 82.22 |
| DP00399 | P50097 | "Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" | Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) | 102 | 221 | 140 | 161 | 22 | HGVLLGLVTQRDYPIDLTQTET | 80.27 |
| DP00399 | P50097 | "Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" | Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) | 102 | 221 | 184 | 201 | 18 | EANKIIWEKKLNALPIID | 82.5 |
| DP00399 | P50097 | "Inosine-5-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)" | Tritrichomonas foetus (Trichomonas foetus) (Tritrichomonas suis) | 102 | 221 | 204 | 213 | 10 | QHLRYIVFRK | 79.67 |
| DP00407 | P07363 | Chemotaxis protein CheA (EC 2.7.13.3) | Escherichia coli (strain K12) | 124 | 158 | 124 | 130 | 7 | RQLALEA | 79.26 |
| DP00410 | P12497 | Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-) | Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) | 108 | 143 | 122 | 138 | 17 | TGNNSQVSQNYPIVQNL | 76.45 |
| DP00410 | P12497 | Gag-Pol polyprotein (Pr160Gag-Pol) Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-) | Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) | 123 | 143 | 126 | 138 | 13 | SQVSQNYPIVQNL | 77.23 |
| DP00415 | P0ABE0 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) | Escherichia coli O157:H7 | 49 | 76 | 57 | 70 | 14 | AQSNAAAPATVPSM | 77.26 |
| DP00418 | P78504 | Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339) | Homo sapiens (Human) | 1094 | 1218 | 1118 | 1124 | 7 | QLNQIKN | 79.93 |
| DP00418 | P78504 | Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339) | Homo sapiens (Human) | 1094 | 1218 | 1129 | 1137 | 9 | HGANTVPIK | 76.03 |
| DP00418 | P78504 | Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339) | Homo sapiens (Human) | 1094 | 1218 | 1172 | 1179 | 8 | KQPAYTLV | 80.27 |
| DP00418 | P78504 | Protein jagged-1 (Jagged1) (hJ1) (CD antigen CD339) | Homo sapiens (Human) | 1094 | 1218 | 1207 | 1213 | 7 | SAQSLNR | 78.17 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 13 | 54 | 42 | GIKLSADVKPFVPRFAGLNVAWLESSEACVFPSSAATYYPFV | 79.57 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 60 | 96 | 37 | TEQKIYTEDMAFGASTFPPQYLSSEITLHPYAYSPYT | 80.22 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 100 | 106 | 7 | TQNVYSV | 87.86 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 108 | 126 | 19 | GSQYLYNQPSCYRGFQTVK | 77.06 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 139 | 149 | 11 | MKALFKKKTYD | 77.26 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 164 | 175 | 12 | ADGTISSEIKSA | 81.83 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 179 | 190 | 12 | HHLSIYAENSLK | 83.25 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 201 | 224 | 24 | KSRIIAKNVSTSKPEFEFTTLDFP | 81.41 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 226 | 237 | 12 | LQGAENNMSEIQ | 81.77 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 262 | 275 | 14 | AAVLSKGEIVVKNN | 78.36 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 277 | 289 | 13 | NESVTANAATNSP | 77.72 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 293 | 314 | 22 | RELSWTPMGYVVRQTLSTELSA | 75.05 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 317 | 332 | 16 | KNVTSMINLKTIASSA | 85.68 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 335 | 359 | 25 | KNVSIPSSEALSSDPSYNKEKHIIH | 76.63 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 388 | 397 | 10 | STSKYEVLTV | 86.05 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 405 | 417 | 13 | DAEEFPNLAVASE | 78.65 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 453 | 461 | 9 | GGMLTALEK | 73.91 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 531 | 539 | 9 | SLKKIILKE | 79.45 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 547 | 559 | 13 | LQENAVSPAFTSD | 75.92 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 1 | 600 | 584 | 590 | 7 | MDELIST | 79.74 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 776 | 854 | 780 | 786 | 7 | VQQELVG | 82.61 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 776 | 854 | 817 | 825 | 9 | EPHYIEIWK | 84.58 |
| DP00420 | Q96T21 | Selenocysteine insertion sequence-binding protein 2 (SECIS-binding protein 2) | Homo sapiens (Human) | 776 | 854 | 827 | 849 | 23 | HLEAYSGCTLELEESLEASTSQM | 75.88 |
| DP00421 | P07516 | Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein) | Bos taurus (Bovine) | 1 | 202 | 37 | 43 | 7 | MLFRLSE | 74.96 |
| DP00421 | P07516 | Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein) | Bos taurus (Bovine) | 1 | 202 | 81 | 105 | 25 | AVQRIAESHLQSISNLGENQASEEE | 81.78 |
| DP00422 | P0A6R3 | DNA-binding protein Fis (Factor-for-inversion stimulation protein) (Hin recombinational enhancer-binding protein) | Escherichia coli (strain K12) | 1 | 23 | 4 | 18 | 15 | QRVNSDVLTVSTVNS | 80.38 |
| DP00423 | P53551 | Histone H1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 166 | 252 | 176 | 188 | 13 | SSLTYKEMILKSM | 77.87 |
| DP00423 | P53551 | Histone H1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 166 | 252 | 196 | 212 | 17 | GSSRIVLKKYVKDTFSS | 82.06 |
| DP00423 | P53551 | Histone H1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 166 | 252 | 216 | 229 | 14 | TSSNFDYLFNSAIK | 85.16 |
| DP00423 | P53551 | Histone H1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 171 | 258 | 176 | 188 | 13 | SSLTYKEMILKSM | 77.87 |
| DP00423 | P53551 | Histone H1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 171 | 258 | 196 | 212 | 17 | GSSRIVLKKYVKDTFSS | 82.06 |
| DP00423 | P53551 | Histone H1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 171 | 258 | 216 | 229 | 14 | TSSNFDYLFNSAIK | 85.16 |
| DP00424 | P04325 | Protein Rev (ART/TRS) (Anti-repression transactivator) (Regulator of expression of viral proteins) | Human immunodeficiency virus type 1 group M subtype B (isolate PCV12) (HIV-1) | 62 | 116 | 99 | 111 | 13 | SPQILVESPTILE | 74.35 |
| DP00427 | P0AFG8 | Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1) | Escherichia coli (strain K12) | 1 | 55 | 15 | 27 | 13 | RDWLQAIESVIRE | 79.93 |
| DP00427 | P0AFG8 | Pyruvate dehydrogenase E1 component (PDH E1 component) (EC 1.2.4.1) | Escherichia coli (strain K12) | 1 | 55 | 32 | 44 | 13 | RAQYLIDQLLAEA | 85.49 |
| DP00435 | Q01853 | Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) | Mus musculus (Mouse) | 736 | 806 | 751 | 764 | 14 | DIRKYEMFAQTLQQ | 81.15 |
| DP00435 | Q01853 | Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) | Mus musculus (Mouse) | 736 | 806 | 767 | 774 | 8 | GFGSFRFP | 76.51 |
| DP00435 | Q01853 | Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) | Mus musculus (Mouse) | 736 | 806 | 792 | 799 | 8 | GGSVYTED | 83.15 |
| DP00436 | P50477 | Canavalin | Canavalia ensiformis (Jack bean) (Dolichos ensiformis) | 1 | 45 | 2 | 29 | 28 | AFSARFPLWLLLGVVLLASVSASFAHSG | 78.33 |
| DP00437 | P43351 | DNA repair protein RAD52 homolog | Homo sapiens (Human) | 1 | 23 | 4 | 10 | 7 | TEEAILG | 89.97 |
| DP00438 | Q05158 | Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2) | Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) | 68 | 115 | 76 | 83 | 8 | GAGTLNMD | 78.93 |
| DP00438 | Q05158 | Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2) | Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) | 82 | 117 | 106 | 112 | 7 | NTSKFAQ | 85.91 |
| DP00446 | O35718 | Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (Protein EF-10) | Mus musculus (Mouse) | 186 | 225 | 200 | 206 | 7 | HLDSYEK | 75.35 |
| DP00446 | O35718 | Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (Protein EF-10) | Mus musculus (Mouse) | 186 | 225 | 213 | 220 | 8 | PIREFLDQ | 74.25 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 241 | 16 | 29 | 14 | RATKFLESIKGKFT | 78.88 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 241 | 37 | 67 | 31 | KDSIISVNSTDIEVTKESPITSNSTIINPTN | 82.19 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 241 | 83 | 90 | 8 | PLVSFKED | 78.26 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 241 | 94 | 133 | 40 | SDNPFSKLYKETIETFDNNEEESSYSYEEINDQTNDNITA | 82.79 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 241 | 141 | 157 | 17 | KLSEILGMLHTLVVASA | 78.73 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 241 | 174 | 196 | 23 | REEMIEKIRTEALMTNDRLEAMA | 80.28 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 241 | 222 | 230 | 9 | KLNNLLEGN | 74.84 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 118 | 16 | 29 | 14 | RATKFLESIKGKFT | 78.88 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 118 | 37 | 67 | 31 | KDSIISVNSTDIEVTKESPITSNSTIINPTN | 82.19 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 118 | 83 | 90 | 8 | PLVSFKED | 78.26 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 118 | 94 | 113 | 20 | SDNPFSKLYKETIETFDNNE | 79.25 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 102 | 16 | 29 | 14 | RATKFLESIKGKFT | 78.88 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 102 | 37 | 67 | 31 | KDSIISVNSTDIEVTKESPITSNSTIINPTN | 82.19 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 1 | 102 | 83 | 90 | 8 | PLVSFKED | 78.26 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 161 | 241 | 174 | 196 | 23 | REEMIEKIRTEALMTNDRLEAMA | 80.28 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 161 | 241 | 222 | 230 | 9 | KLNNLLEGN | 74.84 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 164 | 241 | 174 | 196 | 23 | REEMIEKIRTEALMTNDRLEAMA | 80.28 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 164 | 241 | 222 | 230 | 9 | KLNNLLEGN | 74.84 |
| DP00447 | P12579 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain Long) | 198 | 241 | 222 | 230 | 9 | KLNNLLEGN | 74.84 |
| DP00448 | Q9Y613 | FH1/FH2 domain-containing protein 1 (Formin homolog overexpressed in spleen 1) (FHOS) (Formin homology 2 domain-containing protein 1) | Homo sapiens (Human) | 1104 | 1164 | 1110 | 1117 | 8 | LLVQSVTK | 77.26 |
| DP00448 | Q9Y613 | FH1/FH2 domain-containing protein 1 (Formin homolog overexpressed in spleen 1) (FHOS) (Formin homology 2 domain-containing protein 1) | Homo sapiens (Human) | 1104 | 1164 | 1150 | 1158 | 9 | LVQALGLSK | 75.92 |
| DP00449 | P53563 | Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X) | Rattus norvegicus (Rat) | 31 | 80 | 47 | 60 | 14 | TPSAINGNPSWHLA | 84.95 |
| DP00455 | P84092 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein) | Rattus norvegicus (Rat) | 130 | 158 | 130 | 140 | 11 | KTFITQQGIKS | 79.69 |
| DP00455 | P84092 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein) | Rattus norvegicus (Rat) | 130 | 158 | 147 | 153 | 7 | EQSQITS | 77.11 |
| DP00455 | P84092 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein) | Rattus norvegicus (Rat) | 135 | 158 | 147 | 153 | 7 | EQSQITS | 77.11 |
| DP00458 | P37727 | Rab proteins geranylgeranyltransferase component A 1 (Choroideremia protein homolog) (Rab escort protein 1) (REP-1) | Rattus norvegicus (Rat) | 108 | 208 | 110 | 141 | 32 | KDVEEAGALQKNHASVTSAQSAEAAEAAETSC | 77.58 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 1 | 90 | 6 | 15 | 10 | ADNAHNNAFG | 80.13 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 1 | 90 | 21 | 27 | 7 | GIGNTSG | 80.27 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 1 | 90 | 42 | 48 | 7 | NGWSWSN | 82.04 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 1 | 90 | 58 | 70 | 13 | SDGSYHITFHGDN | 78.44 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 2 | 90 | 6 | 15 | 10 | ADNAHNNAFG | 80.13 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 2 | 90 | 21 | 27 | 7 | GIGNTSG | 80.27 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 2 | 90 | 42 | 48 | 7 | NGWSWSN | 82.04 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 2 | 90 | 58 | 70 | 13 | SDGSYHITFHGDN | 78.44 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 40 | 76 | 42 | 48 | 7 | NGWSWSN | 82.04 |
| DP00461 | P08083 | Colicin-N | Escherichia coli | 40 | 76 | 58 | 70 | 13 | SDGSYHITFHGDN | 78.44 |
| DP00462 | P11157 | Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit) | Mus musculus (Mouse) | 1 | 64 | 14 | 21 | 8 | QQQLQLSP | 76.76 |
| DP00462 | P11157 | Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit) | Mus musculus (Mouse) | 1 | 64 | 47 | 59 | 13 | AARRIFQDSAELE | 77.44 |
| DP00462 | P11157 | Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit) | Mus musculus (Mouse) | 353 | 390 | 353 | 371 | 19 | NISLEGKTNFFEKRVGEYQ | 78.61 |
| DP00462 | P11157 | Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit) | Mus musculus (Mouse) | 353 | 390 | 373 | 385 | 13 | MGVMSNSTENSFT | 77.31 |
| DP00463 | Q9Z0U4 | Gamma-aminobutyric acid type B receptor subunit 1 (GABA-B receptor 1) (GABA-B-R1) (GABA-BR1) (GABABR1) (Gb1) | Rattus norvegicus (Rat) | 17 | 98 | 49 | 66 | 18 | QVKAINFLPVDYEIEYVC | 86.55 |
| DP00463 | Q9Z0U4 | Gamma-aminobutyric acid type B receptor subunit 1 (GABA-B receptor 1) (GABA-B-R1) (GABA-BR1) (GABABR1) (Gb1) | Rattus norvegicus (Rat) | 17 | 98 | 82 | 89 | 8 | ANGSWTDM | 79.14 |
| DP00466 | P04156 | Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230) | Homo sapiens (Human) | 23 | 124 | 29 | 39 | 11 | GGWNTGGSRYP | 80.94 |
| DP00466 | P04156 | Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230) | Homo sapiens (Human) | 23 | 124 | 95 | 101 | 7 | THSQWNK | 73.91 |
| DP00468 | P25963 | NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) | Homo sapiens (Human) | 1 | 66 | 38 | 54 | 17 | KDEEYEQMVKELQEIRL | 82.71 |
| DP00468 | P25963 | NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) | Homo sapiens (Human) | 276 | 317 | 285 | 312 | 28 | DEESYDTESEFTEFTEDELPYDDCVFGG | 79.47 |
| DP00469 | O24646 | Transcription factor HY5 (Protein LONG HYPOCOTYL 5) (bZIP transcription factor 56) (AtbZIP56) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 77 | 2 | 15 | 14 | QEQATSSLAASSLP | 74.18 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 20 | 27 | 8 | LAGHFTQD | 84.28 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 54 | 69 | 16 | LGVASEDELVAEFLQD | 78.66 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 78 | 100 | 23 | APQTFKMDDLLAEMQQIEQSNFR | 81.42 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 110 | 125 | 16 | ADLALSENWAQEFLAA | 79.93 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 129 | 148 | 20 | VDVTQDYNETDWSQEFISEV | 81.3 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 159 | 175 | 17 | WAEEYLEQSEEKLWLGE | 75.96 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 181 | 190 | 10 | TDRWYDEYHP | 80.27 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 193 | 205 | 13 | DLQHTASDFVAKV | 76.85 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 209 | 223 | 15 | KLANSEFLKFVRQIG | 87.78 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 225 | 231 | 7 | GQVSLES | 79.41 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 239 | 298 | 60 | QAEQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEM | 78.64 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 324 | 306 | 319 | 14 | HPWLSDYDDLTSAT | 79.67 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 110 | 20 | 27 | 8 | LAGHFTQD | 84.28 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 110 | 54 | 69 | 16 | LGVASEDELVAEFLQD | 78.66 |
| DP00472 | P50542 | Peroxisomal targeting signal 1 receptor (PTS1 receptor) (PTS1R) (PTS1-BP) (Peroxin-5) (Peroxisomal C-terminal targeting signal import receptor) (Peroxisome receptor 1) | Homo sapiens (Human) | 1 | 110 | 78 | 100 | 23 | APQTFKMDDLLAEMQQIEQSNFR | 81.42 |
| DP00473 | Q49AN0 | Cryptochrome-2 | Homo sapiens (Human) | 490 | 593 | 496 | 522 | 27 | SRLNIERMKQIYQQLSRYRGLCLLASV | 78.53 |
| DP00474 | Q43125 | Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2) | Arabidopsis thaliana (Mouse-ear cress) | 506 | 681 | 511 | 524 | 14 | GDSAEVEEAPIEFP | 76.9 |
| DP00474 | Q43125 | Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2) | Arabidopsis thaliana (Mouse-ear cress) | 506 | 681 | 565 | 572 | 8 | SLNLRNSV | 75.75 |
| DP00474 | Q43125 | Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2) | Arabidopsis thaliana (Mouse-ear cress) | 506 | 681 | 599 | 619 | 21 | NQVTAMIPEFNIRIVAESTED | 79.61 |
| DP00474 | Q43125 | Cryptochrome-1 (AtCry) (Atcry1) (Blue light photoreceptor) (Protein BLUE LIGHT UNINHIBITED 1) (Protein ELONGATED HYPOCOTYL 4) (Protein OUT OF PHASE 2) (OOP2) | Arabidopsis thaliana (Mouse-ear cress) | 506 | 681 | 660 | 676 | 17 | TTSSYLQNHHEILNWRR | 79.64 |
| DP00475 | Q6Q547 | H/ACA ribonucleoprotein complex subunit NOP10 (Nucleolar protein 10) (Nucleolar protein family A member 3) (snoRNP protein NOP10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 17 | 38 | 22 | 28 | 7 | ESGEITK | 75.25 |
| DP00482 | Q08826 | Sorting nexin-3 (Golgi retention deficient protein 19) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 29 | 3 | 18 | 16 | REFKSFGSTEKSLLSK | 73.91 |
| DP00485 | Q9UBE0 | SUMO-activating enzyme subunit 1 (Ubiquitin-like 1-activating enzyme E1A) Cleaved into: SUMO-activating enzyme subunit 1; N-terminally processed | Homo sapiens (Human) | 289 | 311 | 290 | 299 | 10 | DFVRYCFSEM | 78.66 |
| DP00486 | Q9UBT2 | SUMO-activating enzyme subunit 2 (EC 2.3.2.-) (Anthracycline-associated resistance ARX) (Ubiquitin-like 1-activating enzyme E1B) (Ubiquitin-like modifier-activating enzyme 2) | Homo sapiens (Human) | 551 | 640 | 562 | 568 | 7 | AAKSITN | 79.93 |
| DP00486 | Q9UBT2 | SUMO-activating enzyme subunit 2 (EC 2.3.2.-) (Anthracycline-associated resistance ARX) (Ubiquitin-like 1-activating enzyme E1B) (Ubiquitin-like modifier-activating enzyme 2) | Homo sapiens (Human) | 551 | 640 | 585 | 593 | 9 | DDVLIVDSD | 98.33 |
| DP00487 | P09938 | Ribonucleoside-diphosphate reductase small chain 1 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 1) (Ribonucleotide reductase small subunit 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 41 | 11 | 36 | 26 | ADALSDLEIKDSKSNLNKELETLREE | 79.07 |
| DP00488 | P49723 | Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 51 | 3 | 15 | 13 | AHNQFLKTFQKER | 80.19 |
| DP00488 | P49723 | Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 51 | 23 | 46 | 24 | KDEILLMENSRRFVMFPIKYHEIW | 76.99 |
| DP00490 | O88900 | Growth factor receptor-bound protein 14 (GRB14 adapter protein) | Rattus norvegicus (Rat) | 361 | 435 | 369 | 380 | 12 | VSENSLVAMDFS | 75.25 |
| DP00490 | O88900 | Growth factor receptor-bound protein 14 (GRB14 adapter protein) | Rattus norvegicus (Rat) | 361 | 435 | 383 | 389 | 7 | KTRVIDN | 74.25 |
| DP00490 | O88900 | Growth factor receptor-bound protein 14 (GRB14 adapter protein) | Rattus norvegicus (Rat) | 361 | 435 | 391 | 406 | 16 | TEALSVAVEEGLAWRK | 77.17 |
| DP00491 | Q62165 | Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) | Mus musculus (Mouse) | 654 | 750 | 654 | 662 | 9 | VVEWTNNTL | 80.27 |
| DP00491 | Q62165 | Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) | Mus musculus (Mouse) | 654 | 750 | 669 | 680 | 12 | KEQIIGLSRRIA | 91.97 |
| DP00491 | Q62165 | Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) | Mus musculus (Mouse) | 654 | 750 | 689 | 695 | 7 | AFSNALE | 78.26 |
| DP00491 | Q62165 | Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) | Mus musculus (Mouse) | 654 | 750 | 699 | 708 | 10 | KALSIAVTGS | 80.67 |
| DP00491 | Q62165 | Dystroglycan (Dystrophin-associated glycoprotein 1) Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG) | Mus musculus (Mouse) | 654 | 750 | 713 | 719 | 7 | HLQFIPV | 81.89 |
| DP00492 | P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | Homo sapiens (Human) | 142 | 485 | 182 | 205 | 24 | KDILSEASTMQLLQQQQQEAVSEG | 76.2 |
| DP00492 | P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | Homo sapiens (Human) | 142 | 485 | 221 | 233 | 13 | SKDNYLGGTSTIS | 83.43 |
| DP00492 | P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | Homo sapiens (Human) | 142 | 485 | 250 | 258 | 9 | GVEALEHLS | 76.7 |
| DP00492 | P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | Homo sapiens (Human) | 142 | 485 | 305 | 318 | 14 | DTAEYSPFKGGYTK | 74.41 |
| DP00492 | P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | Homo sapiens (Human) | 142 | 485 | 344 | 351 | 8 | TLSLYKSG | 92.64 |
| DP00492 | P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | Homo sapiens (Human) | 142 | 485 | 355 | 371 | 17 | EAAAYQSRDYYNFPLAL | 83.12 |
| DP00492 | P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | Homo sapiens (Human) | 142 | 485 | 395 | 416 | 22 | YGSAWAAAAAQCRYGDLASLHG | 79.74 |
| DP00492 | P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | Homo sapiens (Human) | 142 | 485 | 433 | 449 | 17 | SSWHTLFTAEEGQLYGP | 82.59 |
| DP00499 | Q9Z2F5 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) | Rattus norvegicus (Rat) | 306 | 430 | 310 | 316 | 7 | EQASIEM | 80.32 |
| DP00499 | Q9Z2F5 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) | Rattus norvegicus (Rat) | 306 | 430 | 320 | 329 | 10 | AAREIRRAIT | 77.26 |
| DP00499 | Q9Z2F5 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) | Rattus norvegicus (Rat) | 306 | 430 | 338 | 354 | 17 | NCVNKDHLTAATHWASM | 77.06 |
| DP00499 | Q9Z2F5 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) | Rattus norvegicus (Rat) | 306 | 430 | 364 | 372 | 9 | NGAAYSRYP | 79.97 |
| DP00499 | Q9Z2F5 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) | Rattus norvegicus (Rat) | 306 | 430 | 386 | 399 | 14 | AVEGIVPSAMSLSH | 81.27 |
| DP00505 | P04234 | T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d) | Homo sapiens (Human) | 127 | 171 | 138 | 151 | 14 | DTQALLRNDQVYQP | 76.37 |
| DP00505 | P04234 | T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d) | Homo sapiens (Human) | 127 | 171 | 156 | 166 | 11 | DDAQYSHLGGN | 79.26 |
| DP00506 | P07766 | T-cell surface glycoprotein CD3 epsilon chain (T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e) | Homo sapiens (Human) | 153 | 207 | 195 | 202 | 8 | QRDLYSGL | 76.09 |
| DP00508 | P09693 | T-cell surface glycoprotein CD3 gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g) | Homo sapiens (Human) | 139 | 182 | 156 | 162 | 7 | NDQLYQP | 97.99 |
| DP00508 | P09693 | T-cell surface glycoprotein CD3 gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g) | Homo sapiens (Human) | 139 | 182 | 170 | 177 | 8 | QYSHLQGN | 75.25 |
| DP00510 | O60356 | Nuclear protein 1 (Candidate of metastasis 1) (Protein p8) | Homo sapiens (Human) | 1 | 82 | 26 | 38 | 13 | ESDLYSLAHSYLG | 78.85 |
| DP00517 | P52179 | Myomesin-1 (190 kDa connectin-associated protein) (190 kDa titin-associated protein) (Myomesin family member 1) | Homo sapiens (Human) | 836 | 931 | 871 | 877 | 7 | KDALLGS | 75.92 |
| DP00517 | P52179 | Myomesin-1 (190 kDa connectin-associated protein) (190 kDa titin-associated protein) (Myomesin family member 1) | Homo sapiens (Human) | 836 | 931 | 891 | 907 | 17 | LGQTEVSKVSETVQEEL | 75.37 |
| DP00518 | O54918 | Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) | Mus musculus (Mouse) | 1 | 113 | 73 | 86 | 14 | SPLFIFVRRSSLLS | 95.63 |
| DP00518 | O54918 | Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) | Mus musculus (Mouse) | 1 | 113 | 88 | 97 | 10 | SSSGYFSFDT | 88.8 |
| DP00518 | O54918 | Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) | Mus musculus (Mouse) | 85 | 113 | 88 | 97 | 10 | SSSGYFSFDT | 88.8 |
| DP00518 | O54918 | Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death) | Mus musculus (Mouse) | 139 | 171 | 153 | 166 | 14 | IGDEFNETYTRRVF | 82.51 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1393 | 1405 | 13 | LDSFESRSIASSV | 77.93 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1413 | 1420 | 8 | MVSGIISP | 86.2 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1470 | 1484 | 15 | AAVNAAVQRVQVLPD | 78.66 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1487 | 1495 | 9 | TLLHFATES | 79.86 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1505 | 1525 | 21 | SLSALSLDEPFIQKDVELRIM | 77.15 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1528 | 1539 | 12 | VQENDNGNETES | 75.25 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1543 | 1558 | 16 | KESNENQEKEAEKTID | 77.45 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1570 | 1582 | 13 | DDIEILEECIISA | 79.21 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1647 | 1662 | 16 | TPINFSTATSLSDLTI | 80.73 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1362 | 1745 | 1722 | 1731 | 10 | DILAECINSA | 76.42 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1459 | 1532 | 1470 | 1484 | 15 | AAVNAAVQRVQVLPD | 78.66 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1459 | 1532 | 1487 | 1495 | 9 | TLLHFATES | 79.86 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1459 | 1532 | 1505 | 1525 | 21 | SLSALSLDEPFIQKDVELRIM | 77.15 |
| DP00519 | P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | Homo sapiens (Human) | 1614 | 1679 | 1647 | 1662 | 16 | TPINFSTATSLSDLTI | 80.73 |
| DP00520 | Q969F2 | Protein naked cuticle homolog 2 (Naked-2) (hNkd2) | Homo sapiens (Human) | 1 | 217 | 23 | 32 | 10 | SFVASAYASG | 93.38 |
| DP00520 | Q969F2 | Protein naked cuticle homolog 2 (Naked-2) (hNkd2) | Homo sapiens (Human) | 1 | 217 | 105 | 114 | 10 | QRLNIDALQC | 86.29 |
| DP00520 | Q969F2 | Protein naked cuticle homolog 2 (Naked-2) (hNkd2) | Homo sapiens (Human) | 1 | 217 | 123 | 134 | 12 | RQEWTFTLYDFD | 83.92 |
| DP00520 | Q969F2 | Protein naked cuticle homolog 2 (Naked-2) (hNkd2) | Homo sapiens (Human) | 1 | 217 | 147 | 163 | 17 | LMHTIYEVVDASVNHSS | 78.6 |
| DP00521 | O95997 | Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) | Homo sapiens (Human) | 1 | 202 | 1 | 8 | 8 | MATLIYVD | 97.37 |
| DP00521 | O95997 | Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) | Homo sapiens (Human) | 1 | 202 | 65 | 75 | 11 | GTVNRATEKSV | 76.25 |
| DP00521 | O95997 | Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) | Homo sapiens (Human) | 1 | 202 | 107 | 121 | 15 | SDDAYPEIEKFFPFN | 81.61 |
| DP00521 | O95997 | Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) | Homo sapiens (Human) | 1 | 202 | 123 | 129 | 7 | LDFESFD | 84.85 |
| DP00521 | O95997 | Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) | Homo sapiens (Human) | 1 | 202 | 144 | 150 | 7 | VPLMILD | 77.26 |
| DP00521 | O95997 | Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) | Homo sapiens (Human) | 1 | 202 | 155 | 162 | 8 | LEKLFQLG | 82.61 |
| DP00521 | O95997 | Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG) | Homo sapiens (Human) | 1 | 202 | 174 | 194 | 21 | WESNLLQSPSSILSTLDVELP | 76.84 |
| DP00527 | P02783 | Seminal vesicle secretory protein 4 (Androgen-dependent protein) (ADP) (Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV) (SVS protein S) | Rattus norvegicus (Rat) | 1 | 70 | 3 | 21 | 19 | STSLFLCSLLLLLVTGAIG | 79.39 |
| DP00527 | P02783 | Seminal vesicle secretory protein 4 (Androgen-dependent protein) (ADP) (Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV) (SVS protein S) | Rattus norvegicus (Rat) | 1 | 70 | 24 | 42 | 19 | TKEKYSQSEEVVSESFASG | 77.93 |
| DP00530 | P12950 | Dehydrin DHN1 (M3) (RAB-17 protein) | Zea mays (Maize) | 1 | 168 | 139 | 147 | 9 | TGGAYATGT | 79.34 |
| DP00531 | Q08655 | Abscisic stress-ripening protein 1 | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 115 | 8 | 15 | 8 | HHHLFHHK | 74.58 |
| DP00531 | Q08655 | Abscisic stress-ripening protein 1 | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 115 | 21 | 30 | 10 | GPVDYEKEIK | 73.91 |
| DP00531 | Q08655 | Abscisic stress-ripening protein 1 | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 115 | 34 | 54 | 21 | HLEQIGKLGTVAAGAYALHEK | 79.9 |
| DP00531 | Q08655 | Abscisic stress-ripening protein 1 | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 115 | 69 | 89 | 21 | IEEEIAAAAAVGAGGFAFHEH | 81.73 |
| DP00531 | Q08655 | Abscisic stress-ripening protein 1 | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 61 | 115 | 69 | 89 | 21 | IEEEIAAAAAVGAGGFAFHEH | 81.73 |
| DP00533 | P06701 | Regulatory protein SIR3 (Silent information regulator 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 216 | 549 | 270 | 287 | 18 | THGSISPQEESVSPNISS | 76.87 |
| DP00533 | P06701 | Regulatory protein SIR3 (Silent information regulator 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 216 | 549 | 309 | 330 | 22 | SKELIVSEEIPINSSEQESDYE | 76.77 |
| DP00533 | P06701 | Regulatory protein SIR3 (Silent information regulator 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 216 | 549 | 332 | 340 | 9 | NNETSVLSS | 78.15 |
| DP00533 | P06701 | Regulatory protein SIR3 (Silent information regulator 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 216 | 549 | 356 | 365 | 10 | GRENFVYANN | 88.36 |
| DP00533 | P06701 | Regulatory protein SIR3 (Silent information regulator 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 216 | 549 | 386 | 393 | 8 | SDEAIIPV | 84.99 |
| DP00533 | P06701 | Regulatory protein SIR3 (Silent information regulator 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 216 | 549 | 401 | 432 | 32 | GSELSSKIRKIHIQETQEFSKNYTTETDNEMN | 77.98 |
| DP00533 | P06701 | Regulatory protein SIR3 (Silent information regulator 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 216 | 549 | 459 | 483 | 25 | NAKMIDFATLSKLKKKYQIILDRFA | 81.69 |
| DP00533 | P06701 | Regulatory protein SIR3 (Silent information regulator 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 216 | 549 | 493 | 514 | 22 | QLNKLTDEQSSLDVAGLEDKFR | 73.91 |
| DP00533 | P06701 | Regulatory protein SIR3 (Silent information regulator 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 216 | 549 | 521 | 540 | 20 | GRETILSNFNADINLEESIR | 81.44 |
| DP00534 | Q9LZP9 | Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 131 | 2 | 20 | 19 | ATIATGLNIATQRVFVTSE | 80.46 |
| DP00534 | Q9LZP9 | Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 131 | 28 | 44 | 17 | GPVHLNNSWNLGSRTTN | 79.17 |
| DP00534 | Q9LZP9 | Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 131 | 84 | 96 | 13 | CVAAWDEVEELSA | 77.21 |
| DP00534 | Q9LZP9 | Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 131 | 112 | 118 | 7 | PLEEYCK | 79.93 |
| DP00534 | Q9LZP9 | Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2) | Arabidopsis thaliana (Mouse-ear cress) | 54 | 131 | 84 | 96 | 13 | CVAAWDEVEELSA | 77.21 |
| DP00534 | Q9LZP9 | Calvin cycle protein CP12-2; chloroplastic (CP12 domain-containing protein 2) (Chloroplast protein 12-2) | Arabidopsis thaliana (Mouse-ear cress) | 54 | 131 | 112 | 118 | 7 | PLEEYCK | 79.93 |
| DP00537 | O43236 | Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2) | Homo sapiens (Human) | 1 | 119 | 20 | 27 | 8 | GIKRFLED | 75.25 |
| DP00537 | O43236 | Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2) | Homo sapiens (Human) | 1 | 119 | 33 | 47 | 15 | ELSKFVKDFSGNASC | 86.96 |
| DP00537 | O43236 | Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2) | Homo sapiens (Human) | 1 | 119 | 68 | 78 | 11 | APDLYDDDLEF | 78.47 |
| DP00537 | O43236 | Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2) | Homo sapiens (Human) | 1 | 119 | 88 | 97 | 10 | DNQQYFCAPA | 79.63 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 168 | 486 | 207 | 215 | 9 | VQVKRVLEK | 75.92 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 168 | 486 | 286 | 304 | 19 | KAVKESSIRSVQETVLPIK | 76.52 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 168 | 486 | 310 | 319 | 10 | ETVSIEVKEV | 78.29 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 168 | 486 | 323 | 329 | 7 | LLVSTLG | 76.02 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 168 | 486 | 438 | 451 | 14 | PAVATAATAAEKYK | 80.48 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 207 | 310 | 207 | 215 | 9 | VQVKRVLEK | 75.92 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 207 | 310 | 286 | 304 | 19 | KAVKESSIRSVQETVLPIK | 76.52 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 261 | 330 | 286 | 304 | 19 | KAVKESSIRSVQETVLPIK | 76.52 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 261 | 330 | 310 | 319 | 10 | ETVSIEVKEV | 78.29 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 285 | 313 | 286 | 304 | 19 | KAVKESSIRSVQETVLPIK | 76.52 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 285 | 309 | 286 | 304 | 19 | KAVKESSIRSVQETVLPIK | 76.52 |
| DP00539 | P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | Homo sapiens (Human) | 335 | 486 | 438 | 451 | 14 | PAVATAATAAEKYK | 80.48 |
| DP00540 | Q9VPU8 | KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) | Drosophila melanogaster (Fruit fly) | 1 | 345 | 7 | 28 | 22 | EETKISTEPVDNAWSMKIPAFR | 76.06 |
| DP00540 | Q9VPU8 | KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) | Drosophila melanogaster (Fruit fly) | 1 | 345 | 35 | 67 | 33 | GMVEESSFATLFPKYRERYLKEVWPLVEQCLAE | 75.62 |
| DP00540 | Q9VPU8 | KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) | Drosophila melanogaster (Fruit fly) | 1 | 345 | 90 | 98 | 9 | WDPYIIIKA | 78.78 |
| DP00540 | Q9VPU8 | KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) | Drosophila melanogaster (Fruit fly) | 1 | 345 | 123 | 133 | 11 | GCDIIKIGNLV | 81.73 |
| DP00540 | Q9VPU8 | KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) | Drosophila melanogaster (Fruit fly) | 1 | 345 | 153 | 179 | 27 | TLKSIELLTDCYVLVQGNTVSALGPYK | 76.66 |
| DP00540 | Q9VPU8 | KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) | Drosophila melanogaster (Fruit fly) | 1 | 345 | 186 | 193 | 8 | DIVLETMN | 77.01 |
| DP00540 | Q9VPU8 | KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) | Drosophila melanogaster (Fruit fly) | 1 | 345 | 195 | 207 | 13 | VHPIYNIKALMIK | 79.26 |
| DP00540 | Q9VPU8 | KRR1 small subunit processome component homolog (KRR-R motif-containing protein 1) (Protein dribble) | Drosophila melanogaster (Fruit fly) | 1 | 345 | 262 | 274 | 13 | KQLASGEYFLNQE | 78.65 |
| DP00541 | Q91V27 | Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) | Mus musculus (Mouse) | 147 | 403 | 187 | 199 | 13 | RLLSFRDVDFEED | 76.97 |
| DP00541 | Q91V27 | Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) | Mus musculus (Mouse) | 147 | 403 | 210 | 216 | 7 | TLGLSSV | 77.26 |
| DP00541 | Q91V27 | Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) | Mus musculus (Mouse) | 147 | 403 | 223 | 232 | 10 | LQSLSGEPYS | 80.27 |
| DP00541 | Q91V27 | Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) | Mus musculus (Mouse) | 147 | 403 | 242 | 252 | 11 | GLEETGARALG | 73.91 |
| DP00541 | Q91V27 | Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) | Mus musculus (Mouse) | 147 | 403 | 302 | 313 | 12 | LPSQYLADVDTS | 74.25 |
| DP00541 | Q91V27 | Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) | Mus musculus (Mouse) | 147 | 403 | 337 | 344 | 8 | ETQILELN | 80.23 |
| DP00541 | Q91V27 | Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) | Mus musculus (Mouse) | 147 | 403 | 349 | 361 | 13 | AVEHLLVHLENTV | 79.8 |
| DP00541 | Q91V27 | Melanophilin (Exophilin-3) (Leaden protein) (Slp homolog lacking C2 domains a) (SlaC2-a) (Synaptotagmin-like protein 2a) | Mus musculus (Mouse) | 147 | 403 | 388 | 398 | 11 | LEELTSNISGS | 87.84 |
| DP00543 | Q14061 | Cytochrome c oxidase copper chaperone | Homo sapiens (Human) | 1 | 63 | 3 | 10 | 8 | GLVDSNPA | 74.58 |
| DP00543 | Q14061 | Cytochrome c oxidase copper chaperone | Homo sapiens (Human) | 1 | 63 | 33 | 40 | 8 | RDACIIEK | 77.97 |
| DP00543 | Q14061 | Cytochrome c oxidase copper chaperone | Homo sapiens (Human) | 1 | 63 | 45 | 51 | 7 | CGHLIEA | 77.4 |
| DP00543 | Q14061 | Cytochrome c oxidase copper chaperone | Homo sapiens (Human) | 1 | 29 | 3 | 10 | 8 | GLVDSNPA | 74.58 |
| DP00543 | Q14061 | Cytochrome c oxidase copper chaperone | Homo sapiens (Human) | 25 | 63 | 33 | 40 | 8 | RDACIIEK | 77.97 |
| DP00543 | Q14061 | Cytochrome c oxidase copper chaperone | Homo sapiens (Human) | 25 | 63 | 45 | 51 | 7 | CGHLIEA | 77.4 |
| DP00543 | Q14061 | Cytochrome c oxidase copper chaperone | Homo sapiens (Human) | 25 | 60 | 33 | 40 | 8 | RDACIIEK | 77.97 |
| DP00543 | Q14061 | Cytochrome c oxidase copper chaperone | Homo sapiens (Human) | 25 | 60 | 45 | 51 | 7 | CGHLIEA | 77.4 |
| DP00544 | B0FRH7 | Protein LLP (Protein LAPS18-like) | "Aplysia kurodai (Kurodas sea hare)" | 1 | 120 | 35 | 55 | 21 | KAQELDLDNVVTMKSAEEIKN | 74.79 |
| DP00544 | B0FRH7 | Protein LLP (Protein LAPS18-like) | "Aplysia kurodai (Kurodas sea hare)" | 1 | 120 | 81 | 94 | 14 | TQQNEDGHYPQWMN | 76.59 |
| DP00546 | Q9NX55 | Huntingtin-interacting protein K (Huntingtin yeast partner K) | Homo sapiens (Human) | 1 | 129 | 13 | 23 | 11 | GDVELELETET | 75.22 |
| DP00546 | Q9NX55 | Huntingtin-interacting protein K (Huntingtin yeast partner K) | Homo sapiens (Human) | 1 | 129 | 54 | 69 | 16 | EIQSSNLETAMSVIGD | 80.23 |
| DP00546 | Q9NX55 | Huntingtin-interacting protein K (Huntingtin yeast partner K) | Homo sapiens (Human) | 1 | 129 | 94 | 105 | 12 | DLELIMTEMEIS | 79.4 |
| DP00546 | Q9NX55 | Huntingtin-interacting protein K (Huntingtin yeast partner K) | Homo sapiens (Human) | 1 | 129 | 118 | 124 | 7 | GNVVEAL | 83.52 |
| DP00549 | O00488 | Zinc finger protein 593 (Zinc finger protein T86) | Homo sapiens (Human) | 36 | 77 | 65 | 72 | 8 | ACARYFID | 78.64 |
| DP00549 | O00488 | Zinc finger protein 593 (Zinc finger protein T86) | Homo sapiens (Human) | 78 | 116 | 89 | 102 | 14 | LKQLSVEPYSQEEA | 75.25 |
| DP00550 | P02628 | Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3) | Esox lucius (Northern pike) | 1 | 108 | 19 | 36 | 18 | AEGSFNHKKFFALVGLKA | 86.79 |
| DP00550 | P02628 | Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3) | Esox lucius (Northern pike) | 1 | 108 | 53 | 70 | 18 | ASGFIEEEELKFVLKSFA | 79.49 |
| DP00550 | P02628 | Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3) | Esox lucius (Northern pike) | 1 | 108 | 80 | 88 | 9 | ETKAFLKAA | 75.62 |
| DP00550 | P02628 | Parvalbumin alpha (Parvalbumin III) (Parvalbumin pI 5.0) (Parvalbumin-3) | Esox lucius (Northern pike) | 1 | 108 | 92 | 103 | 12 | GDGKIGIDEFET | 79.6 |
| DP00551 | P16860 | Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29) | Homo sapiens (Human) | 1 | 77 | 9 | 24 | 16 | RALLLLLFLHLAFLGG | 80.18 |
| DP00551 | P16860 | Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29) | Homo sapiens (Human) | 1 | 77 | 36 | 42 | 7 | SDLETSG | 74.92 |
| DP00551 | P16860 | Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29) | Homo sapiens (Human) | 1 | 77 | 53 | 66 | 14 | KLSELQVEQTSLEP | 75.92 |
| DP00552 | P0AFX7 | Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein) | Escherichia coli (strain K12) | 121 | 216 | 123 | 129 | 7 | GQSETSQ | 79.93 |
| DP00552 | P0AFX7 | Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein) | Escherichia coli (strain K12) | 121 | 216 | 134 | 140 | 7 | PVFNTLP | 76.49 |
| DP00552 | P0AFX7 | Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein) | Escherichia coli (strain K12) | 121 | 216 | 176 | 183 | 8 | MLQDYELQ | 75.67 |
| DP00552 | P0AFX7 | Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein) | Escherichia coli (strain K12) | 121 | 216 | 189 | 204 | 16 | EQLQFEQAQTQQAAVQ | 76.42 |
| DP00553 | Q9NZ94 | Neuroligin-3 (Gliotactin homolog) | Homo sapiens (Human) | 731 | 848 | 783 | 797 | 15 | TLRLTALPDYTLTLR | 75.14 |
| DP00553 | Q9NZ94 | Neuroligin-3 (Gliotactin homolog) | Homo sapiens (Human) | 731 | 848 | 807 | 838 | 32 | TPNTITMIPNSLVGLQTLHPYNTFAAGFNSTG | 77.08 |
| DP00555 | Q16143 | Beta-synuclein | Homo sapiens (Human) | 1 | 134 | 1 | 10 | 10 | MDVFMKGLSM | 75.59 |
| DP00555 | Q16143 | Beta-synuclein | Homo sapiens (Human) | 1 | 134 | 14 | 41 | 28 | GVVAAAEKTKQGVTEAAEKTKEGVLYVG | 81.4 |
| DP00555 | Q16143 | Beta-synuclein | Homo sapiens (Human) | 1 | 134 | 50 | 60 | 11 | QGVASVAEKTK | 79.93 |
| DP00555 | Q16143 | Beta-synuclein | Homo sapiens (Human) | 1 | 134 | 67 | 90 | 24 | GGAVFSGAGNIAAATGLVKREEFP | 90.73 |
| DP00555 | Q16143 | Beta-synuclein | Homo sapiens (Human) | 1 | 134 | 115 | 121 | 7 | EGESYED | 77.07 |
| DP00555 | Q16143 | Beta-synuclein | Homo sapiens (Human) | 1 | 134 | 123 | 129 | 7 | PQEEYQE | 79.84 |
| DP00557 | Q00955 | Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) Includes: Biotin carboxylase (EC 6.3.4.14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 2048 | 2080 | 2055 | 2062 | 8 | RSQLSNKS | 75.25 |
| DP00557 | Q00955 | Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) Includes: Biotin carboxylase (EC 6.3.4.14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 2048 | 2080 | 2067 | 2073 | 7 | VHQQISK | 80.22 |
| DP00563 | Q61337 | Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) | Mus musculus (Mouse) | 1 | 204 | 40 | 50 | 11 | AQSMFQIPEFE | 78.29 |
| DP00563 | Q61337 | Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) | Mus musculus (Mouse) | 1 | 204 | 82 | 88 | 7 | LGSNIHQ | 82.27 |
| DP00563 | Q61337 | Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) | Mus musculus (Mouse) | 1 | 204 | 140 | 148 | 9 | NLWAAQRYG | 82.5 |
| DP00563 | Q61337 | Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) | Mus musculus (Mouse) | 1 | 204 | 183 | 196 | 14 | WTRIIQSWWDRNLG | 90.64 |
| DP00564 | Q6P8Z1 | Protein B-Myc | Mus musculus (Mouse) | 2 | 169 | 3 | 24 | 22 | LHVSLANGNRDLDYDSVQPYFM | 78.5 |
| DP00564 | Q6P8Z1 | Protein B-Myc | Mus musculus (Mouse) | 2 | 169 | 63 | 69 | 7 | HAGLYSP | 76.64 |
| DP00564 | Q6P8Z1 | Protein B-Myc | Mus musculus (Mouse) | 2 | 169 | 73 | 79 | 7 | AVAVSFA | 91.16 |
| DP00564 | Q6P8Z1 | Protein B-Myc | Mus musculus (Mouse) | 2 | 169 | 85 | 92 | 8 | GDSFSIAD | 85.79 |
| DP00564 | Q6P8Z1 | Protein B-Myc | Mus musculus (Mouse) | 2 | 169 | 111 | 140 | 30 | DDETFVKNIILQDCMWNGFSASAKLVSKLD | 81.55 |
| DP00564 | Q6P8Z1 | Protein B-Myc | Mus musculus (Mouse) | 2 | 169 | 150 | 159 | 10 | TGVSLAADVE | 74.05 |
| DP00566 | P13102 | Hemagglutinin Cleaved into: Hemagglutinin HA1 chain; Hemagglutinin HA2 chain | Influenza A virus (strain A/Whale/Maine/328/1984 H13N2) | 141 | 175 | 156 | 170 | 15 | GTNSFYRNLVWFVKK | 89.07 |
| DP00573 | P03305 | Genome polyprotein Cleaved into: Leader protease (Lb(pro)) (EC 3.4.22.46); Capsid protein VP0 (VP4-VP2); Capsid protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Capsid protein VP1 (P1D) (Virion protein 1); Protein 2A (P2A) (P52); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Protein 3B-1 (P3B-1) (Genome-linked protein VPg1); Protein 3B-2 (P3B-2) (Genome-linked protein VPg2); Protein 3B-3 (P3B-3) (Genome-linked protein VPg3); Protease 3C (EC 3.4.22.28) (Picornain 3C) (P3C) (Protease P20B); RNA-directed RNA polymerase 3D-POL (P3D-POL) (EC 2.7.7.48) (P56A) | Foot-and-mouth disease virus (isolate Bovine/Germany/O1Kaufbeuren/1966 serotype O) (FMDV) | 852 | 890 | 871 | 877 | 7 | DLQVLAQ | 79.65 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 174 | 361 | 174 | 183 | 10 | ADQLLQMIRV | 76.45 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 174 | 361 | 229 | 242 | 14 | LQRALALSRQEIDM | 76.68 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 174 | 361 | 249 | 258 | 10 | LRRAIQLSMQ | 85.15 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 174 | 361 | 260 | 266 | 7 | SSRNISQ | 79.93 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 174 | 361 | 273 | 281 | 9 | GTNLTSEEL | 79.93 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 174 | 361 | 284 | 297 | 14 | RREAYFEKQQQKQQ | 86.48 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 174 | 361 | 341 | 351 | 11 | QAAVTMSLETV | 76.19 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 182 | 291 | 229 | 242 | 14 | LQRALALSRQEIDM | 76.68 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 182 | 291 | 249 | 258 | 10 | LRRAIQLSMQ | 85.15 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 182 | 291 | 260 | 266 | 7 | SSRNISQ | 79.93 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 182 | 291 | 273 | 281 | 9 | GTNLTSEEL | 79.93 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 194 | 361 | 229 | 242 | 14 | LQRALALSRQEIDM | 76.68 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 194 | 361 | 249 | 258 | 10 | LRRAIQLSMQ | 85.15 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 194 | 361 | 260 | 266 | 7 | SSRNISQ | 79.93 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 194 | 361 | 273 | 281 | 9 | GTNLTSEEL | 79.93 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 194 | 361 | 284 | 297 | 14 | RREAYFEKQQQKQQ | 86.48 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 194 | 361 | 341 | 351 | 11 | QAAVTMSLETV | 76.19 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 224 | 348 | 229 | 242 | 14 | LQRALALSRQEIDM | 76.68 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 224 | 348 | 249 | 258 | 10 | LRRAIQLSMQ | 85.15 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 224 | 348 | 260 | 266 | 7 | SSRNISQ | 79.93 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 224 | 348 | 273 | 281 | 9 | GTNLTSEEL | 79.93 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 224 | 348 | 284 | 297 | 14 | RREAYFEKQQQKQQ | 86.48 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 262 | 361 | 273 | 281 | 9 | GTNLTSEEL | 79.93 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 262 | 361 | 284 | 297 | 14 | RREAYFEKQQQKQQ | 86.48 |
| DP00576 | P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | Homo sapiens (Human) | 262 | 361 | 341 | 351 | 11 | QAAVTMSLETV | 76.19 |
| DP00583 | P16006 | Deoxycytidylate deaminase (EC 3.5.4.12) (dCMP deaminase) (dCD) | Enterobacteria phage T4 (Bacteriophage T4) | 63 | 83 | 64 | 70 | 7 | KHAIIQG | 87.63 |
| DP00584 | A2VD23 | Protein starmaker | Danio rerio (Zebrafish) (Brachydanio rerio) | 1 | 613 | 7 | 21 | 15 | FVPLILAFVGVSISA | 87.05 |
| DP00584 | A2VD23 | Protein starmaker | Danio rerio (Zebrafish) (Brachydanio rerio) | 1 | 613 | 37 | 49 | 13 | DQRHIFTVQFNVG | 77.85 |
| DP00584 | A2VD23 | Protein starmaker | Danio rerio (Zebrafish) (Brachydanio rerio) | 1 | 613 | 56 | 62 | 7 | GDSVTTD | 74.1 |
| DP00584 | A2VD23 | Protein starmaker | Danio rerio (Zebrafish) (Brachydanio rerio) | 1 | 613 | 202 | 211 | 10 | GDSASAEKTD | 79.26 |
| DP00584 | A2VD23 | Protein starmaker | Danio rerio (Zebrafish) (Brachydanio rerio) | 1 | 613 | 522 | 530 | 9 | SDSASVEAN | 76.25 |
| DP00587 | Q9CQK7 | RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) | Mus musculus (Mouse) | 1 | 243 | 12 | 40 | 29 | LEALESIYPDSFTVLSESPPSFTITVTSE | 80.59 |
| DP00587 | Q9CQK7 | RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) | Mus musculus (Mouse) | 1 | 243 | 47 | 61 | 15 | TVQTTLKFTYSEKYP | 77.75 |
| DP00587 | Q9CQK7 | RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) | Mus musculus (Mouse) | 1 | 243 | 63 | 77 | 15 | ETPLYEIFSQENLED | 78.28 |
| DP00587 | Q9CQK7 | RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) | Mus musculus (Mouse) | 1 | 243 | 79 | 121 | 43 | DVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTR | 82.45 |
| DP00587 | Q9CQK7 | RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) | Mus musculus (Mouse) | 1 | 243 | 144 | 166 | 23 | TPVTIENFLSWKAKFDAELLEIK | 79.96 |
| DP00587 | Q9CQK7 | RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) | Mus musculus (Mouse) | 1 | 243 | 183 | 204 | 22 | GKQLFETDHNLDTSDIQFLEDA | 82.65 |
| DP00587 | Q9CQK7 | RWD domain-containing protein 1 (DRG family-regulatory protein 2) (IH1) | Mus musculus (Mouse) | 1 | 243 | 210 | 225 | 16 | VDESLFQEMDDLELED | 77.15 |
| DP00588 | P27958 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1a (isolate H77) (HCV) | 1 | 82 | 20 | 36 | 17 | QDVKFPGGGQIVGGVYL | 81.53 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1009 | 1015 | 7 | HVQHIIG | 91.26 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1026 | 1034 | 9 | AHDNFLAGG | 80.6 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1053 | 1061 | 9 | EGQNTVIGG | 74.92 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1063 | 1078 | 16 | GDDVFLQDLGVWSNQL | 83.13 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1120 | 1138 | 19 | PALNLFSVDHVKNIENLHG | 78.75 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1186 | 1197 | 12 | GNDIFLQDDETV | 79.1 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1208 | 1222 | 15 | DTVDYSAMIHPGRIV | 79.93 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1225 | 1240 | 16 | HEYGFGIEADLSREWV | 79.95 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1246 | 1279 | 34 | LGVDYYDNVRNVENVIGTSMKDVLIGDAQANTLM | 83.18 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1292 | 1298 | 7 | GDDLLFG | 88.72 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1328 | 1336 | 9 | GNDWFGQTQ | 77.63 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1350 | 1356 | 7 | DTVDYSQ | 79.93 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1359 | 1376 | 18 | AHAGIAAGRIGLGILADL | 78.34 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1388 | 1412 | 25 | GSSAYDTVSGIENVVGTELADRITG | 78.33 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1414 | 1421 | 8 | AQANVLRG | 74.25 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1460 | 1476 | 17 | GDDWFFQDAANAGNLLD | 89.67 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1497 | 1513 | 17 | AKGVFLSLGKGFASLMD | 76.73 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1518 | 1531 | 14 | SNVLRNIENAVGSA | 76.47 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1533 | 1539 | 7 | DDVLIGD | 96.32 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1541 | 1556 | 16 | GANVLNGLAGNDVLSG | 79.06 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1586 | 1605 | 20 | GDDTYLFGVGYGHDTIYESG | 78.04 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1609 | 1615 | 7 | DTIRINA | 79.93 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1617 | 1625 | 9 | ADQLWFARQ | 97.81 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1627 | 1635 | 9 | NDLEIRILG | 81.68 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1637 | 1648 | 12 | DDALTVHDWYRD | 79.93 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1651 | 1662 | 12 | HRVEIIHAANQA | 76.92 |
| DP00591 | J7QLC0 | Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin | Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) | 1006 | 1706 | 1664 | 1680 | 17 | DQAGIEKLVEAMAQYPD | 77.06 |
| DP00592 | P48539 | Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4) | Homo sapiens (Human) | 1 | 62 | 25 | 33 | 9 | KVQEEFDID | 79.71 |
| DP00592 | P48539 | Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4) | Homo sapiens (Human) | 1 | 62 | 42 | 54 | 13 | AAVAIQSQFRKFQ | 79.78 |
| DP00594 | P49869 | Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) | Drosophila melanogaster (Fruit fly) | 523 | 753 | 545 | 555 | 11 | LQQLHTLQSQA | 79.87 |
| DP00594 | P49869 | Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) | Drosophila melanogaster (Fruit fly) | 523 | 753 | 576 | 597 | 22 | NSGGYNYHGHFNAINASANLSP | 81.01 |
| DP00594 | P49869 | Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) | Drosophila melanogaster (Fruit fly) | 523 | 753 | 601 | 610 | 10 | ASSLYEYNGV | 92.17 |
| DP00594 | P49869 | Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) | Drosophila melanogaster (Fruit fly) | 523 | 753 | 612 | 619 | 8 | AADNFYGQ | 95.23 |
| DP00594 | P49869 | Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) | Drosophila melanogaster (Fruit fly) | 523 | 753 | 624 | 667 | 44 | QQQSYQQHNYNSHNGERYSLPTFPTISELAAATAAVEAAAAATV | 81.89 |
| DP00594 | P49869 | Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) | Drosophila melanogaster (Fruit fly) | 523 | 753 | 695 | 702 | 8 | KLAKITLN | 75.5 |
| DP00594 | P49869 | Probable nuclear hormone receptor HR38 (dHR38) (Nuclear receptor subfamily 4 group A member 4) | Drosophila melanogaster (Fruit fly) | 523 | 753 | 712 | 718 | 7 | ALQLNSA | 85.28 |
| DP00605 | Q24246 | Cytoplasmic dynein 1 intermediate chain (DH IC) (Dynein intermediate chain; cytosolic) (Protein short wing) | Drosophila melanogaster (Fruit fly) | 109 | 135 | 109 | 121 | 13 | NLSVYNVQATNIP | 81.35 |
| DP00605 | Q24246 | Cytoplasmic dynein 1 intermediate chain (DH IC) (Dynein intermediate chain; cytosolic) (Protein short wing) | Drosophila melanogaster (Fruit fly) | 109 | 135 | 124 | 130 | 7 | ETLVYTK | 86.67 |
| DP00606 | P42759 | Dehydrin ERD10 (Low-temperature-induced protein LTI45) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 260 | 1 | 9 | 9 | MAEEYKNTV | 75.73 |
| DP00606 | P42759 | Dehydrin ERD10 (Low-temperature-induced protein LTI45) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 260 | 31 | 38 | 8 | GMFDFLKK | 80.6 |
| DP00606 | P42759 | Dehydrin ERD10 (Low-temperature-induced protein LTI45) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 260 | 57 | 67 | 11 | KTQISEPESFV | 75.25 |
| DP00606 | P42759 | Dehydrin ERD10 (Low-temperature-induced protein LTI45) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 260 | 134 | 148 | 15 | DHVKTVEEENQGVMD | 74.16 |
| DP00606 | P42759 | Dehydrin ERD10 (Low-temperature-induced protein LTI45) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 260 | 209 | 224 | 16 | QVVNTTPLVETATPIA | 79.35 |
| DP00607 | Q16595 | Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN) | Homo sapiens (Human) | 1 | 41 | 9 | 16 | 8 | VAGLLASP | 79.93 |
| DP00607 | Q16595 | Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN) | Homo sapiens (Human) | 1 | 41 | 20 | 27 | 8 | QAQTLTRV | 74.67 |
| DP00607 | Q16595 | Frataxin; mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN) | Homo sapiens (Human) | 42 | 86 | 61 | 79 | 19 | GLNQIWNVKKQSVYLMNLR | 80.21 |
| DP00608 | Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | Homo sapiens (Human) | 59 | 129 | 63 | 75 | 13 | AFPEIHVAQYPLD | 75.25 |
| DP00608 | Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | Homo sapiens (Human) | 59 | 129 | 84 | 102 | 19 | NALAIQVDSEGKIKYDAIA | 80.87 |
| DP00608 | Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | Homo sapiens (Human) | 59 | 129 | 108 | 118 | 11 | KDKVIYSKYTD | 85.92 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 11 | 19 | 9 | TNPFYASSG | 79.93 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 21 | 37 | 17 | SGKTYASVVAAAAAAAA | 74.9 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 118 | 125 | 8 | DDVSSLSP | 75.25 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 154 | 162 | 9 | GESKIENGS | 84.62 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 210 | 239 | 30 | SDNVIEEEGVELTDKGDVIVNSSPVESVHV | 83.71 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 256 | 278 | 23 | EELKINADAETLEVANKFDQIGD | 83.36 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 288 | 308 | 21 | SDKAIEEVEEKFTSESDSIAD | 81.27 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 324 | 330 | 7 | VVAAESG | 73.91 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 344 | 361 | 18 | KGMTYAEVIKAASAVADN | 77.63 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 392 | 403 | 12 | DSSAIEAVNVDV | 76.51 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 414 | 427 | 14 | VEVSEVLETDGNIP | 81.77 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 442 | 449 | 8 | GEVELESD | 74.96 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 475 | 484 | 10 | VDADINVAEP | 75.72 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 493 | 500 | 8 | KEAVIKED | 79.93 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 506 | 515 | 10 | VDKTISNIEE | 91 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 519 | 536 | 18 | LTAAYDGNFELAVKEISE | 82.66 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 549 | 556 | 8 | VEVEELPV | 77.26 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 575 | 581 | 7 | AESQFEV | 79.93 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 636 | 656 | 21 | TEEMIFGSSEAAKQFLAELEK | 80.24 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 666 | 675 | 10 | DEANISNNMS | 78.8 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 678 | 686 | 9 | IDGQIVTDS | 76.44 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 727 | 705 | 713 | 9 | ALAALLKAA | 75.88 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 163 | 374 | 210 | 239 | 30 | SDNVIEEEGVELTDKGDVIVNSSPVESVHV | 83.71 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 163 | 374 | 256 | 278 | 23 | EELKINADAETLEVANKFDQIGD | 83.36 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 163 | 374 | 288 | 308 | 21 | SDKAIEEVEEKFTSESDSIAD | 81.27 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 163 | 374 | 324 | 330 | 7 | VVAAESG | 73.91 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 163 | 374 | 344 | 361 | 18 | KGMTYAEVIKAASAVADN | 77.63 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 408 | 627 | 414 | 427 | 14 | VEVSEVLETDGNIP | 81.77 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 408 | 627 | 442 | 449 | 8 | GEVELESD | 74.96 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 408 | 627 | 475 | 484 | 10 | VDADINVAEP | 75.72 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 408 | 627 | 493 | 500 | 8 | KEAVIKED | 79.93 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 408 | 627 | 506 | 515 | 10 | VDKTISNIEE | 91 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 408 | 627 | 519 | 536 | 18 | LTAAYDGNFELAVKEISE | 82.66 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 408 | 627 | 549 | 556 | 8 | VEVEELPV | 77.26 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 408 | 627 | 575 | 581 | 7 | AESQFEV | 79.93 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 639 | 839 | 646 | 656 | 11 | AAKQFLAELEK | 79.14 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 639 | 839 | 666 | 675 | 10 | DEANISNNMS | 78.8 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 639 | 839 | 678 | 686 | 9 | IDGQIVTDS | 76.44 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 639 | 839 | 705 | 713 | 9 | ALAALLKAA | 75.88 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 639 | 839 | 720 | 729 | 10 | EGGNFTITSQ | 81.24 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 639 | 839 | 731 | 738 | 8 | GTKLFSMD | 82.27 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 639 | 839 | 759 | 783 | 25 | NRSNIFSNSNVTMADETEINLSEEE | 81.74 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 639 | 839 | 790 | 825 | 36 | LQSLRVKFLRLLQRLGHSAEDSIAAQVLYRLALLAG | 78.37 |
| DP00609 | O81283 | Translocase of chloroplast 159; chloroplastic (AtToc159) (EC 3.6.5.-) (159 kDa chloroplast outer envelope protein) (Plastid protein import 2) (Translocase of chloroplast 160; chloroplastic) (AtToc160) (Translocase of chloroplast 86; chloroplastic) (AtToc86) | Arabidopsis thaliana (Mouse-ear cress) | 639 | 839 | 828 | 834 | 7 | AGQLFSL | 80.36 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 3 | 12 | 10 | DGTEFVVRSD | 75.25 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 44 | 56 | 13 | EDEVFEEAIGSEN | 78.06 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 66 | 73 | 8 | KRELFESD | 76.92 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 76 | 82 | 7 | PLVETLK | 73.91 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 91 | 97 | 7 | EDFEEAV | 75.92 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 100 | 108 | 9 | LDETSSNEG | 75.25 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 111 | 119 | 9 | KDFTAVGES | 74.58 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 123 | 134 | 12 | GEAEFDVLATKM | 79.93 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 160 | 182 | 23 | TENATSTNTNGSNLAAEHVGIEN | 78.03 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 186 | 194 | 9 | HSFLGNGIA | 74.8 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 217 | 227 | 11 | NDGIEVDNWEE | 80.12 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 231 | 252 | 22 | GIQTEQEVEEGEGTTENQFEKR | 78.96 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 264 | 272 | 9 | SKNLFEKQT | 80.27 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 284 | 291 | 8 | KDLFENGS | 80.27 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 306 | 320 | 15 | TGAAYTSNIVTNASG | 83.9 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 322 | 331 | 10 | NEVSSAVTSS | 79.06 |
| DP00610 | Q9SLF3 | Translocase of chloroplast 132; chloroplastic (AtToc132) (EC 3.6.5.-) (132 kDa chloroplast outer envelope protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 455 | 368 | 375 | 8 | TEVHSNSG | 80.27 |
| DP00611 | P30291 | Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) | Homo sapiens (Human) | 1 | 292 | 22 | 29 | 8 | RQKLIFSP | 87.29 |
| DP00611 | P30291 | Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) | Homo sapiens (Human) | 1 | 292 | 51 | 59 | 9 | EDSAFQEPD | 86.96 |
| DP00611 | P30291 | Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) | Homo sapiens (Human) | 1 | 292 | 111 | 123 | 13 | GDSWEEEGFGSSS | 80.27 |
| DP00611 | P30291 | Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) | Homo sapiens (Human) | 1 | 292 | 129 | 140 | 12 | AAPYFLGSSFSP | 83.05 |
| DP00611 | P30291 | Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) | Homo sapiens (Human) | 1 | 292 | 231 | 239 | 9 | PQVNINPFT | 85.73 |
| DP00611 | P30291 | Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) | Homo sapiens (Human) | 1 | 292 | 242 | 248 | 7 | SLLLHSS | 75.63 |
| DP00611 | P30291 | Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) | Homo sapiens (Human) | 1 | 292 | 255 | 262 | 8 | KRTYWNDS | 78.76 |
| DP00613 | Q22472 | Resistance to inhibitors of cholinesterase protein 3 | Caenorhabditis elegans | 1 | 378 | 42 | 70 | 29 | LGLVFGVIVVCFAMLYPTLFHPMLMGFLG | 84.85 |
| DP00613 | Q22472 | Resistance to inhibitors of cholinesterase protein 3 | Caenorhabditis elegans | 1 | 378 | 113 | 119 | 7 | QAQAESQ | 76.21 |
| DP00613 | Q22472 | Resistance to inhibitors of cholinesterase protein 3 | Caenorhabditis elegans | 1 | 378 | 125 | 147 | 23 | GMFTWMLPVYTIGVVLFLLYTLF | 82.01 |
| DP00613 | Q22472 | Resistance to inhibitors of cholinesterase protein 3 | Caenorhabditis elegans | 1 | 378 | 157 | 165 | 9 | KKRNYFDSE | 83.5 |
| DP00613 | Q22472 | Resistance to inhibitors of cholinesterase protein 3 | Caenorhabditis elegans | 1 | 378 | 173 | 182 | 10 | SETKYGGKFG | 74.98 |
| DP00613 | Q22472 | Resistance to inhibitors of cholinesterase protein 3 | Caenorhabditis elegans | 1 | 378 | 199 | 210 | 12 | AMSKILEQLESV | 81.16 |
| DP00613 | Q22472 | Resistance to inhibitors of cholinesterase protein 3 | Caenorhabditis elegans | 1 | 378 | 226 | 232 | 7 | SEQLEED | 74.25 |
| DP00613 | Q22472 | Resistance to inhibitors of cholinesterase protein 3 | Caenorhabditis elegans | 1 | 378 | 238 | 267 | 30 | AVGLTETNEQYIKDLEVALKEFQSLSKEYD | 80.21 |
| DP00613 | Q22472 | Resistance to inhibitors of cholinesterase protein 3 | Caenorhabditis elegans | 1 | 378 | 294 | 305 | 12 | ELSEIEEEEEEV | 85.28 |
| DP00615 | Q9WMX2 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (isolate Con1) (HCV) | 2213 | 2308 | 2223 | 2235 | 13 | DADLIEANLLWRQ | 80.6 |
| DP00615 | Q9WMX2 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (isolate Con1) (HCV) | 2213 | 2308 | 2237 | 2258 | 22 | MGGNITRVESENKVVILDSFEP | 86.96 |
| DP00615 | Q9WMX2 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (isolate Con1) (HCV) | 2213 | 2308 | 2297 | 2303 | 7 | LLESWKD | 75.25 |
| DP00615 | Q9WMX2 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (isolate Con1) (HCV) | 2218 | 2314 | 2223 | 2235 | 13 | DADLIEANLLWRQ | 80.6 |
| DP00615 | Q9WMX2 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (isolate Con1) (HCV) | 2218 | 2314 | 2237 | 2258 | 22 | MGGNITRVESENKVVILDSFEP | 86.96 |
| DP00615 | Q9WMX2 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (isolate Con1) (HCV) | 2218 | 2314 | 2297 | 2303 | 7 | LLESWKD | 75.25 |
| DP00615 | Q9WMX2 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (isolate Con1) (HCV) | 2221 | 2314 | 2223 | 2235 | 13 | DADLIEANLLWRQ | 80.6 |
| DP00615 | Q9WMX2 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (isolate Con1) (HCV) | 2221 | 2314 | 2237 | 2258 | 22 | MGGNITRVESENKVVILDSFEP | 86.96 |
| DP00615 | Q9WMX2 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (isolate Con1) (HCV) | 2221 | 2314 | 2297 | 2303 | 7 | LLESWKD | 75.25 |
| DP00621 | P00736 | Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain | Homo sapiens (Human) | 193 | 305 | 194 | 211 | 18 | SSELYTEASGYISSLEYP | 77.31 |
| DP00621 | P00736 | Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain | Homo sapiens (Human) | 193 | 305 | 218 | 226 | 9 | LRCNYSIRV | 79.71 |
| DP00621 | P00736 | Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain | Homo sapiens (Human) | 193 | 305 | 232 | 243 | 12 | LHLKFLEPFDID | 77.26 |
| DP00621 | P00736 | Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain | Homo sapiens (Human) | 193 | 305 | 252 | 267 | 16 | YDQLQIYANGKNIGEF | 83.57 |
| DP00621 | P00736 | Complement C1r subcomponent (EC 3.4.21.41) (Complement component 1 subcomponent r) Cleaved into: Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain | Homo sapiens (Human) | 193 | 305 | 282 | 291 | 10 | AVDLLFFTDE | 80.1 |
| DP00623 | P83949 | Homeotic protein ultrabithorax | Drosophila melanogaster (Fruit fly) | 1 | 174 | 1 | 13 | 13 | MNSYFEQASGFYG | 82.66 |
| DP00623 | P83949 | Homeotic protein ultrabithorax | Drosophila melanogaster (Fruit fly) | 1 | 174 | 36 | 79 | 44 | AAAAYRGFPLSLGMSPYANHHLQRTTQDSPYDASITAACNKIYG | 80.65 |
| DP00623 | P83949 | Homeotic protein ultrabithorax | Drosophila melanogaster (Fruit fly) | 1 | 174 | 95 | 107 | 13 | DAVNGYKDIWNTG | 81.07 |
| DP00623 | P83949 | Homeotic protein ultrabithorax | Drosophila melanogaster (Fruit fly) | 1 | 174 | 137 | 148 | 12 | NAANANGQNNPA | 73.91 |
| DP00623 | P83949 | Homeotic protein ultrabithorax | Drosophila melanogaster (Fruit fly) | 235 | 286 | 235 | 246 | 12 | SNHTFYPWMAIA | 77.65 |
| DP00623 | P83949 | Homeotic protein ultrabithorax | Drosophila melanogaster (Fruit fly) | 235 | 286 | 264 | 281 | 18 | QYGGISTDMGKRYSESLA | 75.92 |
| DP00624 | P35638 | DNA damage-inducible transcript 3 protein (DDIT-3) (C/EBP zeta) (C/EBP-homologous protein) (CHOP) (C/EBP-homologous protein 10) (CHOP-10) (CCAAT/enhancer-binding protein homologous protein) (Growth arrest and DNA damage-inducible protein GADD153) | Homo sapiens (Human) | 116 | 168 | 132 | 147 | 16 | AQLAEENERLKQEIER | 74.87 |
| DP00625 | P45976 | Pre-mRNA polyadenylation factor FIP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 80 | 195 | 80 | 88 | 9 | DLEVIISLG | 78.67 |
| DP00625 | P45976 | Pre-mRNA polyadenylation factor FIP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 80 | 195 | 98 | 109 | 12 | LLDSYSTAATSS | 77.2 |
| DP00625 | P45976 | Pre-mRNA polyadenylation factor FIP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 80 | 195 | 111 | 136 | 26 | KDVISVATDVSNTITKTSDERLITEG | 82.81 |
| DP00625 | P45976 | Pre-mRNA polyadenylation factor FIP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 80 | 195 | 139 | 147 | 9 | NQGVTATTV | 75.81 |
| DP00625 | P45976 | Pre-mRNA polyadenylation factor FIP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 80 | 195 | 168 | 181 | 14 | KEGIFDSVGITTID | 82.27 |
| DP00626 | P0AG11 | "Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" | Escherichia coli (strain K12) | 1 | 139 | 8 | 27 | 20 | DLREIVTFPLFSDLVQCGFP | 82.54 |
| DP00626 | P0AG11 | "Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" | Escherichia coli (strain K12) | 1 | 139 | 31 | 80 | 50 | ADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITA | 83.16 |
| DP00626 | P0AG11 | "Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" | Escherichia coli (strain K12) | 1 | 139 | 83 | 96 | 14 | GDIVIAAVDGEFTV | 78.88 |
| DP00626 | P0AG11 | "Protein UmuD (EC 3.4.21.-) (DNA polymerase V) (Pol V) Cleaved into: Protein UmuD" | Escherichia coli (strain K12) | 1 | 139 | 104 | 134 | 31 | TVQLIPMNSAYSPITISSEDTLDVFGVVIHV | 81.51 |
| DP00628 | P15309 | "Prostatic acid phosphatase (PAP) (EC 3.1.3.2) (5-nucleotidase) (5-NT) (EC 3.1.3.5) (Acid phosphatase 3) (Ecto-5-nucleotidase) (Protein tyrosine phosphatase ACP3) (EC 3.1.3.48) (Thiamine monophosphatase) (TMPase) Cleaved into: PAPf39" | Homo sapiens (Human) | 248 | 286 | 260 | 271 | 12 | GGVLVNEILNHM | 78.76 |
| DP00629 | Q07097 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Sendai virus (strain Fushimi) (SeV) | 401 | 524 | 413 | 432 | 20 | GGGAIEVALDNADIDLETEA | 77.46 |
| DP00629 | Q07097 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Sendai virus (strain Fushimi) (SeV) | 401 | 524 | 454 | 462 | 9 | SGGHFVTLH | 80.01 |
| DP00629 | Q07097 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Sendai virus (strain Fushimi) (SeV) | 402 | 524 | 413 | 432 | 20 | GGGAIEVALDNADIDLETEA | 77.46 |
| DP00629 | Q07097 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Sendai virus (strain Fushimi) (SeV) | 402 | 524 | 454 | 462 | 9 | SGGHFVTLH | 80.01 |
| DP00630 | O76070 | Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR) | Homo sapiens (Human) | 1 | 127 | 6 | 12 | 7 | KGFSIAK | 87.29 |
| DP00630 | O76070 | Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR) | Homo sapiens (Human) | 1 | 127 | 24 | 40 | 17 | QGVTEAAEKTKEGVMYV | 80.27 |
| DP00630 | O76070 | Gamma-synuclein (Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR) | Homo sapiens (Human) | 1 | 127 | 47 | 93 | 47 | NVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSG | 79.06 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 284 | 67 | 76 | 10 | MTSPFNGLTS | 74.45 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 284 | 88 | 97 | 10 | KRTLFQFESH | 77.46 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 284 | 111 | 139 | 29 | RVNRILFPTQQNVDIDAAEEEEEGEVLLP | 79.23 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 284 | 147 | 155 | 9 | RQLHLSLER | 74.58 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 284 | 175 | 191 | 17 | SDKVITFELAKNWNNNS | 78.65 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 284 | 204 | 212 | 9 | EEDIIINPV | 95.13 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 284 | 225 | 231 | 7 | VTQEIRN | 80.03 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 284 | 244 | 254 | 11 | IEDVITYVNKK | 90.12 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 90 | 67 | 76 | 10 | MTSPFNGLTS | 74.45 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 31 | 190 | 67 | 76 | 10 | MTSPFNGLTS | 74.45 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 31 | 190 | 88 | 97 | 10 | KRTLFQFESH | 77.46 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 31 | 190 | 111 | 139 | 29 | RVNRILFPTQQNVDIDAAEEEEEGEVLLP | 79.23 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 31 | 190 | 147 | 155 | 9 | RQLHLSLER | 74.58 |
| DP00631 | P38634 | Protein SIC1 (CDK inhibitor p40) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 31 | 190 | 175 | 185 | 11 | SDKVITFELAK | 79.96 |
| DP00632 | Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | Homo sapiens (Human) | 1 | 264 | 4 | 11 | 8 | TDYSTYSQ | 89.88 |
| DP00632 | Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | Homo sapiens (Human) | 1 | 264 | 14 | 23 | 10 | AQQGYSAYTA | 81.97 |
| DP00632 | Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | Homo sapiens (Human) | 1 | 264 | 29 | 45 | 17 | YAQTTQAYGQQSYGTYG | 84.87 |
| DP00632 | Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | Homo sapiens (Human) | 1 | 264 | 48 | 72 | 25 | TDVSYTQAQTTATYGQTAYATSYGQ | 82.69 |
| DP00632 | Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | Homo sapiens (Human) | 1 | 264 | 82 | 88 | 7 | APQAYSQ | 87.29 |
| DP00632 | Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | Homo sapiens (Human) | 1 | 264 | 94 | 128 | 35 | GTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYG | 83.73 |
| DP00632 | Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | Homo sapiens (Human) | 1 | 264 | 166 | 174 | 9 | GQSNYSYPQ | 78.52 |
| DP00632 | Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | Homo sapiens (Human) | 1 | 264 | 203 | 233 | 31 | YDQSSYSQQNTYGQPSSYGQQSSYGQQSSYG | 83.55 |
| DP00632 | Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | Homo sapiens (Human) | 1 | 264 | 243 | 259 | 17 | QTGSYSQAPSQYSQQSS | 76.37 |
| DP00633 | Q09472 | Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) | Homo sapiens (Human) | 401 | 566 | 425 | 432 | 8 | NQQPILTG | 82.61 |
| DP00633 | Q09472 | Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) | Homo sapiens (Human) | 401 | 566 | 455 | 480 | 26 | TVSQIDPSSIERAYAALGLPYQVNQM | 80.74 |
| DP00633 | Q09472 | Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) | Homo sapiens (Human) | 401 | 566 | 533 | 541 | 9 | LHSAINSQN | 80.3 |
| DP00636 | P17120 | Kinesin-like protein bimC | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) | 1 | 71 | 44 | 50 | 7 | KTAAISR | 86.29 |
| DP00640 | Q89933 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) | 400 | 525 | 414 | 429 | 16 | QAQVSFLHGDQSENEL | 85.03 |
| DP00640 | Q89933 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) | 400 | 525 | 492 | 508 | 17 | ADALLRLQAMAGISEEQ | 75.76 |
| DP00640 | Q89933 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) | 400 | 525 | 514 | 520 | 7 | TPIVYND | 80.55 |
| DP00640 | Q89933 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) | 401 | 525 | 414 | 429 | 16 | QAQVSFLHGDQSENEL | 85.03 |
| DP00640 | Q89933 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) | 401 | 525 | 492 | 508 | 17 | ADALLRLQAMAGISEEQ | 75.76 |
| DP00640 | Q89933 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) | 401 | 525 | 514 | 520 | 7 | TPIVYND | 80.55 |
| DP00640 | Q89933 | Nucleoprotein (Nucleocapsid protein) (NP) (Protein N) | Measles virus (strain Edmonston B) (MeV) (Subacute sclerose panencephalitis virus) | 401 | 486 | 414 | 429 | 16 | QAQVSFLHGDQSENEL | 85.03 |
| DP00641 | P51671 | Eotaxin (C-C motif chemokine 11) (Eosinophil chemotactic protein) (Small-inducible cytokine A11) | Homo sapiens (Human) | 1 | 31 | 4 | 19 | 16 | SAALLWLLLIAAAFSP | 80.56 |
| DP00644 | P22362 | C-C motif chemokine 1 (Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309) | Homo sapiens (Human) | 1 | 23 | 1 | 18 | 18 | MQIITTALVCLLLAGMWP | 82.29 |
| DP00645 | Q91ZE9 | Bcl-2-modifying factor | Mus musculus (Mouse) | 1 | 185 | 5 | 19 | 15 | QCVEELEDDVFQSED | 75.25 |
| DP00645 | Q91ZE9 | Bcl-2-modifying factor | Mus musculus (Mouse) | 1 | 185 | 27 | 41 | 15 | GGLLSADLFAQSQLD | 76.21 |
| DP00645 | Q91ZE9 | Bcl-2-modifying factor | Mus musculus (Mouse) | 1 | 185 | 46 | 53 | 8 | RLQLFPLT | 87.29 |
| DP00645 | Q91ZE9 | Bcl-2-modifying factor | Mus musculus (Mouse) | 1 | 185 | 69 | 75 | 7 | ATQTLSP | 79.26 |
| DP00645 | Q91ZE9 | Bcl-2-modifying factor | Mus musculus (Mouse) | 1 | 185 | 92 | 104 | 13 | PQRLFYGNAGYRL | 80.42 |
| DP00645 | Q91ZE9 | Bcl-2-modifying factor | Mus musculus (Mouse) | 1 | 185 | 123 | 135 | 13 | GQFLQHRAEVQIA | 83.33 |
| DP00645 | Q91ZE9 | Bcl-2-modifying factor | Mus musculus (Mouse) | 1 | 185 | 137 | 148 | 12 | KLQCIADQFHRL | 75.61 |
| DP00645 | Q91ZE9 | Bcl-2-modifying factor | Mus musculus (Mouse) | 1 | 185 | 153 | 176 | 24 | HQQNRDRAWWQVFLFLQNLALNRQ | 80.48 |
| DP00646 | Q01231 | Gap junction alpha-5 protein (Connexin-40) (Cx40) | Mus musculus (Mouse) | 251 | 355 | 275 | 287 | 13 | SGEKFFSDFSNNM | 77.95 |
| DP00646 | Q01231 | Gap junction alpha-5 protein (Connexin-40) (Cx40) | Mus musculus (Mouse) | 251 | 355 | 303 | 329 | 27 | NQEQIPGEGFIHMHYSQKPEYASGASA | 79.39 |
| DP00654 | Q9ZPI5 | Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 (AtMPF2) Includes: Enoyl-CoA hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase (EC 4.2.1.17) (EC 5.1.2.3) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) | Arabidopsis thaliana (Mouse-ear cress) | 576 | 596 | 582 | 590 | 9 | RKGFYLYDD | 94.83 |
| DP00655 | P59113 | Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1) | Mus musculus (Mouse) | 141 | 250 | 160 | 174 | 15 | VIEDILNLESSSTSS | 79.15 |
| DP00655 | P59113 | Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1) | Mus musculus (Mouse) | 141 | 250 | 179 | 195 | 17 | SPGLYSKTMTPTYDPIN | 76.02 |
| DP00655 | P59113 | Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1) | Mus musculus (Mouse) | 141 | 250 | 199 | 208 | 10 | ALSTMTWFGD | 82.68 |
| DP00655 | P59113 | Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1) | Mus musculus (Mouse) | 141 | 250 | 215 | 222 | 8 | NCSVLAFS | 80.14 |
| DP00655 | P59113 | Fermitin family homolog 1 (Kindlin-1) (Unc-112-related protein 1) | Mus musculus (Mouse) | 653 | 677 | 658 | 672 | 15 | KDQNETLDEDLFHKL | 76.01 |
| DP00656 | P07674 | Transcriptional repressor protein KorB | Escherichia coli | 1 | 64 | 30 | 42 | 13 | GLDSIGDLSSLLD | 75.3 |
| DP00656 | P07674 | Transcriptional repressor protein KorB | Escherichia coli | 252 | 294 | 259 | 266 | 8 | TVDAFNGQ | 84.62 |
| DP00657 | P31168 | Dehydrin COR47 (Cold-induced COR47 protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 265 | 1 | 7 | 7 | MAEEYKN | 76.06 |
| DP00657 | P31168 | Dehydrin COR47 (Cold-induced COR47 protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 265 | 31 | 40 | 10 | DRGLFDFLGK | 84.82 |
| DP00657 | P31168 | Dehydrin COR47 (Cold-induced COR47 protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 265 | 60 | 66 | 7 | KAQISEP | 79.93 |
| DP00657 | P31168 | Dehydrin COR47 (Cold-induced COR47 protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 265 | 73 | 91 | 19 | EEVKENKITLLEELQEKTE | 76.71 |
| DP00657 | P31168 | Dehydrin COR47 (Cold-induced COR47 protein) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 265 | 97 | 110 | 14 | KPSVIEKLHRSNSS | 73.91 |
| DP00658 | P42758 | Dehydrin Xero 2 (Low-temperature-induced protein LTI30) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 193 | 87 | 98 | 12 | GTNTTYGTTNTG | 79.49 |
| DP00658 | P42758 | Dehydrin Xero 2 (Low-temperature-induced protein LTI30) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 193 | 126 | 140 | 15 | TNTAYGTNTNVVHHE | 79.93 |
| DP00658 | P42758 | Dehydrin Xero 2 (Low-temperature-induced protein LTI30) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 193 | 163 | 185 | 23 | TTTSYGNTGVVHHENKSTMDKIK | 74.49 |
| DP00659 | P16458 | Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit) | Sterkiella nova (Ciliate) (Oxytricha nova) | 233 | 385 | 275 | 283 | 9 | SVDKIVKYT | 89.97 |
| DP00659 | P16458 | Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit) | Sterkiella nova (Ciliate) (Oxytricha nova) | 233 | 385 | 333 | 345 | 13 | TMAQFVKYLDWHE | 84.54 |
| DP00659 | P16458 | Telomere-binding protein subunit beta (TEBP beta) (Telomere-binding protein 41 kDa subunit) | Sterkiella nova (Ciliate) (Oxytricha nova) | 233 | 385 | 366 | 372 | 7 | KASATSG | 75.92 |
| DP00661 | Q9CX60 | Protein LBH (Limb bud and heart-expressed protein) | Mus musculus (Mouse) | 1 | 105 | 1 | 15 | 15 | MSVYFPIHCSDYLRS | 79.82 |
| DP00661 | Q9CX60 | Protein LBH (Limb bud and heart-expressed protein) | Mus musculus (Mouse) | 1 | 105 | 27 | 34 | 8 | SMEEIGLS | 79.93 |
| DP00661 | Q9CX60 | Protein LBH (Limb bud and heart-expressed protein) | Mus musculus (Mouse) | 1 | 105 | 37 | 47 | 11 | KDGLSYQIFPD | 86.87 |
| DP00661 | Q9CX60 | Protein LBH (Limb bud and heart-expressed protein) | Mus musculus (Mouse) | 1 | 105 | 71 | 81 | 11 | GEVESGELRWP | 76.25 |
| DP00662 | Q8LBP4 | Inner membrane protein ALBINO3; chloroplastic | Arabidopsis thaliana (Mouse-ear cress) | 339 | 462 | 341 | 354 | 14 | NNVLSTAQQVYLRK | 83.44 |
| DP00662 | Q8LBP4 | Inner membrane protein ALBINO3; chloroplastic | Arabidopsis thaliana (Mouse-ear cress) | 339 | 462 | 365 | 372 | 8 | NASKIISA | 85.54 |
| DP00662 | Q8LBP4 | Inner membrane protein ALBINO3; chloroplastic | Arabidopsis thaliana (Mouse-ear cress) | 339 | 462 | 408 | 421 | 14 | DTVELVEESQSESE | 76.21 |
| DP00662 | Q8LBP4 | Inner membrane protein ALBINO3; chloroplastic | Arabidopsis thaliana (Mouse-ear cress) | 339 | 462 | 434 | 442 | 9 | GALASSTTS | 76.14 |
| DP00663 | P81558 | Myelin basic protein (MBP) | Sus scrofa (Pig) | 1 | 171 | 10 | 22 | 13 | HGSKYLASASTMD | 78.31 |
| DP00663 | P81558 | Myelin basic protein (MBP) | Sus scrofa (Pig) | 1 | 171 | 39 | 46 | 8 | SLGRFFGA | 79.01 |
| DP00663 | P81558 | Myelin basic protein (MBP) | Sus scrofa (Pig) | 1 | 171 | 85 | 94 | 10 | PVVHFFKNIV | 86.76 |
| DP00663 | P81558 | Myelin basic protein (MBP) | Sus scrofa (Pig) | 1 | 171 | 108 | 118 | 11 | GLSLSRFSWGA | 76.28 |
| DP00663 | P81558 | Myelin basic protein (MBP) | Sus scrofa (Pig) | 1 | 171 | 147 | 158 | 12 | AQGTLSKIFKLG | 79.68 |
| DP00664 | Q01417 | 18 kDa seed maturation protein | Glycine max (Soybean) (Glycine hispida) | 1 | 173 | 7 | 24 | 18 | AGESIKETATNIGASAKA | 78.71 |
| DP00664 | Q01417 | 18 kDa seed maturation protein | Glycine max (Soybean) (Glycine hispida) | 1 | 173 | 77 | 83 | 7 | KQSATTA | 79.93 |
| DP00664 | Q01417 | 18 kDa seed maturation protein | Glycine max (Soybean) (Glycine hispida) | 1 | 173 | 98 | 109 | 12 | GTATYSTTGEYG | 78.62 |
| DP00666 | P32004 | Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171) | Homo sapiens (Human) | 1144 | 1257 | 1147 | 1153 | 7 | KGGKYSV | 78.26 |
| DP00666 | P32004 | Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171) | Homo sapiens (Human) | 1144 | 1257 | 1169 | 1181 | 13 | KDETFGEYRSLES | 85.7 |
| DP00666 | P32004 | Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171) | Homo sapiens (Human) | 1144 | 1257 | 1215 | 1231 | 17 | VDVQFNEDGSFIGQYSG | 82.06 |
| DP00667 | P42763 | Dehydrin ERD14 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 185 | 1 | 7 | 7 | MAEEIKN | 75.25 |
| DP00667 | P42763 | Dehydrin ERD14 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 185 | 27 | 36 | 10 | DRGLFDFLGK | 84.82 |
| DP00667 | P42763 | Dehydrin ERD14 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 185 | 48 | 60 | 13 | IASEFEQKVHISE | 86.13 |
| DP00669 | P81019 | Seminal plasma protein BSP-30 kDa (BSP-30K) | Bos taurus (Bovine) | 26 | 96 | 52 | 66 | 15 | PPEIYTTTFLPRTIY | 76.79 |
| DP00672 | Q92886 | Neurogenin-1 (NGN-1) (Class A basic helix-loop-helix protein 6) (bHLHa6) (Neurogenic basic-helix-loop-helix protein) (Neurogenic differentiation factor 3) (NeuroD3) | Homo sapiens (Human) | 90 | 150 | 127 | 145 | 19 | KLTKIETLRFAYNYIWALA | 83.51 |
| DP00673 | P06935 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (WNV) | 1 | 24 | 12 | 18 | 7 | RAVNMLK | 77.26 |
| DP00673 | P06935 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (WNV) | 2 | 105 | 12 | 18 | 7 | RAVNMLK | 77.26 |
| DP00673 | P06935 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (WNV) | 2 | 105 | 24 | 30 | 7 | GLSLIGL | 95.32 |
| DP00673 | P06935 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (WNV) | 2 | 105 | 45 | 60 | 16 | RFVLALLAFFRFTAIA | 84.64 |
| DP00673 | P06935 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (WNV) | 2 | 105 | 79 | 85 | 7 | KHLLSFK | 80.27 |
| DP00673 | P06935 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (WNV) | 2 | 105 | 89 | 96 | 8 | GTLTSAIN | 87.88 |
| DP00673 | P06935 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (WNV) | 76 | 105 | 79 | 85 | 7 | KHLLSFK | 80.27 |
| DP00673 | P06935 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (WNV) | 76 | 105 | 89 | 96 | 8 | GTLTSAIN | 87.88 |
| DP00673 | P06935 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (WNV) | 80 | 105 | 89 | 96 | 8 | GTLTSAIN | 87.88 |
| DP00674 | Q69422 | Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) | Hepatitis GB virus B (GBV-B) (GB virus B) | 2 | 155 | 21 | 34 | 14 | QTQASYPVSIKTSV | 78.19 |
| DP00674 | Q69422 | Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) | Hepatitis GB virus B (GBV-B) (GB virus B) | 2 | 155 | 51 | 71 | 21 | RNYKIAGIHDGLQTLAQAALP | 79.07 |
| DP00674 | Q69422 | Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) | Hepatitis GB virus B (GBV-B) (GB virus B) | 2 | 155 | 86 | 104 | 19 | NLGILLDYPLGWIGDVTTH | 78.56 |
| DP00674 | Q69422 | Genome polyprotein Cleaved into: Core protein; Envelope glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; p6; Viroporin p7; Protease NS2 (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) | Hepatitis GB virus B (GBV-B) (GB virus B) | 2 | 155 | 119 | 150 | 32 | PVCQIVRLLEDGVNWATGWFGVHLFVVCLLSL | 79.95 |
| DP00675 | P19711 | Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) | Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) | 169 | 270 | 208 | 221 | 14 | PDATIVVEGVKYQV | 83.44 |
| DP00675 | P19711 | Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) | Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) | 169 | 270 | 233 | 241 | 9 | QDGLYHNKN | 86.96 |
| DP00675 | P19711 | Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) | Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) | 169 | 270 | 253 | 265 | 13 | ALLAWAIIAIVLF | 87.39 |
| DP00675 | P19711 | Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) | Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) | 170 | 260 | 208 | 221 | 14 | PDATIVVEGVKYQV | 83.44 |
| DP00675 | P19711 | Genome polyprotein Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3; Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) | Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) | 170 | 260 | 233 | 241 | 9 | QDGLYHNKN | 86.96 |
| DP00677 | P12810 | 16.9 kDa class I heat shock protein 1 (HSP 16.9) (Heat shock protein 16.9A) (Heat shock protein 17) (Low molecular weight heat shock protein) | Triticum aestivum (Wheat) | 1 | 42 | 6 | 19 | 14 | RSNVFDPFADLWAD | 76.97 |
| DP00677 | P12810 | 16.9 kDa class I heat shock protein 1 (HSP 16.9) (Heat shock protein 16.9A) (Heat shock protein 17) (Low molecular weight heat shock protein) | Triticum aestivum (Wheat) | 1 | 42 | 23 | 32 | 10 | TFRSIVPAIS | 81.07 |
| DP00678 | P11171 | Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1) | Homo sapiens (Human) | 800 | 864 | 800 | 807 | 8 | TTQITKTV | 75.92 |
| DP00678 | P11171 | Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1) | Homo sapiens (Human) | 800 | 864 | 818 | 841 | 24 | KRIVITGDADIDHDQVLVQAIKEA | 82.65 |
| DP00683 | Q99801 | Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) | Homo sapiens (Human) | 1 | 184 | 26 | 37 | 12 | LTSFLIQDILRD | 82.83 |
| DP00683 | Q99801 | Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) | Homo sapiens (Human) | 1 | 184 | 73 | 79 | 7 | NDQLSTG | 81.27 |
| DP00683 | Q99801 | Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) | Homo sapiens (Human) | 1 | 184 | 86 | 94 | 9 | EAETLAETE | 74.25 |
| DP00683 | Q99801 | Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) | Homo sapiens (Human) | 1 | 184 | 98 | 111 | 14 | HLGSYLLDSENTSG | 78.12 |
| DP00683 | Q99801 | Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) | Homo sapiens (Human) | 1 | 184 | 127 | 151 | 25 | SRAAFSHTQVIELERKFSHQKYLSA | 78.53 |
| DP00683 | Q99801 | Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A) | Homo sapiens (Human) | 1 | 184 | 166 | 176 | 11 | TQVKIWFQNRR | 85.95 |
| DP00689 | P30185 | Dehydrin Rab18 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 186 | 9 | 29 | 21 | GGQATDEYGNPIQQQYDEYGN | 76.7 |
| DP00689 | P30185 | Dehydrin Rab18 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 186 | 46 | 73 | 28 | GGQGYGTGGQGYGSGGQGYGTGGQGYGT | 75.25 |
| DP00693 | P45561 | Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP) | Sus scrofa (Pig) | 2 | 173 | 2 | 16 | 15 | GTWILFACLLGAAFS | 79.75 |
| DP00693 | P45561 | Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP) | Sus scrofa (Pig) | 2 | 173 | 25 | 47 | 23 | HPGYINFSYEVLTPLKWYQNMIR | 83.36 |
| DP00693 | P45561 | Amelogenin (Amelogenin 173A/173B) (Leucine-rich amelogenin peptide) (LRAP) | Sus scrofa (Pig) | 2 | 173 | 63 | 72 | 10 | HHQIIPVVSQ | 75.85 |
| DP00694 | Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | Homo sapiens (Human) | 1 | 228 | 20 | 45 | 26 | ADEGFWDCSVCTFRNSAEAFKCSICD | 77.48 |
| DP00694 | Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | Homo sapiens (Human) | 1 | 228 | 60 | 70 | 11 | QLVAQQVAQQY | 77.29 |
| DP00694 | Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | Homo sapiens (Human) | 1 | 228 | 124 | 144 | 21 | EANSIQSANATTKTSETNHTS | 77.35 |
| DP00694 | Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | Homo sapiens (Human) | 1 | 228 | 156 | 176 | 21 | AQQLAVTVGNVTVIITDFKEK | 80.12 |
| DP00694 | Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | Homo sapiens (Human) | 1 | 228 | 194 | 202 | 9 | EQQNQSSSG | 73.58 |
| DP00694 | Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | Homo sapiens (Human) | 145 | 179 | 156 | 174 | 19 | AQQLAVTVGNVTVIITDFK | 80.04 |
| DP00697 | Q9IK92 | Nucleoprotein (Protein N) (Nucleocapsid protein) | Nipah virus | 400 | 532 | 418 | 430 | 13 | GGVLIGGSDQDID | 86.91 |
| DP00697 | Q9IK92 | Nucleoprotein (Protein N) (Nucleocapsid protein) | Nipah virus | 400 | 532 | 441 | 459 | 19 | RQSVTFKREMSISSLANSV | 80.16 |
| DP00697 | Q9IK92 | Nucleoprotein (Protein N) (Nucleocapsid protein) | Nipah virus | 400 | 532 | 469 | 481 | 13 | GTRLTNSLLNLRS | 75.56 |
| DP00697 | Q9IK92 | Nucleoprotein (Protein N) (Nucleocapsid protein) | Nipah virus | 400 | 532 | 498 | 511 | 14 | DDPAISNRTQGESE | 75.78 |
| DP00698 | O89339 | Nucleoprotein (Protein N) (Nucleocapsid protein) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 400 | 532 | 425 | 437 | 13 | GEQDIDEEEEPIE | 77.26 |
| DP00698 | O89339 | Nucleoprotein (Protein N) (Nucleocapsid protein) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 400 | 532 | 441 | 447 | 7 | RQSVTFK | 85.05 |
| DP00698 | O89339 | Nucleoprotein (Protein N) (Nucleocapsid protein) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 400 | 532 | 469 | 481 | 13 | GTRLTNSLLNLRS | 75.56 |
| DP00698 | O89339 | Nucleoprotein (Protein N) (Nucleocapsid protein) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 400 | 532 | 484 | 498 | 15 | AAKAIKESTAQSSSE | 77.53 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 9 | 39 | 31 | DGLNIIDFIQKNQKEIQKTYGRSSIQQPSIK | 79.91 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 46 | 59 | 14 | EDFLQCTSGESEQV | 75.78 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 112 | 118 | 7 | TDVVYHD | 79.07 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 125 | 131 | 7 | GYGFTSS | 79.41 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 135 | 153 | 19 | GWSDYTSGANNGNVCLVSD | 74.67 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 155 | 169 | 15 | KMLSYAPEIAVSKED | 80.25 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 173 | 185 | 13 | DLVHLENKLSTTG | 74.79 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 189 | 200 | 12 | TAVPFTLRNLSD | 76.56 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 208 | 220 | 13 | IAEHYYGLGVKEQ | 90.66 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 228 | 241 | 14 | RNVNLDSIKLYTSD | 76.92 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 245 | 267 | 23 | ADQLEFEDEFAGSSSEVIVGISP | 81.85 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 283 | 304 | 22 | IGRTIEGQSIRDNLQAKDNKST | 75.49 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 328 | 335 | 8 | LAEEFECS | 77.26 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 338 | 355 | 18 | EDPIIRELLKENSLINCQ | 81.94 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 364 | 373 | 10 | YHWSIERSIS | 80.47 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 406 | 378 | 388 | 11 | EIVNGAVQTAD | 76.89 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 100 | 9 | 39 | 31 | DGLNIIDFIQKNQKEIQKTYGRSSIQQPSIK | 79.91 |
| DP00699 | Q9IK91 | Phosphoprotein (Protein P) | Nipah virus | 1 | 100 | 46 | 59 | 14 | EDFLQCTSGESEQV | 75.78 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 10 | 34 | 25 | GLDIIDFIQKNQKEIQKTYGRSSIQ | 78.74 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 46 | 54 | 9 | EDFLQSTSG | 75.88 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 79 | 101 | 23 | SSVTSSDGTIGQRVSNTRAWAED | 78.19 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 112 | 118 | 7 | TDVVYHD | 79.07 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 134 | 140 | 7 | RGWSYHM | 79.93 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 168 | 184 | 17 | EVREIDLIGLEDKFASA | 76.92 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 207 | 215 | 9 | VIPEYYYGS | 86.36 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 228 | 241 | 14 | GNVNLDSIKIYTSD | 80.67 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 245 | 265 | 21 | ENQLEYEDEFAKSSSEVVIDT | 83.53 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 327 | 335 | 9 | MLSEEFECS | 79.34 |
| DP00700 | O55778 | Phosphoprotein (Protein P) | Hendra virus (isolate Horse/Autralia/Hendra/1994) | 1 | 404 | 338 | 347 | 10 | DDPIIQELER | 75.82 |
| DP00702 | P46937 | Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog) | Homo sapiens (Human) | 50 | 171 | 50 | 57 | 8 | AGHQIVHV | 75.59 |
| DP00702 | P46937 | Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog) | Homo sapiens (Human) | 50 | 171 | 59 | 73 | 15 | GDSETDLEALFNAVM | 78.13 |
| DP00705 | P22943 | 12 kDa heat shock protein (Glucose and lipid-regulated protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 109 | 21 | 35 | 15 | SQKSYAEQGKEYITD | 80.22 |
| DP00705 | P22943 | 12 kDa heat shock protein (Glucose and lipid-regulated protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 109 | 49 | 55 | 7 | NKGVFQG | 74.25 |
| DP00705 | P22943 | 12 kDa heat shock protein (Glucose and lipid-regulated protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 109 | 69 | 82 | 14 | GQGESLADQARDYM | 74.25 |
| DP00705 | P22943 | 12 kDa heat shock protein (Glucose and lipid-regulated protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 109 | 91 | 98 | 8 | DAVEYVSG | 77.3 |
| DP00706 | Q15517 | Corneodesmosin (S protein) | Homo sapiens (Human) | 60 | 171 | 64 | 70 | 7 | GFSSYSG | 92.64 |
| DP00706 | Q15517 | Corneodesmosin (S protein) | Homo sapiens (Human) | 60 | 171 | 74 | 80 | 7 | SGSSISS | 76.78 |
| DP00706 | Q15517 | Corneodesmosin (S protein) | Homo sapiens (Human) | 60 | 171 | 109 | 119 | 11 | GTGYSQVSYSS | 79.6 |
| DP00706 | Q15517 | Corneodesmosin (S protein) | Homo sapiens (Human) | 60 | 171 | 157 | 166 | 10 | SSSSFQFSSS | 77.39 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 161 | 243 | 170 | 176 | 7 | NAENTAS | 81.61 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 161 | 243 | 191 | 203 | 13 | LEQLLALYVAEIR | 81.73 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 161 | 243 | 218 | 228 | 11 | PDSAYLQEARL | 84.62 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 347 | 420 | 372 | 383 | 12 | LDEVISKYAMLQ | 89.72 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 347 | 420 | 398 | 406 | 9 | LQGTSSHSA | 75.25 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 495 | 740 | 498 | 509 | 12 | SSLQISNEKNLE | 77.26 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 495 | 740 | 539 | 550 | 12 | APSSIDAESNGE | 75.14 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 495 | 740 | 563 | 575 | 13 | VSQLFELEIEALP | 79.6 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 495 | 740 | 598 | 614 | 17 | TTVLENGAGMVSSTSFN | 79.58 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 495 | 740 | 644 | 652 | 9 | LGNSYVERQ | 86.96 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 495 | 740 | 692 | 702 | 11 | GLVTSSLCIPS | 85.62 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 566 | 739 | 566 | 575 | 10 | LFELEIEALP | 78.56 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 566 | 739 | 598 | 614 | 17 | TTVLENGAGMVSSTSFN | 79.58 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 566 | 739 | 644 | 652 | 9 | LGNSYVERQ | 86.96 |
| DP00707 | Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | Homo sapiens (Human) | 566 | 739 | 692 | 702 | 11 | GLVTSSLCIPS | 85.62 |
| DP00708 | O35613 | Death domain-associated protein 6 (Daxx) | Mus musculus (Mouse) | 566 | 739 | 570 | 578 | 9 | SQLAELEME | 79.34 |
| DP00708 | O35613 | Death domain-associated protein 6 (Daxx) | Mus musculus (Mouse) | 566 | 739 | 596 | 613 | 18 | SLPTILENGAAVVTSTSV | 77.93 |
| DP00708 | O35613 | Death domain-associated protein 6 (Daxx) | Mus musculus (Mouse) | 566 | 739 | 643 | 650 | 8 | LLGNSYIK | 86.37 |
| DP00708 | O35613 | Death domain-associated protein 6 (Daxx) | Mus musculus (Mouse) | 566 | 739 | 658 | 664 | 7 | SGQNTSV | 80.22 |
| DP00708 | O35613 | Death domain-associated protein 6 (Daxx) | Mus musculus (Mouse) | 566 | 739 | 673 | 684 | 12 | ASVASVADSSTR | 80.6 |
| DP00708 | O35613 | Death domain-associated protein 6 (Daxx) | Mus musculus (Mouse) | 566 | 739 | 690 | 698 | 9 | HELVTSSLC | 79.34 |
| DP00708 | O35613 | Death domain-associated protein 6 (Daxx) | Mus musculus (Mouse) | 566 | 739 | 711 | 726 | 16 | AQSLRQCIYKTSVATQ | 82.63 |
| DP00709 | Q9Y3M2 | Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1) | Homo sapiens (Human) | 1 | 63 | 3 | 9 | 7 | FFGNTFS | 86.34 |
| DP00709 | Q9Y3M2 | Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1) | Homo sapiens (Human) | 1 | 63 | 18 | 27 | 10 | SASLSNLHSL | 80.6 |
| DP00709 | Q9Y3M2 | Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1) | Homo sapiens (Human) | 1 | 63 | 35 | 42 | 8 | ELGLEYGS | 84.16 |
| DP00709 | Q9Y3M2 | Protein chibby homolog 1 (ARPP-binding protein) (Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor; Golgi and endoplasmic reticulum-associated 1) | Homo sapiens (Human) | 1 | 63 | 49 | 58 | 10 | GQSLKFENGQ | 81.47 |
| DP00716 | P02545 | Prelamin-A/C Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32) | Homo sapiens (Human) | 567 | 664 | 575 | 583 | 9 | DPAEYNLRS | 77.33 |
| DP00716 | P02545 | Prelamin-A/C Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32) | Homo sapiens (Human) | 567 | 664 | 617 | 627 | 11 | ASSVTVTRSYR | 74.25 |
| DP00716 | P02545 | Prelamin-A/C Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32) | Homo sapiens (Human) | 567 | 664 | 633 | 652 | 20 | GGGSFGDNLVTRSYLLGNSS | 75.69 |
| DP00717 | P35521 | Methylosome subunit pICln (Chloride channel; nucleotide sensitive 1A) (Chloride conductance regulatory protein ICln) (I(Cln)) | Canis lupus familiaris (Dog) (Canis familiaris) | 93 | 115 | 103 | 110 | 8 | DVEPIAEF | 80.31 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 9 | 111 | 14 | 31 | 18 | SDSFTDTLSANISQEMTM | 76.77 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 9 | 111 | 41 | 55 | 15 | TNFGISSVDLSVMED | 82.45 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 9 | 111 | 63 | 84 | 22 | KPFTTVDFSSISTPHYEDIPFT | 75.68 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 9 | 111 | 91 | 106 | 16 | ADYKYDLKLQEYQSAI | 85.64 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 112 | 174 | 119 | 125 | 7 | KTQLYNK | 96.99 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 112 | 174 | 133 | 139 | 7 | SLMAIEC | 75.2 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 112 | 174 | 147 | 153 | 7 | SGFHYGV | 87.29 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 238 | 278 | 243 | 255 | 13 | AKHLYDSYIKSFP | 78.85 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 238 | 278 | 260 | 267 | 8 | KARAILTG | 75.84 |
| DP00718 | P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | Homo sapiens (Human) | 453 | 477 | 456 | 472 | 17 | SSQLFAKLLQKMTDLRQ | 78.18 |
| DP00719 | Q13569 | G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) | Homo sapiens (Human) | 1 | 50 | 5 | 29 | 25 | NAGSYSLQQAQAFYTFPFQQLMAEA | 82.78 |
| DP00719 | Q13569 | G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) | Homo sapiens (Human) | 51 | 111 | 94 | 103 | 10 | KQEKITDTFK | 87.29 |
| DP00719 | Q13569 | G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) | Homo sapiens (Human) | 340 | 410 | 360 | 369 | 10 | SNGLIESVEL | 79.97 |
| DP00719 | Q13569 | G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) | Homo sapiens (Human) | 340 | 410 | 371 | 399 | 29 | GESAFSGIPNGQWMTQSFTDQIPSFSNHC | 79.77 |
| DP00720 | Q05344 | FACT complex subunit Ssrp1 (Chorion-factor 5) (Facilitates chromatin transcription complex subunit Ssrp1) (Recombination signal sequence recognition protein) (Single-strand recognition protein) (dSSRP1) | Drosophila melanogaster (Fruit fly) | 437 | 518 | 488 | 501 | 14 | SDVAEEYDSNVESD | 86.86 |
| DP00720 | Q05344 | FACT complex subunit Ssrp1 (Chorion-factor 5) (Facilitates chromatin transcription complex subunit Ssrp1) (Recombination signal sequence recognition protein) (Single-strand recognition protein) (dSSRP1) | Drosophila melanogaster (Fruit fly) | 625 | 723 | 659 | 665 | 7 | SKEYISD | 78.4 |
| DP00721 | Q8IRG6 | FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16) | Drosophila melanogaster (Fruit fly) | 889 | 1044 | 889 | 916 | 28 | KEWLNSCDIRYSEGVQSLNWQKIMKTIT | 78.83 |
| DP00721 | Q8IRG6 | FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16) | Drosophila melanogaster (Fruit fly) | 889 | 1044 | 919 | 932 | 14 | PEGFFEQGGWTFLD | 85.12 |
| DP00721 | Q8IRG6 | FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16) | Drosophila melanogaster (Fruit fly) | 889 | 1044 | 939 | 953 | 15 | GENETAESEEDEAYN | 82.34 |
| DP00721 | Q8IRG6 | FACT complex subunit spt16 (Facilitates chromatin transcription complex subunit SPT16) (dSPT16) | Drosophila melanogaster (Fruit fly) | 889 | 1044 | 965 | 979 | 15 | EDSEYSEASEDSEES | 87.29 |
| DP00722 | P0AGE2 | Single-stranded DNA-binding protein (SSB) | Escherichia coli O157:H7 | 113 | 177 | 144 | 151 | 8 | GGNQFSGG | 75.59 |
| DP00724 | Q9LQT8 | DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2) | Arabidopsis thaliana (Mouse-ear cress) | 11 | 113 | 27 | 38 | 12 | MDELLAVLGYKV | 80.16 |
| DP00724 | Q9LQT8 | DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2) | Arabidopsis thaliana (Mouse-ear cress) | 11 | 113 | 47 | 58 | 12 | AQKLEQLEVMMS | 78.93 |
| DP00724 | Q9LQT8 | DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2) | Arabidopsis thaliana (Mouse-ear cress) | 11 | 113 | 66 | 89 | 24 | SQLATETVHYNPAELYTWLDSMLT | 81.55 |
| DP00724 | Q9LQT8 | DELLA protein GAI (GRAS family protein 3) (AtGRAS-3) (Gibberellic acid-insensitive mutant protein) (Restoration of growth on ammonia protein 2) | Arabidopsis thaliana (Mouse-ear cress) | 11 | 113 | 96 | 108 | 13 | SNAEYDLKAIPGD | 78.36 |
| DP00725 | P41851 | Type II secretion system protein M (T2SS protein M) (Cholera toxin secretion protein EpsM) (General secretion pathway protein M) | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 44 | 85 | 58 | 75 | 18 | KQLLSWVSENANDIVTLR | 76.92 |
| DP00728 | P00760 | Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2 | Bos taurus (Bovine) | 4 | 47 | 4 | 16 | 13 | FIFLALLGAAVAF | 85.23 |
| DP00728 | P00760 | Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2 | Bos taurus (Bovine) | 4 | 47 | 20 | 42 | 23 | DDDKIVGGYTCGANTVPYQVSLN | 78.92 |
| DP00728 | P00760 | Cationic trypsin (EC 3.4.21.4) (Beta-trypsin) Cleaved into: Alpha-trypsin chain 1; Alpha-trypsin chain 2 | Bos taurus (Bovine) | 68 | 89 | 74 | 84 | 11 | GEDNINVVEGN | 82.61 |
| DP00729 | P00974 | Pancreatic trypsin inhibitor (Aprotinin) (Basic protease inhibitor) (BPI) (BPTI) | Bos taurus (Bovine) | 14 | 38 | 15 | 23 | 9 | LLGTLAAST | 75.59 |
| DP00742 | Q99LM3 | Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM) | Mus musculus (Mouse) | 1 | 341 | 18 | 24 | 7 | TAGNLET | 75.82 |
| DP00742 | Q99LM3 | Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM) | Mus musculus (Mouse) | 1 | 341 | 26 | 43 | 18 | GSQGIAEEVAEGTVGTSD | 76.25 |
| DP00742 | Q99LM3 | Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM) | Mus musculus (Mouse) | 1 | 341 | 69 | 80 | 12 | GEASILDELKTD | 78.9 |
| DP00742 | Q99LM3 | Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM) | Mus musculus (Mouse) | 1 | 341 | 169 | 181 | 13 | GAEVTVNEAETES | 80.4 |
| DP00742 | Q99LM3 | Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM) | Mus musculus (Mouse) | 1 | 341 | 231 | 237 | 7 | RAAVIPS | 78.26 |
| DP00742 | Q99LM3 | Smoothelin-like protein 1 (Calponin homology-associated smooth muscle protein) (CHASM) | Mus musculus (Mouse) | 1 | 341 | 313 | 336 | 24 | NRKAIMDKFGGAASGPTALFRNTK | 75.5 |
| DP00747 | P01160 | Natriuretic peptides A (Atrial natriuretic factor prohormone) (proANF) (Atrial natriuretic peptide prohormone) (preproANP) (proANP) (Atriopeptigen) (Cardiodilatin) (CDD) (preproCDD-ANF) Cleaved into: Long-acting natriuretic peptide (LANP) (Long-acting natriuretic hormone) (LANH) (Pro atrial natriuretic factor 1-30) (proANF 1-30) (Pro atrial natriuretic peptide 1-30) (proANP 1-30); Vessel dilator (VSDL) (Pro atrial natriuretic factor 31-67) (proANF 31-67) (Pro atrial natriuretic peptide 31-67) (proANP 31-67); Kaliuretic peptide (KP) (Pro atrial natriuretic factor 79-98) (proANF 79-98) (Pro atrial natriuretic peptide 79-98) (proANP 79-98); Urodilatin (URO) (CDD 95-126) (CDD-ANP (95-126)) (Pro atrial natriuretic peptide 95-126) (proANP 95-126); Auriculin-C (Atrial natriuretic factor 1-33) (ANF 1-33); Auriculin-D (Atrial natriuretic factor 3-33) (ANF 3-33); Atrial natriuretic peptide (ANP) (Alpha-atrial natriuretic peptide) (Alpha-hANP) (Atrial natriuretic factor) (ANF) (CDD-ANF) (CDD-ANP (99-126)) (Cardionatrin) (Pro atrial natriuretic factor 99-126) (proANF 99-126); Auriculin-B (Atrial natriuretic factor 8-33) (ANF 8-33); Auriculin-A; Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II); Atriopeptin-3 (Atriopeptin III) | Homo sapiens (Human) | 56 | 123 | 70 | 76 | 7 | AGAALSP | 73.91 |
| DP00748 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 192 | 223 | 196 | 203 | 8 | SVSALIGG | 85.41 |
| DP00748 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 238 | 293 | 239 | 278 | 40 | YARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGE | 79.84 |
| DP00749 | Q9TY14 | Apical membrane antigen 1 (Fragment) | Plasmodium vivax | 413 | 445 | 414 | 440 | 27 | AEIKENNQVVIKEEFRNYYENGEEKSN | 77.16 |
| DP00750 | Q38151 | 39 protein | Bacillus phage SPP1 (Bacteriophage SPP1) | 68 | 126 | 73 | 96 | 24 | RDRFIPSYEETQRILKEQAEAEEA | 74.83 |
| DP00750 | Q38151 | 39 protein | Bacillus phage SPP1 (Bacteriophage SPP1) | 68 | 126 | 105 | 121 | 17 | AAQEENMRKIREMLGIN | 78.63 |
| DP00750 | Q38151 | 39 protein | Bacillus phage SPP1 (Bacteriophage SPP1) | 68 | 112 | 73 | 96 | 24 | RDRFIPSYEETQRILKEQAEAEEA | 74.83 |
| DP00752 | E6PBU9 | 40S ribosomal protein rpS31e | Tetrahymena thermophila | 1 | 71 | 10 | 52 | 43 | GETKIYTLEQGTSVLDLKSQISQDMGFEIDMMTLVNNGFIAPN | 78.47 |
| DP00752 | E6PBU9 | 40S ribosomal protein rpS31e | Tetrahymena thermophila | 1 | 71 | 58 | 66 | 9 | DDVTYYLSL | 85.99 |
| DP00753 | C4M0U8 | Calmodulin; putative | Entamoeba histolytica | 1 | 81 | 12 | 25 | 14 | EQQEYKEAFQLFDK | 90.8 |
| DP00753 | C4M0U8 | Calmodulin; putative | Entamoeba histolytica | 1 | 81 | 27 | 38 | 12 | NDNKLTAEELGT | 73.91 |
| DP00753 | C4M0U8 | Calmodulin; putative | Entamoeba histolytica | 1 | 81 | 48 | 60 | 13 | TKQKISEIVKDYD | 89.19 |
| DP00753 | C4M0U8 | Calmodulin; putative | Entamoeba histolytica | 1 | 81 | 63 | 76 | 14 | NSGKFDQETFLTIM | 84.78 |
| DP00753 | C4M0U8 | Calmodulin; putative | Entamoeba histolytica | 82 | 150 | 91 | 97 | 7 | KAFEIFD | 97.75 |
| DP00753 | C4M0U8 | Calmodulin; putative | Entamoeba histolytica | 82 | 150 | 100 | 122 | 23 | KNGYISASELKHVLTTLGEKLTE | 79.45 |
| DP00753 | C4M0U8 | Calmodulin; putative | Entamoeba histolytica | 82 | 150 | 128 | 145 | 18 | LLKEIGVEEGLINVDDFV | 84.97 |
| DP00754 | Q70Q12 | FXYD domain-containing ion transport regulator | Squalus acanthias (Spiny dogfish) | 62 | 94 | 81 | 87 | 7 | TAQHLLQ | 79.55 |
| DP00756 | Q04884 | Opacity protein opA60 (Fragment) | Neisseria gonorrhoeae | 18 | 52 | 18 | 24 | 7 | AYEHITH | 91.97 |
| DP00756 | Q04884 | Opacity protein opA60 (Fragment) | Neisseria gonorrhoeae | 18 | 52 | 33 | 47 | 15 | NKNKISTVSDYFRNI | 81.14 |
| DP00756 | Q04884 | Opacity protein opA60 (Fragment) | Neisseria gonorrhoeae | 75 | 114 | 78 | 92 | 15 | NNNKYSVNIENVRIR | 80.31 |
| DP00756 | Q04884 | Opacity protein opA60 (Fragment) | Neisseria gonorrhoeae | 145 | 188 | 154 | 163 | 10 | TIEVTTVPSN | 84.08 |
| DP00756 | Q04884 | Opacity protein opA60 (Fragment) | Neisseria gonorrhoeae | 145 | 188 | 167 | 175 | 9 | GAVTTYNTD | 81.64 |
| DP00759 | P80220 | TSC22 domain family protein 3 (DSIP-immunoreactive peptide) (DIP protein) (Delta sleep-inducing peptide immunoreactor) (Glucocorticoid-induced leucine zipper protein) | Sus scrofa (Pig) | 48 | 77 | 48 | 57 | 10 | QLEKFQSRLS | 86.62 |
| DP00765 | O00585 | C-C motif chemokine 21 (6Ckine) (Beta-chemokine exodus-2) (Secondary lymphoid-tissue chemokine) (SLC) (Small-inducible cytokine A21) | Homo sapiens (Human) | 71 | 111 | 83 | 91 | 9 | VQQLMQHLD | 80.27 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 14 | 99 | 43 | 50 | 8 | TELEEVSL | 73.91 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 14 | 99 | 61 | 67 | 7 | VAAVTLG | 82.99 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 14 | 99 | 70 | 77 | 8 | GTQETALT | 75.92 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 14 | 99 | 83 | 89 | 7 | QAQVSVA | 75.54 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 117 | 166 | 121 | 131 | 11 | PSQNIAAGLES | 76.86 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 117 | 166 | 136 | 143 | 8 | AGAQILGQ | 77.01 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 272 | 590 | 288 | 296 | 9 | DVQTISILP | 81.16 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 272 | 590 | 301 | 309 | 9 | ESHLILEEV | 79.04 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 272 | 590 | 340 | 346 | 7 | GEVVEQT | 76.25 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 272 | 590 | 466 | 475 | 10 | HSVLLDSYLV | 84.25 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 272 | 590 | 505 | 521 | 17 | GAQALSEESETQDQSEV | 76.18 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 272 | 590 | 552 | 567 | 16 | QDQSTSHQELQEEALA | 74.87 |
| DP00768 | Q28181 | Cyclic nucleotide-gated cation channel beta-1 (240 kDa protein of rod photoreceptor CNG-channel) (Cyclic nucleotide-gated cation channel 4) (CNG channel 4) (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel gamma) (Cyclic nucleotide-gated cation channel modulatory subunit) (Cyclic nucleotide-gated channel beta-1) (CNG channel beta-1) (Glutamic acid-rich protein) (GARP) | Bos taurus (Bovine) | 272 | 590 | 570 | 585 | 16 | SGGSFQMSPFEALQEC | 73.58 |
| DP00769 | Q24F70 | 40S ribosomal protein S10; putative | Tetrahymena thermophila (strain SB210) | 106 | 162 | 147 | 157 | 11 | GAAETAQGNQE | 75.92 |
| DP00771 | P20435 | DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 71 | 4 | 30 | 27 | YEEAFNDGNENFEDFDVEHFSDEETYE | 83.66 |
| DP00771 | P20435 | DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 71 | 44 | 52 | 9 | NGKTIVTGG | 80.27 |
| DP00771 | P20435 | DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (ABC23) (DNA-directed RNA polymerases I; II; and III 23 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 71 | 58 | 65 | 8 | FQQHEQIR | 75.25 |
| DP00774 | P40719 | Sensor protein QseC (EC 2.7.13.3) | Escherichia coli (strain K12) | 35 | 158 | 40 | 52 | 13 | VDELFDTQLMLFA | 91.23 |
| DP00774 | P40719 | Sensor protein QseC (EC 2.7.13.3) | Escherichia coli (strain K12) | 35 | 158 | 58 | 66 | 9 | LDLNEINAA | 90.64 |
| DP00774 | P40719 | Sensor protein QseC (EC 2.7.13.3) | Escherichia coli (strain K12) | 35 | 158 | 83 | 94 | 12 | DDALTFAIFTHD | 84.03 |
| DP00774 | P40719 | Sensor protein QseC (EC 2.7.13.3) | Escherichia coli (strain K12) | 35 | 158 | 106 | 123 | 18 | EDIPYSYQREGFADGQLV | 76.14 |
| DP00774 | P40719 | Sensor protein QseC (EC 2.7.13.3) | Escherichia coli (strain K12) | 35 | 158 | 127 | 134 | 8 | DPWRFVWM | 79.93 |
| DP00774 | P40719 | Sensor protein QseC (EC 2.7.13.3) | Escherichia coli (strain K12) | 35 | 158 | 139 | 152 | 14 | GKYRIVVGQEWEYR | 83.13 |
| DP00774 | P40719 | Sensor protein QseC (EC 2.7.13.3) | Escherichia coli (strain K12) | 386 | 417 | 396 | 404 | 9 | ALARIGERF | 79.71 |
| DP00775 | P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | Homo sapiens (Human) | 130 | 150 | 130 | 141 | 12 | VQAKFGDYNKEV | 81.86 |
| DP00775 | P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | Homo sapiens (Human) | 298 | 515 | 320 | 327 | 8 | RQQLETEK | 77.55 |
| DP00775 | P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | Homo sapiens (Human) | 298 | 515 | 350 | 357 | 8 | RLQDYEEK | 75.25 |
| DP00775 | P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | Homo sapiens (Human) | 298 | 515 | 365 | 378 | 14 | LSEQIQRALQLEEE | 75.51 |
| DP00775 | P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | Homo sapiens (Human) | 298 | 515 | 416 | 434 | 19 | QLAAELAEYTAKIALLEEA | 80.55 |
| DP00775 | P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | Homo sapiens (Human) | 298 | 515 | 484 | 491 | 8 | HVQESLQD | 74.67 |
| DP00775 | P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | Homo sapiens (Human) | 298 | 515 | 498 | 506 | 9 | GYSAELSSE | 77.41 |
| DP00775 | P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | Homo sapiens (Human) | 506 | 586 | 529 | 540 | 12 | RQLLTLSSELSQ | 76.11 |
| DP00775 | P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | Homo sapiens (Human) | 506 | 586 | 549 | 557 | 9 | HNDIIHNEN | 76.66 |
| DP00776 | P0ACF8 | DNA-binding protein H-NS (Heat-stable nucleoid-structuring protein) (Histone-like protein HLP-II) (Protein B1) (Protein H1) | Escherichia coli (strain K12) | 57 | 89 | 57 | 67 | 11 | KLQQYREMLIA | 82.24 |
| DP00776 | P0ACF8 | DNA-binding protein H-NS (Heat-stable nucleoid-structuring protein) (Histone-like protein HLP-II) (Protein B1) (Protein H1) | Escherichia coli (strain K12) | 57 | 89 | 74 | 84 | 11 | ELLNSLAAVKS | 77.04 |
| DP00778 | P46670 | Tubulin-specific chaperone C (Chromosome instability protein 2) (Tubulin-folding cofactor C) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 220 | 245 | 225 | 240 | 16 | RDHLIIQDFSNPFQSE | 76.15 |
| DP00783 | P10279 | Major prion protein (PrP) (Major scrapie-associated fibril protein 1) (CD antigen CD230) | Bos taurus (Bovine) | 23 | 121 | 32 | 42 | 11 | GGWNTGGSRYP | 80.94 |
| DP00786 | G4NEJ8 | PC4 domain-containing protein | Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) | 117 | 158 | 147 | 153 | 7 | KKANIEA | 80.12 |
| DP00787 | B2LME8 | Alginase | Pseudoalteromonas sp. SM0524 | 32 | 155 | 36 | 61 | 26 | NAGFESGFSNWNETDPAAISSDAYSG | 78.13 |
| DP00787 | B2LME8 | Alginase | Pseudoalteromonas sp. SM0524 | 32 | 155 | 72 | 150 | 79 | ARVYQVVDIQPNTEYTLSAYVLGKGQIGVNDLNGLFKNQTFNVSSWTKVTKTFTSANTNSLQVFAKHYNNTSDVRFDNF | 80.49 |
| DP00788 | P38801 | Exosome complex protein LRP1 (Like an rRNA processing protein 1) (Yeast C1D domain-containing protein) (rRNA processing protein 47) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 118 | 184 | 148 | 157 | 10 | AESTTTKIID | 79.26 |
| DP00790 | P08245 | Uncharacterized protein YciH | Escherichia coli (strain K12) | 1 | 31 | 6 | 18 | 13 | SRLVYSTETGRID | 77.67 |
| DP00791 | P9WHJ5 | RNA polymerase-binding protein RbpA | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 26 | 12 | 19 | 8 | GAVSYETD | 82.15 |
| DP00791 | P9WHJ5 | RNA polymerase-binding protein RbpA | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 25 | 12 | 19 | 8 | GAVSYETD | 82.15 |
| DP00792 | P36886 | Photosystem I reaction center subunit psaK; chloroplastic (Light-harvesting complex I 7 kDa protein) (PSI-K) (Photosystem I subunit X) | Hordeum vulgare (Barley) | 1 | 42 | 2 | 11 | 10 | ASQLSAMTSV | 79.93 |
| DP00793 | P05387 | 60S acidic ribosomal protein P2 (Large ribosomal subunit protein P2) (Renal carcinoma antigen NY-REN-44) | Homo sapiens (Human) | 63 | 115 | 69 | 76 | 8 | GAVAVSAA | 75.25 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 116 | 138 | 124 | 133 | 10 | LDKEIKNSFN | 77.66 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 117 | 345 | 124 | 133 | 10 | LDKEIKNSFN | 77.66 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 117 | 345 | 135 | 143 | 9 | EAQVFMPIS | 78.45 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 117 | 345 | 172 | 188 | 17 | TQPLTFTTATFAATKFG | 80.44 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 117 | 345 | 218 | 236 | 19 | KQKAISSSMHSLYGLGLGS | 84.83 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 117 | 345 | 260 | 268 | 9 | QQQKTSALS | 77.93 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 117 | 345 | 270 | 278 | 9 | NAKEFIFPN | 90.23 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 117 | 345 | 300 | 340 | 41 | PLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQ | 82.45 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 147 | 345 | 172 | 188 | 17 | TQPLTFTTATFAATKFG | 80.44 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 147 | 345 | 218 | 236 | 19 | KQKAISSSMHSLYGLGLGS | 84.83 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 147 | 345 | 260 | 268 | 9 | QQQKTSALS | 77.93 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 147 | 345 | 270 | 278 | 9 | NAKEFIFPN | 90.23 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 147 | 345 | 300 | 340 | 41 | PLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQ | 82.45 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 147 | 285 | 172 | 188 | 17 | TQPLTFTTATFAATKFG | 80.44 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 147 | 285 | 218 | 236 | 19 | KQKAISSSMHSLYGLGLGS | 84.83 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 147 | 285 | 260 | 268 | 9 | QQQKTSALS | 77.93 |
| DP00794 | P50616 | Protein Tob1 (Transducer of erbB-2 1) | Homo sapiens (Human) | 147 | 285 | 270 | 278 | 9 | NAKEFIFPN | 90.23 |
| DP00795 | P62326 | Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide) | Bos taurus (Bovine) | 1 | 44 | 6 | 14 | 9 | DMAEIEKFD | 81.72 |
| DP00795 | P62326 | Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide) | Bos taurus (Bovine) | 1 | 44 | 31 | 37 | 7 | SKETIEQ | 75.92 |
| DP00795 | P62326 | Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide) | Bos taurus (Bovine) | 13 | 44 | 31 | 37 | 7 | SKETIEQ | 75.92 |
| DP00795 | P62326 | Thymosin beta-4 (T beta-4) Cleaved into: Hematopoietic system regulatory peptide (Seraspenide) | Bos taurus (Bovine) | 22 | 44 | 31 | 37 | 7 | SKETIEQ | 75.92 |
| DP00796 | P15382 | Potassium voltage-gated channel subfamily E member 1 (Delayed rectifier potassium channel subunit IsK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel) | Homo sapiens (Human) | 107 | 129 | 109 | 117 | 9 | VENHLAIEQ | 79.26 |
| DP00797 | O15273 | Telethonin (Titin cap protein) | Homo sapiens (Human) | 91 | 167 | 112 | 123 | 12 | QLQELLALETAL | 80.6 |
| DP00797 | O15273 | Telethonin (Titin cap protein) | Homo sapiens (Human) | 91 | 167 | 131 | 138 | 8 | QEVAEITK | 78.05 |
| DP00798 | O14214 | tRNA (guanine(9)-N1)-methyltransferase (EC 2.1.1.221) (tRNA methyltransferase 10) (tRNA(m1G9)-methyltransferase) (tRNA(m1G9)MTase) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 83 | 42 | 48 | 7 | RQQEWDA | 76.59 |
| DP00798 | O14214 | tRNA (guanine(9)-N1)-methyltransferase (EC 2.1.1.221) (tRNA methyltransferase 10) (tRNA(m1G9)-methyltransferase) (tRNA(m1G9)MTase) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 271 | 304 | 274 | 288 | 15 | GILLKSDESFDVSED | 76.19 |
| DP00799 | P9WNK3 | ESAT-6-like protein EsxH (10 kDa antigen CFP7) (CFP-7) (Low molecular weight protein antigen 7) (Protein TB10.4) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 76 | 96 | 76 | 82 | 7 | HEANTMA | 79.93 |
| DP00803 | P22179 | Photosystem I reaction center subunit VI; chloroplastic (PSI-H) (Light-harvesting complex I 11 kDa protein) | Spinacia oleracea (Spinach) | 1 | 58 | 2 | 15 | 14 | ASLATLAAVQPTTL | 75.94 |
| DP00803 | P22179 | Photosystem I reaction center subunit VI; chloroplastic (PSI-H) (Light-harvesting complex I 11 kDa protein) | Spinacia oleracea (Spinach) | 1 | 58 | 33 | 41 | 9 | ARQSFKLNN | 76.81 |
| DP00803 | P22179 | Photosystem I reaction center subunit VI; chloroplastic (PSI-H) (Light-harvesting complex I 11 kDa protein) | Spinacia oleracea (Spinach) | 1 | 58 | 43 | 53 | 11 | RSGAIVAKYGD | 81.76 |
| DP00806 | A1B8N7 | ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) | Paracoccus denitrificans (strain Pd 1222) | 116 | 188 | 118 | 128 | 11 | ADVVSAQALTD | 84.43 |
| DP00806 | A1B8N7 | ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) | Paracoccus denitrificans (strain Pd 1222) | 116 | 188 | 144 | 174 | 31 | KTVKLNARVDESLIGGMIVKLGSQMIDSSIR | 80.43 |
| DP00806 | A1B8N7 | ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) | Paracoccus denitrificans (strain Pd 1222) | 116 | 188 | 177 | 183 | 7 | LASLQNA | 74.63 |
| DP00808 | P24937 | Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 51 | 2 | 10 | 9 | EDINFASLA | 80.75 |
| DP00808 | P24937 | Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 51 | 18 | 46 | 29 | FMGNWQDIGTSNMSGGAFSWGSLWSGIKN | 79.41 |
| DP00808 | P24937 | Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 158 | 250 | 200 | 206 | 7 | AVVVTRP | 77.93 |
| DP00808 | P24937 | Pre-protein VI (pVI) Cleaved into: Endosome lysis protein; Protease cofactor (pVI-C) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 158 | 250 | 225 | 245 | 21 | ASGNWQSTLNSIVGLGVQSLK | 87.55 |
| DP00809 | P80870 | General stress protein 13 (GSP13) | Bacillus subtilis (strain 168) | 81 | 130 | 95 | 112 | 18 | AAQVSEEASTPQGFNTLK | 78.93 |
| DP00809 | P80870 | General stress protein 13 (GSP13) | Bacillus subtilis (strain 168) | 81 | 130 | 114 | 123 | 10 | KLEEWIEMSN | 80 |
| DP00810 | P0A882 | Trp operon repressor | Escherichia coli O157:H7 | 63 | 92 | 75 | 87 | 13 | LGAGIATITRGSN | 88.37 |
| DP00811 | Q9V452 | Chromatin accessibility complex 16kD protein | Drosophila melanogaster (Fruit fly) | 1 | 28 | 15 | 23 | 9 | TAETFLPLS | 90.3 |
| DP00811 | Q9V452 | Chromatin accessibility complex 16kD protein | Drosophila melanogaster (Fruit fly) | 101 | 140 | 103 | 109 | 7 | HQFQEML | 75.68 |
| DP00814 | P01252 | Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1 | Bos taurus (Bovine) | 1 | 110 | 8 | 15 | 8 | TSSEITTK | 74.79 |
| DP00814 | P01252 | Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1 | Bos taurus (Bovine) | 1 | 110 | 22 | 29 | 8 | EVVEEAEN | 75.92 |
| DP00815 | Q9DCL8 | Protein phosphatase inhibitor 2 (IPP-2) | Mus musculus (Mouse) | 1 | 206 | 49 | 58 | 10 | DEMNILATYH | 83.68 |
| DP00815 | Q9DCL8 | Protein phosphatase inhibitor 2 (IPP-2) | Mus musculus (Mouse) | 1 | 206 | 83 | 89 | 7 | DEDAYSD | 75.87 |
| DP00815 | Q9DCL8 | Protein phosphatase inhibitor 2 (IPP-2) | Mus musculus (Mouse) | 1 | 206 | 145 | 164 | 20 | RKLHYNEGLNIKLARQLISK | 77.68 |
| DP00815 | Q9DCL8 | Protein phosphatase inhibitor 2 (IPP-2) | Mus musculus (Mouse) | 1 | 206 | 184 | 196 | 13 | MNVEESSQGSTTS | 73.91 |
| DP00815 | Q9DCL8 | Protein phosphatase inhibitor 2 (IPP-2) | Mus musculus (Mouse) | 57 | 129 | 83 | 89 | 7 | DEDAYSD | 75.87 |
| DP00815 | Q9DCL8 | Protein phosphatase inhibitor 2 (IPP-2) | Mus musculus (Mouse) | 170 | 206 | 184 | 196 | 13 | MNVEESSQGSTTS | 73.91 |
| DP00816 | P41236 | Protein phosphatase inhibitor 2 (IPP-2) | Homo sapiens (Human) | 9 | 164 | 24 | 31 | 8 | SMVASAEQ | 75.67 |
| DP00816 | P41236 | Protein phosphatase inhibitor 2 (IPP-2) | Homo sapiens (Human) | 9 | 164 | 36 | 42 | 7 | VDEELSK | 75.25 |
| DP00816 | P41236 | Protein phosphatase inhibitor 2 (IPP-2) | Homo sapiens (Human) | 9 | 164 | 48 | 57 | 10 | DEMNILATYH | 83.68 |
| DP00816 | P41236 | Protein phosphatase inhibitor 2 (IPP-2) | Homo sapiens (Human) | 9 | 164 | 144 | 159 | 16 | RKLHYNEGLNIKLARQ | 78.11 |
| DP00818 | P40422 | DNA-directed RNA polymerases I; II; and III subunit RPABC4 (RNA polymerases I; II; and III subunit ABC4) (ABC10-alpha) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 24 | 4 | 11 | 8 | EGFQIPTN | 75.08 |
| DP00823 | N1NXA6 | SAGA-associated factor 11 | "Saccharomyces cerevisiae (strain CEN.PK113-7D) (Bakers yeast)" | 64 | 99 | 67 | 73 | 7 | SSQYIHC | 76.54 |
| DP00824 | Q9NJS1 | Salivary anti-thrombin peptide anophelin | Anopheles albimanus (New world malaria mosquito) | 23 | 83 | 47 | 71 | 25 | NDTSITDEDYAAIEASLSETFNTAA | 79.71 |
| DP00824 | Q9NJS1 | Salivary anti-thrombin peptide anophelin | Anopheles albimanus (New world malaria mosquito) | 54 | 83 | 55 | 71 | 17 | DYAAIEASLSETFNTAA | 80.7 |
| DP00824 | Q9NJS1 | Salivary anti-thrombin peptide anophelin | Anopheles albimanus (New world malaria mosquito) | 56 | 83 | 56 | 71 | 16 | YAAIEASLSETFNTAA | 80.29 |
| DP00827 | O31467 | Sec-independent protein translocase protein TatAd | Bacillus subtilis (strain 168) | 49 | 70 | 57 | 65 | 9 | SAELTAVKQ | 80.27 |
| DP00828 | P13183 | Cytochrome c oxidase subunit 7B; mitochondrial (Cytochrome c oxidase polypeptide VIIb) (IHQ) | Bos taurus (Bovine) | 36 | 56 | 39 | 51 | 13 | NAVLASGATFCVA | 80.45 |
| DP00833 | P22995 | Antitoxin ParD | Escherichia coli | 38 | 83 | 42 | 58 | 17 | ADQAWQELKTMLGNRIN | 80.62 |
| DP00833 | P22995 | Antitoxin ParD | Escherichia coli | 38 | 83 | 69 | 78 | 10 | SVGEILDEEL | 76.42 |
| DP00833 | P22995 | Antitoxin ParD | Escherichia coli | 50 | 83 | 69 | 78 | 10 | SVGEILDEEL | 76.42 |
| DP00833 | P22995 | Antitoxin ParD | Escherichia coli | 58 | 83 | 69 | 78 | 10 | SVGEILDEEL | 76.42 |
| DP00834 | P69428 | Sec-independent protein translocase protein TatA | Escherichia coli (strain K12) | 21 | 89 | 32 | 38 | 7 | LGASIKG | 75.25 |
| DP00834 | P69428 | Sec-independent protein translocase protein TatA | Escherichia coli (strain K12) | 21 | 89 | 55 | 65 | 11 | QDADFTAKTIA | 78.63 |
| DP00834 | P69428 | Sec-independent protein translocase protein TatA | Escherichia coli (strain K12) | 22 | 44 | 32 | 38 | 7 | LGASIKG | 75.25 |
| DP00834 | P69428 | Sec-independent protein translocase protein TatA | Escherichia coli (strain K12) | 44 | 89 | 55 | 65 | 11 | QDADFTAKTIA | 78.63 |
| DP00834 | P69428 | Sec-independent protein translocase protein TatA | Escherichia coli (strain K12) | 47 | 89 | 55 | 65 | 11 | QDADFTAKTIA | 78.63 |
| DP00835 | Q03337 | Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 54 | 1 | 7 | 7 | MSQRIIQ | 87.1 |
| DP00835 | Q03337 | Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 54 | 19 | 26 | 8 | SDGYEYTV | 85.74 |
| DP00835 | Q03337 | Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 54 | 29 | 49 | 21 | KQAITSEASTTYIPSRIYSES | 76.7 |
| DP00835 | Q03337 | Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 104 | 164 | 115 | 126 | 12 | RASAFLSQNESS | 77.06 |
| DP00835 | Q03337 | Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 104 | 164 | 129 | 136 | 8 | LSNASNSP | 74.08 |
| DP00835 | Q03337 | Trafficking protein particle complex subunit 31 (TRAPP subunit 31) (Transport protein particle 31 kDa subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 104 | 164 | 138 | 150 | 13 | MLANSSTATSASA | 78.08 |
| DP00836 | P01139 | Beta-nerve growth factor (Beta-NGF) | Mus musculus (Mouse) | 19 | 128 | 39 | 45 | 7 | KLQHSLD | 75.25 |
| DP00836 | P01139 | Beta-nerve growth factor (Beta-NGF) | Mus musculus (Mouse) | 19 | 128 | 66 | 72 | 7 | QTRNITV | 76.64 |
| DP00836 | P01139 | Beta-nerve growth factor (Beta-NGF) | Mus musculus (Mouse) | 19 | 128 | 85 | 92 | 8 | PRVLFSTQ | 79.68 |
| DP00836 | P01139 | Beta-nerve growth factor (Beta-NGF) | Mus musculus (Mouse) | 19 | 128 | 101 | 114 | 14 | LDLDFQAHGTIPFN | 77.45 |
| DP00839 | Q16186 | Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog) | Homo sapiens (Human) | 1 | 21 | 4 | 11 | 8 | SGALFPSL | 79.93 |
| DP00839 | Q16186 | Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog) | Homo sapiens (Human) | 132 | 252 | 144 | 151 | 8 | GHELSALG | 75.92 |
| DP00839 | Q16186 | Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog) | Homo sapiens (Human) | 132 | 252 | 155 | 174 | 20 | GLQSLLGNMSHSQLMQLIGP | 84.62 |
| DP00839 | Q16186 | Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog) | Homo sapiens (Human) | 132 | 252 | 182 | 188 | 7 | GLGALTG | 75.59 |
| DP00839 | Q16186 | Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog) | Homo sapiens (Human) | 132 | 252 | 190 | 197 | 8 | GLASLLGS | 79.18 |
| DP00839 | Q16186 | Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog) | Homo sapiens (Human) | 253 | 285 | 261 | 275 | 15 | PIQLSDLQSILATMN | 77.08 |
| DP00840 | P46065 | Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A) | Bos taurus (Bovine) | 74 | 108 | 76 | 86 | 11 | YVAALSLVLKG | 76.28 |
| DP00840 | P46065 | Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A) | Bos taurus (Bovine) | 74 | 108 | 91 | 100 | 10 | KLRWYFKLYD | 91.14 |
| DP00841 | O14733 | Dual specificity mitogen-activated protein kinase kinase 7 (MAP kinase kinase 7) (MAPKK 7) (EC 2.7.12.2) (JNK-activating kinase 2) (MAPK/ERK kinase 7) (MEK 7) (Stress-activated protein kinase kinase 4) (SAPK kinase 4) (SAPKK-4) (SAPKK4) (c-Jun N-terminal kinase kinase 2) (JNK kinase 2) (JNKK 2) | Homo sapiens (Human) | 30 | 100 | 86 | 95 | 10 | SMESIEIDQK | 78.63 |
| DP00842 | P12506 | Protein Tat (Transactivating regulatory protein) | Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) (HIV-1) | 1 | 86 | 4 | 12 | 9 | VDPNIEPWN | 77.48 |
| DP00842 | P12506 | Protein Tat (Transactivating regulatory protein) | Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) (HIV-1) | 1 | 86 | 34 | 49 | 16 | CQVCFITKGLGISYGR | 82.53 |
| DP00847 | P20220 | Protein F-112 | Sulfolobus spindle-shape virus 1 (SSV1) | 74 | 112 | 85 | 94 | 10 | TQDNIAKIFD | 86.96 |
| DP00847 | P20220 | Protein F-112 | Sulfolobus spindle-shape virus 1 (SSV1) | 74 | 112 | 96 | 107 | 12 | QPANFEQTDQGF | 82 |
| DP00848 | Q49ZM2 | Putative secretory antigen | Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) | 1 | 49 | 5 | 22 | 18 | VTATTLTAGIGAAIVGLD | 77.07 |
| DP00848 | Q49ZM2 | Putative secretory antigen | Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) | 1 | 49 | 27 | 34 | 8 | ADAAEQTQ | 75.25 |
| DP00848 | Q49ZM2 | Putative secretory antigen | Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) | 1 | 49 | 37 | 44 | 8 | NQSTTQST | 77.76 |
| DP00849 | Q9Q8E9 | M156R | Myxoma virus (strain Lausanne) (MYXV) | 1 | 32 | 14 | 27 | 14 | KNKNIKVNTYRTSA | 82.18 |
| DP00850 | P36932 | Integrase (EC 2.7.7.-) (EC 3.1.-.-) | Escherichia phage P2 (Bacteriophage P2) | 46 | 161 | 61 | 71 | 11 | LSELTQIWWDL | 83.37 |
| DP00850 | P36932 | Integrase (EC 2.7.7.-) (EC 3.1.-.-) | Escherichia phage P2 (Bacteriophage P2) | 46 | 161 | 82 | 113 | 32 | NLGKIEIFTKITNDPCAFQITKSLISQYCATR | 83.29 |
| DP00850 | P36932 | Integrase (EC 2.7.7.-) (EC 3.1.-.-) | Escherichia phage P2 (Bacteriophage P2) | 46 | 161 | 126 | 146 | 21 | DLTCISGMFTALIEAELFFGE | 83.02 |
| DP00851 | Q9KX51 | PmoC | Methylosinus trichosporium | 177 | 256 | 177 | 196 | 20 | HGFSLAFLIVAIGPFMIIPN | 83.63 |
| DP00851 | Q9KX51 | PmoC | Methylosinus trichosporium | 177 | 256 | 198 | 247 | 50 | GLNEWGHTFWFMEELFVAPLHWGFVFFGWMALGVFGVVLQILMGVKRLIG | 81.48 |
| DP00853 | P00127 | Cytochrome b-c1 complex subunit 6; mitochondrial (Complex III subunit 6) (Complex III subunit VI) (Cytochrome c1 non-heme 17 kDa protein) (Mitochondrial hinge protein) (Ubiquinol-cytochrome c oxidoreductase subunit 6) (Ubiquinol-cytochrome c reductase 17 kDa protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 72 | 2 | 18 | 17 | GMLELVGEYWEQLKITV | 79.34 |
| DP00858 | A8AZZ3 | Amylase-binding protein AbpA | Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) | 24 | 44 | 24 | 39 | 16 | ADEATDAARNNDGAYY | 81.4 |
| DP00863 | Q9X0Q3 | Transcriptional regulator; crp family | Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) | 130 | 201 | 134 | 143 | 10 | KLMNFLVRHM | 81.07 |
| DP00863 | Q9X0Q3 | Transcriptional regulator; crp family | Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) | 130 | 201 | 154 | 163 | 10 | TLEELSRLFG | 78.06 |
| DP00863 | Q9X0Q3 | Transcriptional regulator; crp family | Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) | 130 | 201 | 169 | 182 | 14 | LSRVFQELEREGYI | 78.76 |
| DP00866 | O54465 | Hypothetical mobile element-associated protein (Pathogenicity island protein) | Staphylococcus aureus | 42 | 72 | 46 | 52 | 7 | LQQSEQS | 73.91 |
| DP00866 | O54465 | Hypothetical mobile element-associated protein (Pathogenicity island protein) | Staphylococcus aureus | 42 | 72 | 56 | 67 | 12 | QYGTTLQNLAKQ | 82 |
| DP00869 | F2Z293 | Chlorophyll a-b binding protein; chloroplastic | Spinacia oleracea (Spinach) | 1 | 87 | 19 | 38 | 20 | KAPEYLDGSLVGDYGFDPFG | 77.58 |
| DP00869 | F2Z293 | Chlorophyll a-b binding protein; chloroplastic | Spinacia oleracea (Spinach) | 1 | 87 | 41 | 51 | 11 | KPAEYLQYDYD | 79.78 |
| DP00869 | F2Z293 | Chlorophyll a-b binding protein; chloroplastic | Spinacia oleracea (Spinach) | 1 | 87 | 53 | 68 | 16 | LDQNLAKNLAGDIIGT | 83.61 |
| DP00869 | F2Z293 | Chlorophyll a-b binding protein; chloroplastic | Spinacia oleracea (Spinach) | 1 | 87 | 73 | 82 | 10 | ADVKSTSLQP | 79.93 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 363 | 565 | 379 | 392 | 14 | VARLFSLFGCQEED | 92.76 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 363 | 565 | 402 | 422 | 21 | LALALAHAGELEALQALMELG | 77.5 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 363 | 565 | 431 | 442 | 12 | NGQTLLHVAARN | 75.92 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 363 | 565 | 445 | 451 | 7 | DGVVTML | 79.26 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 363 | 565 | 514 | 520 | 7 | GLQAWGQ | 76.97 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 363 | 565 | 536 | 558 | 23 | LCVAEAAGNQEVLALLRNLALVG | 77.74 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 364 | 565 | 379 | 392 | 14 | VARLFSLFGCQEED | 92.76 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 364 | 565 | 402 | 422 | 21 | LALALAHAGELEALQALMELG | 77.5 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 364 | 565 | 431 | 442 | 12 | NGQTLLHVAARN | 75.92 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 364 | 565 | 445 | 451 | 7 | DGVVTML | 79.26 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 364 | 565 | 514 | 520 | 7 | GLQAWGQ | 76.97 |
| DP00870 | H0W0T5 | Asparaginase (EC 3.5.1.1) | Cavia porcellus (Guinea pig) | 364 | 565 | 536 | 558 | 23 | LCVAEAAGNQEVLALLRNLALVG | 77.74 |
| DP00871 | A4ZNR2 | Nuclear export protein (NEP) (Non-structural protein 2) (NS2) | Influenza A virus (A/lvPR8/34(H1N1)) | 1 | 121 | 4 | 16 | 13 | NTVSSFQDILLRM | 78.18 |
| DP00871 | A4ZNR2 | Nuclear export protein (NEP) (Non-structural protein 2) (NS2) | Influenza A virus (A/lvPR8/34(H1N1)) | 1 | 121 | 18 | 25 | 8 | KMQLESSS | 77.01 |
| DP00871 | A4ZNR2 | Nuclear export protein (NEP) (Non-structural protein 2) (NS2) | Influenza A virus (A/lvPR8/34(H1N1)) | 1 | 121 | 28 | 42 | 15 | LNGMITQFESLKLYR | 79.64 |
| DP00871 | A4ZNR2 | Nuclear export protein (NEP) (Non-structural protein 2) (NS2) | Influenza A virus (A/lvPR8/34(H1N1)) | 1 | 121 | 53 | 62 | 10 | GDLHSLQNRN | 75.72 |
| DP00871 | A4ZNR2 | Nuclear export protein (NEP) (Non-structural protein 2) (NS2) | Influenza A virus (A/lvPR8/34(H1N1)) | 1 | 121 | 69 | 83 | 15 | LGQKFEEIRWLIEEV | 80.89 |
| DP00871 | A4ZNR2 | Nuclear export protein (NEP) (Non-structural protein 2) (NS2) | Influenza A virus (A/lvPR8/34(H1N1)) | 1 | 121 | 85 | 116 | 32 | HKLKITENSFEQITFMQALHLLLEVEQEIRTF | 81.9 |
| DP00872 | P80428 | Actin-related protein 4 (Actin-like protein ARP4) (Actin-like protein 4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 199 | 226 | 203 | 211 | 9 | IIPLFAIKQ | 85.69 |
| DP00872 | P80428 | Actin-related protein 4 (Actin-like protein ARP4) (Actin-like protein 4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 199 | 226 | 213 | 221 | 9 | KPEFIKKTF | 76.37 |
| DP00873 | Q9H981 | Actin-related protein 8 (hArp8) (INO80 complex subunit N) | Homo sapiens (Human) | 401 | 507 | 420 | 430 | 11 | HDEHYLLATQS | 81.03 |
| DP00873 | Q9H981 | Actin-related protein 8 (hArp8) (INO80 complex subunit N) | Homo sapiens (Human) | 401 | 507 | 485 | 496 | 12 | NDSEEALTALMS | 75.47 |
| DP00874 | Q12406 | Actin-related protein 7 (Actin-like protein ARP7) (Chromatin structure-remodeling complex protein ARP7) (SWI/SNF complex component ARP7) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 353 | 379 | 359 | 374 | 16 | GTSHINTNVGDNNSTA | 79.56 |
| DP00875 | P69723 | Virion infectivity factor (Vif) (SOR protein) Cleaved into: p17; p7 | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) | 141 | 192 | 143 | 156 | 14 | GSLQYLALAALITP | 81.56 |
| DP00876 | P14340 | Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5) | Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2) | 1 | 100 | 26 | 37 | 12 | VQQLTKRFSLGM | 80.94 |
| DP00876 | P14340 | Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5) | Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2) | 1 | 100 | 43 | 60 | 18 | PLKLFMALVAFLRFLTIP | 85.28 |
| DP00876 | P14340 | Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5) | Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2) | 1 | 100 | 74 | 83 | 10 | KSKAINVLRG | 75.89 |
| DP00877 | P9WHN5 | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 64 | 39 | 59 | 21 | LLDEIDDVLEENAEDFVRAYV | 82.13 |
| DP00877 | P9WHN5 | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 21 | 61 | 39 | 56 | 18 | LLDEIDDVLEENAEDFVR | 81.22 |
| DP00877 | P9WHN5 | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 21 | 51 | 39 | 46 | 8 | LLDEIDDV | 79.93 |
| DP00878 | G8HXD9 | NepR | Sphingomonas sp. Fr1 | 28 | 56 | 32 | 44 | 13 | LRSAYQKTIEEQV | 82.71 |
| DP00884 | P50106 | DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 49 | 79 | 51 | 60 | 10 | IDSTTMNTIS | 84.75 |
| DP00884 | P50106 | DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 101 | 137 | 102 | 116 | 15 | AQDFSAAPIQVSTTE | 75.67 |
| DP00884 | P50106 | DNA-directed RNA polymerase I subunit RPA14 (A14) (DNA-directed RNA polymerase I 14 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 102 | 137 | 102 | 116 | 15 | AQDFSAAPIQVSTTE | 75.67 |
| DP00889 | P9WF19 | Putative antitoxin VapB5 | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 45 | 24 | 30 | 7 | EDVTITV | 77.88 |
| DP00892 | O31818 | UPF0291 protein YnzC | Bacillus subtilis (strain 168) | 41 | 77 | 50 | 56 | 7 | KSVKIID | 85.14 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 1 | 10 | 10 | MLDFFTIFSK | 91.54 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 12 | 23 | 12 | GLVLWCFQGVSD | 91.36 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 29 | 40 | 12 | VNALIRSVLLQE | 77.48 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 42 | 91 | 50 | GGNNSFTHEALTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFR | 82.19 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 100 | 122 | 23 | QQSALSLLNGTFDFQNDFLRLLR | 81.42 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 200 | 211 | 12 | NGVELSKEELIR | 80.99 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 213 | 220 | 8 | KREEFIQK | 85.7 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 256 | 264 | 9 | KEVLDYSTP | 76.92 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 274 | 282 | 9 | LSEDINLIR | 85.28 |
| DP00893 | P08240 | Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) | Homo sapiens (Human) | 1 | 331 | 303 | 309 | 7 | AAQNSTK | 82.94 |
| DP00894 | Q7B2Z6 | Intrinsic membrane protein PufX (PUFX protien) | Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides) | 54 | 82 | 69 | 77 | 9 | GALETGIEL | 83.28 |
| DP00895 | P03421 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain A2) | 1 | 102 | 16 | 29 | 14 | RATKFLESIKGKFT | 78.88 |
| DP00895 | P03421 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain A2) | 1 | 102 | 37 | 67 | 31 | KDSIISVNSIDIEVTKESPITSNSTIINPTN | 83.53 |
| DP00895 | P03421 | Phosphoprotein (Protein P) | Human respiratory syncytial virus A (strain A2) | 1 | 102 | 83 | 90 | 8 | PLVSFKED | 78.26 |
| DP00896 | P10121 | Signal recognition particle receptor FtsY (SRP receptor) | Escherichia coli (strain K12) | 1 | 187 | 6 | 16 | 11 | KRGFFSWLGFG | 78.29 |
| DP00896 | P10121 | Signal recognition particle receptor FtsY (SRP receptor) | Escherichia coli (strain K12) | 1 | 187 | 34 | 43 | 10 | VVEEIVQAQE | 91.97 |
| DP00896 | P10121 | Signal recognition particle receptor FtsY (SRP receptor) | Escherichia coli (strain K12) | 1 | 187 | 62 | 82 | 21 | AEAETFAADVVEVTEQVAESE | 82.4 |
| DP00896 | P10121 | Signal recognition particle receptor FtsY (SRP receptor) | Escherichia coli (strain K12) | 1 | 187 | 130 | 169 | 40 | AEAETVEIVEAAEEEAAKEEITDEELETALAAEAAEEAVM | 79.75 |
| DP00898 | P13338 | RNA polymerase-associated protein Gp33 | Enterobacteria phage T4 (Bacteriophage T4) | 1 | 31 | 1 | 10 | 10 | MTQFSLNDIR | 76.05 |
| DP00899 | P44654 | Periplasmic nitrate reductase; electron transfer subunit (Diheme cytochrome c NapB) | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) | 28 | 62 | 37 | 44 | 8 | TQAAENIP | 88.21 |
| DP00900 | Q04660 | Ribosome biogenesis protein ERB1 (Eukaryotic ribosome biogenesis protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 535 | 570 | 544 | 552 | 9 | KSNLEVNEN | 82.83 |
| DP00900 | Q04660 | Ribosome biogenesis protein ERB1 (Eukaryotic ribosome biogenesis protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 535 | 570 | 559 | 565 | 7 | GENESAK | 74.25 |
| DP00902 | O32728 | RNA polymerase sigma factor | Geobacillus stearothermophilus (Bacillus stearothermophilus) | 1 | 101 | 32 | 38 | 7 | RDEIIEK | 89.97 |
| DP00902 | O32728 | RNA polymerase sigma factor | Geobacillus stearothermophilus (Bacillus stearothermophilus) | 1 | 101 | 40 | 96 | 57 | MRLVWSVVQRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQ | 83.52 |
| DP00902 | O32728 | RNA polymerase sigma factor | Geobacillus stearothermophilus (Bacillus stearothermophilus) | 159 | 250 | 169 | 193 | 25 | NDGDPITLLDQIADADEASWFDKIA | 80.84 |
| DP00902 | O32728 | RNA polymerase sigma factor | Geobacillus stearothermophilus (Bacillus stearothermophilus) | 159 | 250 | 204 | 215 | 12 | RERLIVYLRYYR | 85.76 |
| DP00902 | O32728 | RNA polymerase sigma factor | Geobacillus stearothermophilus (Bacillus stearothermophilus) | 159 | 250 | 236 | 245 | 10 | LEKKILQHIK | 83.08 |
| DP00903 | P47813 | Eukaryotic translation initiation factor 1A; X-chromosomal (eIF-1A X isoform) (Eukaryotic translation initiation factor 4C) (eIF-4C) | Homo sapiens (Human) | 124 | 144 | 125 | 135 | 11 | DDDEIQFDDIG | 75.8 |
| DP00904 | Q58876 | Uncharacterized protein MJ1481 | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) | 104 | 213 | 109 | 124 | 16 | EGALYIVSNKKLFKKL | 81.35 |
| DP00904 | Q58876 | Uncharacterized protein MJ1481 | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) | 104 | 213 | 138 | 149 | 12 | GMLDIEDMRAIG | 74.58 |
| DP00904 | Q58876 | Uncharacterized protein MJ1481 | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) | 104 | 213 | 168 | 208 | 41 | NVERFIEKYKPEKIFVVVEDDKDELLYLRAKNLYNAEKLDA | 82.85 |
| DP00907 | Q9HB71 | Calcyclin-binding protein (CacyBP) (hCacyBP) (S100A6-binding protein) (Siah-interacting protein) | Homo sapiens (Human) | 48 | 80 | 51 | 57 | 7 | KAELLDN | 75.63 |
| DP00907 | Q9HB71 | Calcyclin-binding protein (CacyBP) (hCacyBP) (S100A6-binding protein) (Siah-interacting protein) | Homo sapiens (Human) | 48 | 80 | 63 | 75 | 13 | VVAPITTGYTDGI | 76.28 |
| DP00908 | P9WJ35 | Antitoxin VapB30 | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 46 | 27 | 33 | 7 | EAVVTAL | 76.78 |
| DP00910 | P41567 | Eukaryotic translation initiation factor 1 (eIF1) (A121) (Protein translation factor SUI1 homolog) (Sui1iso1) | Homo sapiens (Human) | 1 | 28 | 3 | 14 | 12 | AIQNLHSFDPFA | 79.29 |
| DP00912 | Q8N4Q1 | Mitochondrial intermembrane space import and assembly protein 40 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 4) | Homo sapiens (Human) | 107 | 142 | 121 | 134 | 14 | AEQAEETAPIEATA | 75.25 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 2 | 9 | 8 | KFGFIAHP | 94.65 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 13 | 69 | 57 | GLKRYVKMLDLLQRNSTEQHSGYTRELWERQNLVPFMNFARITSATGATCEGVIKYM | 78.74 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 87 | 95 | 9 | VVQGIEELA | 79.34 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 103 | 111 | 9 | GLGGFTSIV | 83.5 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 129 | 151 | 23 | GNSLTTYAGYKALMQIQSWLEIR | 79.02 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 155 | 187 | 33 | EPVAIVGYPGSICLALSRLLLAHGFSLHLLHRA | 81.25 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 219 | 234 | 16 | RCKLFAAATSAGGVID | 78.57 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 239 | 250 | 12 | QPGSIFIDVALP | 78.93 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 262 | 319 | 58 | DDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAETIVLALENRRENFSLGRYLA | 84.86 |
| DP00913 | A0A0J9X1Q5 | Aminotransferase PigE (EC 2.6.1.-) | Serratia sp. (strain FS14) | 1 | 371 | 322 | 366 | 45 | KVLEIGEIAERHGFFAYPLASYGERIDRQSVTNLKRYYHHDIYAG | 82.07 |
| DP00915 | Q5JH72 | PCNA-inhibitor (Thermococcales inhibitor of PCNA) (TIP) | Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) | 1 | 27 | 4 | 11 | 8 | KLDEFIGD | 89.97 |
| DP00918 | A0MHA3 | Patellamide protein | uncultured Prochloron sp. | 36 | 64 | 38 | 53 | 16 | GLEASVTACITFCAYD | 88.52 |
| DP00919 | C6KEI3 | "Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein" | Human immunodeficiency virus 1 | 1 | 75 | 6 | 17 | 12 | SKSSIVGWPAIR | 76.25 |
| DP00919 | C6KEI3 | "Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein" | Human immunodeficiency virus 1 | 1 | 75 | 49 | 61 | 13 | HGALTSSNTDTTN | 75.25 |
| DP00919 | C6KEI3 | "Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein" | Human immunodeficiency virus 1 | 152 | 180 | 153 | 160 | 8 | GEVEEATE | 75.17 |
| DP00922 | P67966 | Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1) | Gallus gallus (Chicken) | 67 | 115 | 76 | 83 | 8 | GAGTLSTD | 74.58 |
| DP00922 | P67966 | Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1) | Gallus gallus (Chicken) | 67 | 115 | 88 | 94 | 7 | LGIKYEE | 80.94 |
| DP00926 | Q9BQB4 | Sclerostin | Homo sapiens (Human) | 25 | 79 | 25 | 42 | 18 | GWQAFKNDATEIIPELGE | 80.12 |
| DP00928 | P62552 | Antitoxin CcdA (LynA) (Protein H) (Protein LetA) | Escherichia coli (strain K12) | 1 | 72 | 2 | 36 | 35 | KQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEA | 79.73 |
| DP00928 | P62552 | Antitoxin CcdA (LynA) (Protein H) (Protein LetA) | Escherichia coli (strain K12) | 1 | 72 | 53 | 67 | 15 | AEVARFIEMNGSFAD | 78.64 |
| DP00928 | P62552 | Antitoxin CcdA (LynA) (Protein H) (Protein LetA) | Escherichia coli (strain K12) | 32 | 72 | 53 | 67 | 15 | AEVARFIEMNGSFAD | 78.64 |
| DP00928 | P62552 | Antitoxin CcdA (LynA) (Protein H) (Protein LetA) | Escherichia coli (strain K12) | 37 | 72 | 53 | 67 | 15 | AEVARFIEMNGSFAD | 78.64 |
| DP00928 | P62552 | Antitoxin CcdA (LynA) (Protein H) (Protein LetA) | Escherichia coli (strain K12) | 41 | 72 | 53 | 67 | 15 | AEVARFIEMNGSFAD | 78.64 |
| DP00928 | P62552 | Antitoxin CcdA (LynA) (Protein H) (Protein LetA) | Escherichia coli (strain K12) | 46 | 72 | 53 | 67 | 15 | AEVARFIEMNGSFAD | 78.64 |
| DP00928 | P62552 | Antitoxin CcdA (LynA) (Protein H) (Protein LetA) | Escherichia coli (strain K12) | 46 | 71 | 53 | 66 | 14 | AEVARFIEMNGSFA | 78.74 |
| DP00929 | P04608 | Protein Tat (Transactivating regulatory protein) | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) | 1 | 86 | 34 | 49 | 16 | CQVCFITKALGISYGR | 82.38 |
| DP00929 | P04608 | Protein Tat (Transactivating regulatory protein) | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) | 1 | 86 | 65 | 71 | 7 | HQASLSK | 74.44 |
| DP00929 | P04608 | Protein Tat (Transactivating regulatory protein) | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) | 50 | 86 | 65 | 71 | 7 | HQASLSK | 74.44 |
| DP00931 | Q5ZYC9 | IcmR | Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) | 1 | 27 | 1 | 16 | 16 | MGNNTDDSARNPFGFY | 76.76 |
| DP00932 | P35926 | Recombination enhancement function protein | Escherichia phage P1 (Bacteriophage P1) | 1 | 76 | 4 | 15 | 12 | IEQKIEQCRKWQ | 85.28 |
| DP00934 | P61925 | cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform) | Homo sapiens (Human) | 1 | 76 | 2 | 15 | 14 | TDVETTYADFIASG | 79.34 |
| DP00934 | P61925 | cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor; muscle/brain isoform) | Homo sapiens (Human) | 1 | 76 | 22 | 51 | 30 | AIHDILVSSASGNSNELALKLAGLDINKTE | 77.65 |
| DP00937 | Q12972 | Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1) | Homo sapiens (Human) | 144 | 225 | 163 | 172 | 10 | LDNLTEFNTA | 85.82 |
| DP00937 | Q12972 | Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1) | Homo sapiens (Human) | 144 | 225 | 176 | 190 | 15 | RISTLTIEEGNLDIQ | 80.25 |
| DP00937 | Q12972 | Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1) | Homo sapiens (Human) | 144 | 225 | 199 | 211 | 13 | SRVTFSEDDEIIN | 90.17 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 332 | 13 | 21 | 9 | TDFLEEWKA | 78.3 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 332 | 51 | 65 | 15 | LAQTTAAGTSELNHG | 77.95 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 332 | 156 | 171 | 16 | GVVNIPAAECLDEYED | 90.05 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 332 | 181 | 197 | 17 | REDAITQQNTIQNEAAS | 80.64 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 332 | 218 | 233 | 16 | YKSTISAPEEEILNRY | 79.08 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 332 | 250 | 265 | 16 | APANFASSSTLEKRIE | 76.71 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 332 | 295 | 305 | 11 | LKEEIDLLNRD | 75.31 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 290 | 13 | 21 | 9 | TDFLEEWKA | 78.3 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 290 | 51 | 65 | 15 | LAQTTAAGTSELNHG | 77.95 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 290 | 156 | 171 | 16 | GVVNIPAAECLDEYED | 90.05 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 290 | 181 | 197 | 17 | REDAITQQNTIQNEAAS | 80.64 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 290 | 218 | 233 | 16 | YKSTISAPEEEILNRY | 79.08 |
| DP00940 | Q62627 | PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) | Rattus norvegicus (Rat) | 1 | 290 | 250 | 265 | 16 | APANFASSSTLEKRIE | 76.71 |
| DP00943 | O35274 | Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130) | Rattus norvegicus (Rat) | 1 | 154 | 19 | 29 | 11 | HRSAYEAGIQA | 78.78 |
| DP00943 | O35274 | Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130) | Rattus norvegicus (Rat) | 1 | 154 | 57 | 67 | 11 | IKSMFLQMGTT | 75.55 |
| DP00943 | O35274 | Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130) | Rattus norvegicus (Rat) | 1 | 154 | 109 | 124 | 16 | ALLKLGTSVSERVSRF | 74.16 |
| DP00943 | O35274 | Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130) | Rattus norvegicus (Rat) | 417 | 494 | 447 | 468 | 22 | RKIHFSTAPIQVFSTYSNEDYD | 80.1 |
| DP00943 | O35274 | Neurabin-2 (Neurabin-II) (Neural tissue-specific F-actin-binding protein II) (PP1bp134) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) (p130) | Rattus norvegicus (Rat) | 417 | 494 | 478 | 487 | 10 | AASAEYELEK | 76.69 |
| DP00944 | P12736 | 50S ribosomal protein L32e (Hl5) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 1 | 94 | 10 | 21 | 12 | AEEEYTELTDIS | 77.87 |
| DP00944 | P12736 | 50S ribosomal protein L32e (Hl5) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 1 | 94 | 34 | 41 | 8 | AGFESVED | 79.93 |
| DP00944 | P12736 | 50S ribosomal protein L32e (Hl5) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 1 | 94 | 46 | 65 | 20 | DQSALADVSGIGNALAARIK | 77.26 |
| DP00944 | P12736 | 50S ribosomal protein L32e (Hl5) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 1 | 94 | 71 | 84 | 14 | LEVESETEAEVEEE | 76.54 |
| DP00947 | O10609 | Protein E7 | Human papillomavirus 45 | 1 | 41 | 7 | 16 | 10 | TLQEIVLHLE | 80.43 |
| DP00947 | O10609 | Protein E7 | Human papillomavirus 45 | 1 | 41 | 24 | 36 | 13 | VDLLCYEQLSESE | 79.78 |
| DP00947 | O10609 | Protein E7 | Human papillomavirus 45 | 72 | 106 | 72 | 81 | 10 | RIELTVESSA | 78.36 |
| DP00947 | O10609 | Protein E7 | Human papillomavirus 45 | 72 | 106 | 86 | 101 | 16 | TLQQLFLSTLSFVCPW | 83.36 |
| DP00948 | P59595 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 161 | 210 | 169 | 176 | 8 | PKGFYAEG | 78.43 |
| DP00948 | P59595 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 168 | 208 | 169 | 176 | 8 | PKGFYAEG | 78.43 |
| DP00948 | P59595 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 182 | 247 | 218 | 226 | 9 | TALALLLLD | 85.88 |
| DP00948 | P59595 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 182 | 247 | 228 | 234 | 7 | LNQLESK | 73.96 |
| DP00948 | P59595 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 343 | 402 | 348 | 364 | 17 | KDNVILLNKHIDAYKTF | 80.86 |
| DP00948 | P59595 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 366 | 422 | 407 | 413 | 7 | QLQNSMS | 84.62 |
| DP00949 | Q9HAU5 | Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) | Homo sapiens (Human) | 430 | 486 | 455 | 481 | 27 | EGGIWEDEDARNFYENLIDLKAFVPAI | 81.79 |
| DP00949 | Q9HAU5 | Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) | Homo sapiens (Human) | 481 | 530 | 517 | 525 | 9 | DLELELENL | 80.45 |
| DP00949 | Q9HAU5 | Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) | Homo sapiens (Human) | 1105 | 1129 | 1110 | 1118 | 9 | DEDFIQALD | 80.16 |
| DP00949 | Q9HAU5 | Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) | Homo sapiens (Human) | 1167 | 1207 | 1181 | 1187 | 7 | QQFKILN | 82.61 |
| DP00949 | Q9HAU5 | Regulator of nonsense transcripts 2 (Nonsense mRNA reducing factor 2) (Up-frameshift suppressor 2 homolog) (hUpf2) | Homo sapiens (Human) | 1167 | 1207 | 1195 | 1202 | 8 | AANHWNQQ | 79.52 |
| DP00951 | P17677 | Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46) | Homo sapiens (Human) | 1 | 238 | 16 | 22 | 7 | DDQKIEQ | 83.61 |
| DP00951 | P17677 | Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46) | Homo sapiens (Human) | 1 | 238 | 34 | 47 | 14 | AATKIQASFRGHIT | 77.81 |
| DP00951 | P17677 | Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46) | Homo sapiens (Human) | 1 | 238 | 59 | 67 | 9 | VQAAEAEAN | 77.26 |
| DP00951 | P17677 | Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46) | Homo sapiens (Human) | 1 | 238 | 116 | 122 | 7 | GDAATEQ | 75.25 |
| DP00951 | P17677 | Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46) | Homo sapiens (Human) | 1 | 238 | 172 | 182 | 11 | AAVTAAAATTP | 78.96 |
| DP00951 | P17677 | Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46) | Homo sapiens (Human) | 1 | 238 | 203 | 213 | 11 | SQAEENIEAVD | 77.14 |
| DP00953 | Q9H832 | Ubiquitin-conjugating enzyme E2 Z (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme Z) (Uba6-specific E2 conjugating enzyme 1) (Use1) (Ubiquitin carrier protein Z) (Ubiquitin-protein ligase Z) | Homo sapiens (Human) | 1 | 99 | 76 | 84 | 9 | GAALLSHWD | 79.86 |
| DP00954 | Q9YGY0 | Axin-1 (Axis inhibition protein 1) (xAxin) | Xenopus laevis (African clawed frog) | 435 | 465 | 445 | 455 | 11 | HHFNSRYSETG | 78.29 |
| DP00955 | P06836 | Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43) | Bos taurus (Bovine) | 1 | 242 | 16 | 22 | 7 | EDQKIEQ | 82.61 |
| DP00955 | P06836 | Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43) | Bos taurus (Bovine) | 1 | 242 | 34 | 47 | 14 | AATKIQASFRGHIT | 77.81 |
| DP00955 | P06836 | Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43) | Bos taurus (Bovine) | 1 | 242 | 61 | 77 | 17 | AAEAEANEKDEAAVAEG | 78.32 |
| DP00955 | P06836 | Neuromodulin (Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43) | Bos taurus (Bovine) | 1 | 242 | 176 | 185 | 10 | AAVTAAAATA | 79.06 |
| DP00957 | C0J347 | SBDS-like protein | Trypanosoma cruzi | 264 | 464 | 265 | 272 | 8 | DAELIARA | 92.64 |
| DP00957 | C0J347 | SBDS-like protein | Trypanosoma cruzi | 264 | 464 | 331 | 341 | 11 | QTVTTAELSST | 80.05 |
| DP00957 | C0J347 | SBDS-like protein | Trypanosoma cruzi | 264 | 464 | 352 | 365 | 14 | LKVALSKLVLDETN | 78.93 |
| DP00957 | C0J347 | SBDS-like protein | Trypanosoma cruzi | 264 | 464 | 415 | 422 | 8 | EEVLVNRK | 74.92 |
| DP00957 | C0J347 | SBDS-like protein | Trypanosoma cruzi | 264 | 464 | 437 | 445 | 9 | KRNEYWNDA | 77.07 |
| DP00957 | C0J347 | SBDS-like protein | Trypanosoma cruzi | 264 | 464 | 448 | 456 | 9 | DDYDYGYED | 74.73 |
| DP00958 | P46984 | EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 123 | 13 | 19 | 7 | GVEKSFA | 75.35 |
| DP00958 | P46984 | EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 123 | 61 | 87 | 27 | GSQLTYLGQLRTQLTGLQDDINEFLTG | 78.67 |
| DP00958 | P46984 | EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 123 | 105 | 115 | 11 | IQEEINQLLDG | 83.34 |
| DP00958 | P46984 | EKC/KEOPS complex subunit GON7 (Low-dye-binding protein 6) (Polarized growth chromatin-associated controller 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 65 | 113 | 77 | 87 | 11 | LQDDINEFLTG | 82.61 |
| DP00959 | O15169 | Axin-1 (Axis inhibition protein 1) (hAxin) | Homo sapiens (Human) | 295 | 500 | 301 | 313 | 13 | VNPYYVNAGYALA | 79.21 |
| DP00959 | O15169 | Axin-1 (Axis inhibition protein 1) (hAxin) | Homo sapiens (Human) | 295 | 500 | 322 | 328 | 7 | EQQSLSS | 81.08 |
| DP00959 | O15169 | Axin-1 (Axis inhibition protein 1) (hAxin) | Homo sapiens (Human) | 295 | 500 | 330 | 337 | 8 | ADTLSLTD | 79.43 |
| DP00959 | O15169 | Axin-1 (Axis inhibition protein 1) (hAxin) | Homo sapiens (Human) | 295 | 500 | 384 | 394 | 11 | EPQKFAEELIH | 81.88 |
| DP00959 | O15169 | Axin-1 (Axis inhibition protein 1) (hAxin) | Homo sapiens (Human) | 295 | 500 | 466 | 472 | 7 | NPESILD | 75.92 |
| DP00961 | P52630 | Signal transducer and activator of transcription 2 (p113) | Homo sapiens (Human) | 786 | 816 | 802 | 811 | 10 | PMEIFRNCVK | 82.14 |
| DP00961 | P52630 | Signal transducer and activator of transcription 2 (p113) | Homo sapiens (Human) | 817 | 838 | 824 | 833 | 10 | AGQNTVDEVY | 80.2 |
| DP00962 | P42224 | Signal transducer and activator of transcription 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) | Homo sapiens (Human) | 720 | 750 | 733 | 745 | 13 | EVSRIVGSVEFDS | 84.44 |
| DP00965 | P0C6L3 | Small delta antigen (S-HDAg) (p24) | Hepatitis delta virus genotype I (isolate D380) (HDV) | 12 | 60 | 14 | 23 | 10 | EEVLEQWVSG | 77.86 |
| DP00968 | Q60795 | Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2) | Mus musculus (Mouse) | 1 | 98 | 16 | 29 | 14 | DMDLIDILWRQDID | 76.73 |
| DP00968 | Q60795 | Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2) | Mus musculus (Mouse) | 1 | 98 | 33 | 41 | 9 | SREVFDFSQ | 78.6 |
| DP00968 | Q60795 | Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nuclear factor; erythroid derived 2; like 2) | Mus musculus (Mouse) | 1 | 98 | 66 | 93 | 28 | QEKAFFAQFQLDEETGEFLPIQPAQHIQ | 79.23 |
| DP00969 | Q02548 | Paired box protein Pax-5 (B-cell-specific transcription factor) (BSAP) | Homo sapiens (Human) | 1 | 30 | 18 | 25 | 8 | GGVNQLGG | 76.09 |
| DP00970 | P0ABD8 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) | Escherichia coli (strain K12) | 1 | 77 | 2 | 25 | 24 | DIRKIKKLIELVEESGISELEISE | 76 |
| DP00970 | P0ABD8 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) | Escherichia coli (strain K12) | 1 | 77 | 44 | 52 | 9 | MQQAYAAPM | 77.74 |
| DP00970 | P0ABD8 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) | Escherichia coli (strain K12) | 1 | 77 | 57 | 70 | 14 | AQSNAAAPATVPSM | 77.26 |
| DP00973 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 1 | 204 | 10 | 16 | 7 | RSSWYWG | 87.58 |
| DP00973 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 1 | 204 | 22 | 29 | 8 | EAVALLQG | 80.89 |
| DP00973 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 1 | 204 | 31 | 43 | 13 | RHGVFLVRDSSTS | 84.46 |
| DP00973 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 1 | 204 | 45 | 54 | 10 | GDYVLSVSEN | 78.46 |
| DP00973 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 1 | 204 | 56 | 64 | 9 | RVSHYIINS | 84.36 |
| DP00973 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 1 | 204 | 90 | 117 | 28 | GDQEFDSLPALLEFYKIHYLDTTTLIEP | 83.6 |
| DP00973 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 1 | 204 | 124 | 146 | 23 | GSGVILRQEEAEYVRALFDFNGN | 81.42 |
| DP00973 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 1 | 204 | 166 | 174 | 9 | EEQWWNAED | 85.43 |
| DP00973 | P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | Homo sapiens (Human) | 1 | 204 | 182 | 191 | 10 | IPVPYVEKYR | 78.8 |
| DP00974 | P42866 | Mu-type opioid receptor (M-OR-1) (MOR-1) | Mus musculus (Mouse) | 1 | 51 | 26 | 34 | 9 | PGSWLNLSH | 74.69 |
| DP00974 | P42866 | Mu-type opioid receptor (M-OR-1) (MOR-1) | Mus musculus (Mouse) | 361 | 398 | 384 | 393 | 10 | NHQLENLEAE | 77.06 |
| DP00975 | Q86FP9 | Thrombin inhibitor madanin 1 | Haemaphysalis longicornis (Bush tick) | 20 | 79 | 47 | 56 | 10 | GDADYDEYEE | 77.26 |
| DP00975 | Q86FP9 | Thrombin inhibitor madanin 1 | Haemaphysalis longicornis (Bush tick) | 50 | 73 | 50 | 56 | 7 | DYDEYEE | 77.26 |
| DP00976 | P04578 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) | 127 | 196 | 136 | 149 | 14 | NDTNTNSSSGRMIM | 79.93 |
| DP00976 | P04578 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) | 127 | 196 | 155 | 165 | 11 | KNCSFNISTSI | 81.42 |
| DP00976 | P04578 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) | 127 | 196 | 169 | 185 | 17 | VQKEYAFFYKLDIIPID | 81.57 |
| DP00976 | P04578 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) | 297 | 331 | 315 | 324 | 10 | RAFVTIGKIG | 86.66 |
| DP00977 | Q86FP8 | Thrombin inhibitor madanin 2 | Haemaphysalis longicornis (Bush tick) | 20 | 80 | 41 | 58 | 18 | VQERYQGNQGDYDEYDQD | 81.03 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 34 | 41 | 8 | WVTVYYGV | 79.47 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 48 | 71 | 24 | TTTLFCASDAKAYDTEVHNVWATH | 79.89 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 81 | 114 | 34 | QEVKLENVTENFNMWKNNMVEQMHEDIISLWDQS | 82.85 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 124 | 132 | 9 | LCVTLNCTD | 86.96 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 135 | 147 | 13 | NATNTTSSSWETM | 77.05 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 153 | 165 | 13 | KNCSFNITTSIRD | 77.03 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 167 | 200 | 34 | VQKEYALFYNLDVVPIDNASYRLISCNTSVITQA | 81.71 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 217 | 230 | 14 | AGFAILKCNDKKFN | 79.55 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 236 | 246 | 11 | TNVSTVQCTHG | 77.26 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 252 | 293 | 42 | STQLLLNGSLAEEEIVIRSENFTNNAKTIIVQLNESVVINCT | 82.54 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 308 | 322 | 15 | GRALYTTGEIIGDIR | 85.26 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 324 | 359 | 36 | AHCNLSKTQWENTLEQIAIKLKEQFGNNKTIIFNPS | 81.41 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 362 | 391 | 30 | GDPEIVTHSFNCGGEFFYCNSTQLFTWNDT | 85.65 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 393 | 403 | 11 | KLNNTGRNITL | 77.17 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 407 | 423 | 17 | IKQIINMWQEVGKAMYA | 77 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 432 | 441 | 10 | CSSNITGLLL | 79.26 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 33 | 498 | 467 | 479 | 13 | RSELYKYKVVKIE | 85.16 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 127 | 193 | 135 | 147 | 13 | NATNTTSSSWETM | 77.05 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 127 | 193 | 153 | 165 | 13 | KNCSFNITTSIRD | 77.03 |
| DP00978 | P35961 | Envelope glycoprotein gp160 (Env polyprotein) Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41) | Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) | 127 | 193 | 167 | 188 | 22 | VQKEYALFYNLDVVPIDNASYR | 81.83 |
| DP00980 | P36595 | DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (DNA-directed RNA polymerases I; II; and III 15 kDa polypeptide) (RPC16) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 59 | 14 | 28 | 15 | GAVMEEEVDELEMID | 77.26 |
| DP00980 | P36595 | DNA-directed RNA polymerases I; II; and III subunit RPABC2 (RNA polymerases I; II; and III subunit ABC2) (DNA-directed RNA polymerases I; II; and III 15 kDa polypeptide) (RPC16) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 59 | 44 | 54 | 11 | STTVITEDVAS | 81.33 |
| DP00984 | P12357 | Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) | Spinacia oleracea (Spinach) | 70 | 164 | 73 | 99 | 27 | PSLVISLSTGLSLFLGRFVFFNFQREN | 82.26 |
| DP00984 | P12357 | Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) | Spinacia oleracea (Spinach) | 70 | 164 | 109 | 117 | 9 | GMSHFEAGD | 82.61 |
| DP00984 | P12357 | Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) | Spinacia oleracea (Spinach) | 70 | 164 | 119 | 130 | 12 | RAKEYVSLLKSN | 77.01 |
| DP00984 | P12357 | Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) | Spinacia oleracea (Spinach) | 70 | 164 | 133 | 159 | 27 | VGFNIVDVLAWGSIGHIVAYYILATAS | 82.87 |
| DP00984 | P12357 | Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) | Spinacia oleracea (Spinach) | 73 | 167 | 73 | 99 | 27 | PSLVISLSTGLSLFLGRFVFFNFQREN | 82.26 |
| DP00984 | P12357 | Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) | Spinacia oleracea (Spinach) | 73 | 167 | 109 | 117 | 9 | GMSHFEAGD | 82.61 |
| DP00984 | P12357 | Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) | Spinacia oleracea (Spinach) | 73 | 167 | 119 | 130 | 12 | RAKEYVSLLKSN | 77.01 |
| DP00984 | P12357 | Photosystem I reaction center subunit V; chloroplastic (PSI-G) (Photosystem I 9 kDa protein) | Spinacia oleracea (Spinach) | 73 | 167 | 133 | 162 | 30 | VGFNIVDVLAWGSIGHIVAYYILATASNGY | 82.11 |
| DP00985 | Q87WW0 | Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) (SAT) | Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) | 217 | 305 | 219 | 236 | 18 | NGTLIMIDDERILEHLTD | 79.1 |
| DP00985 | Q87WW0 | Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) (SAT) | Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) | 217 | 305 | 259 | 280 | 22 | GAVESEATSLTDIIQEMLLTRT | 77.55 |
| DP00986 | Q8QWD4 | VP4 (Fragment) | Human enterovirus D68 (EV68) (EV-68) | 2 | 29 | 14 | 24 | 11 | ENANIATNGSH | 84.16 |
| DP00990 | P12355 | Photosystem I reaction center subunit III; chloroplastic (Light-harvesting complex I 17 kDa protein) (PSI-F) | Spinacia oleracea (Spinach) | 1 | 77 | 1 | 11 | 11 | MSFTIPTNLYK | 82.82 |
| DP00990 | P12355 | Photosystem I reaction center subunit III; chloroplastic (Light-harvesting complex I 17 kDa protein) (PSI-F) | Spinacia oleracea (Spinach) | 1 | 77 | 54 | 70 | 17 | AAAALALSSVLLSSWSV | 79.38 |
| DP00992 | P27356 | Methane monooxygenase regulatory protein B | Methylosinus trichosporium | 1 | 35 | 4 | 30 | 27 | AHNAYNAGIMQKTGKAFADEFFAEENQ | 80.04 |
| DP00993 | Q9I332 | Translocation protein in type III secretion | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) | 1 | 253 | 25 | 35 | 11 | RAQQIAFEQAL | 79.2 |
| DP00993 | Q9I332 | Translocation protein in type III secretion | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) | 1 | 253 | 50 | 60 | 11 | GDETTEAAATA | 74.7 |
| DP00993 | Q9I332 | Translocation protein in type III secretion | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) | 1 | 253 | 191 | 197 | 7 | TAQASVQ | 80.27 |
| DP00993 | Q9I332 | Translocation protein in type III secretion | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) | 1 | 253 | 242 | 248 | 7 | GDRLLAR | 75.59 |
| DP00993 | Q9I332 | Translocation protein in type III secretion | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) | 20 | 40 | 25 | 35 | 11 | RAQQIAFEQAL | 79.2 |
| DP00994 | P39015 | Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 142 | 168 | 146 | 163 | 18 | TAQLSLQDYLNQQANNQF | 80.01 |
| DP00994 | P39015 | Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 177 | 273 | 202 | 234 | 33 | KTKEYLEFDATFVESNTRKNFGDRNNNSRNNFN | 86.43 |
| DP00994 | P39015 | Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 177 | 273 | 244 | 268 | 25 | KGNNTANATNSANTVQKNRNIDVSN | 77.95 |
| DP00994 | P39015 | Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 273 | 202 | 234 | 33 | KTKEYLEFDATFVESNTRKNFGDRNNNSRNNFN | 86.43 |
| DP00994 | P39015 | Suppressor protein STM1 (3BP1) (GU4 nucleic-binding protein 2) (G4p2 protein) (POP2 multicopy suppressor protein 4) (Ribosomal subunits association factor) (AF) (TOM1 suppressor protein 1) (Triplex-binding protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 273 | 244 | 268 | 25 | KGNNTANATNSANTVQKNRNIDVSN | 77.95 |
| DP00995 | P01097 | ATPase inhibitor; mitochondrial (ATP synthase F1 subunit epsilon) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 28 | 50 | 35 | 43 | 9 | SEDSFVKRE | 73.91 |
| DP00997 | P0A4T9 | HTH-type transcriptional activator TipA | Streptomyces lividans | 111 | 159 | 111 | 127 | 17 | GINLTPEEKFEVFGDFD | 79.82 |
| DP00997 | P0A4T9 | HTH-type transcriptional activator TipA | Streptomyces lividans | 111 | 159 | 141 | 147 | 7 | NTDAYRQ | 74.58 |
| DP00998 | Q05127 | Polymerase cofactor VP35 (Ebola VP35) (eVP35) | Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) | 20 | 48 | 25 | 36 | 12 | LSGWISEQLMTG | 80.85 |
| DP00999 | P03315 | Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) | Semliki forest virus (SFV) | 119 | 260 | 131 | 137 | 7 | GYACLVG | 73.91 |
| DP00999 | P03315 | Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) | Semliki forest virus (SFV) | 119 | 260 | 146 | 152 | 7 | VKGVIDN | 73.96 |
| DP00999 | P03315 | Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) | Semliki forest virus (SFV) | 119 | 260 | 156 | 174 | 19 | AKLAFKKSSKYDLECAQIP | 79.93 |
| DP00999 | P03315 | Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) | Semliki forest virus (SFV) | 119 | 260 | 189 | 210 | 22 | PEGHYNWHHGAVQYSGGRFTIP | 81.06 |
| DP00999 | P03315 | Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) | Semliki forest virus (SFV) | 119 | 260 | 229 | 241 | 13 | RVVAIVLGGANEG | 83.71 |
| DP00999 | P03315 | Structural polyprotein (p130) Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C); Precursor of protein E3/E2 (p62) (pE2); Assembly protein E3; Spike glycoprotein E2 (E2 envelope glycoprotein); 6K protein; Spike glycoprotein E1 (E1 envelope glycoprotein) | Semliki forest virus (SFV) | 119 | 260 | 246 | 255 | 10 | LSVVTWNKDM | 90.13 |
| DP01009 | P97303 | Transcription regulator protein BACH2 (BTB and CNC homolog 2) | Mus musculus (Mouse) | 331 | 520 | 340 | 354 | 15 | LRSLFGITKGVESTG | 80.4 |
| DP01009 | P97303 | Transcription regulator protein BACH2 (BTB and CNC homolog 2) | Mus musculus (Mouse) | 331 | 520 | 367 | 383 | 17 | SACPFNKGISQGDLKTD | 75.66 |
| DP01009 | P97303 | Transcription regulator protein BACH2 (BTB and CNC homolog 2) | Mus musculus (Mouse) | 331 | 520 | 387 | 393 | 7 | LAGNYGQ | 91.3 |
| DP01009 | P97303 | Transcription regulator protein BACH2 (BTB and CNC homolog 2) | Mus musculus (Mouse) | 331 | 520 | 400 | 407 | 8 | DVSNFAMG | 91.97 |
| DP01009 | P97303 | Transcription regulator protein BACH2 (BTB and CNC homolog 2) | Mus musculus (Mouse) | 331 | 520 | 427 | 436 | 10 | RRSVIFSASA | 81.04 |
| DP01009 | P97303 | Transcription regulator protein BACH2 (BTB and CNC homolog 2) | Mus musculus (Mouse) | 331 | 520 | 444 | 454 | 11 | VHSYSAVSNLD | 79.72 |
| DP01009 | P97303 | Transcription regulator protein BACH2 (BTB and CNC homolog 2) | Mus musculus (Mouse) | 331 | 520 | 475 | 483 | 9 | SSQAYSHSG | 75.77 |
| DP01011 | P68390 | Ovomucoid | Meleagris gallopavo (Wild turkey) | 1 | 65 | 17 | 25 | 9 | KDVLVCTED | 75.62 |
| DP01011 | P68390 | Ovomucoid | Meleagris gallopavo (Wild turkey) | 1 | 65 | 38 | 55 | 18 | SECLLCAYNIEYGTNISK | 79.58 |
| DP01014 | O94742 | 26S proteasome complex subunit SEM1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 89 | 3 | 18 | 16 | TDVAAAQAQSKIDLTK | 84.34 |
| DP01014 | O94742 | 26S proteasome complex subunit SEM1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 89 | 36 | 65 | 30 | EDFPIDTWANGETIKSNAVTQTNIWEENWD | 81.56 |
| DP01015 | Q83AR4 | Elongation factor P (EF-P) | Coxiella burnetii (strain RSA 493 / Nine Mile phase I) | 132 | 188 | 159 | 176 | 18 | GAVVRVPLFLNEGEIIKV | 78.86 |
| DP01016 | Q20MD5 | Matrix protein 2 (Fragment) | Influenza A virus (strain A/Udorn/1972 H3N2) | 1 | 21 | 1 | 10 | 10 | MSLLTEVETP | 77.06 |
| DP01022 | Q6URW6 | Myosin-14 (Myosin heavy chain 14) (Myosin heavy chain; non-muscle IIc) (Non-muscle myosin heavy chain IIc) (NMHC II-C) | Mus musculus (Mouse) | 1954 | 2000 | 1961 | 1978 | 18 | VRQVFRLEEGVASDEEEA | 76.14 |
| DP01025 | P02619 | Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2) | Esox lucius (Northern pike) | 1 | 107 | 8 | 39 | 32 | ADVAAALAACSAADSFKHKEFFAKVGLASKSL | 75.56 |
| DP01025 | P02619 | Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2) | Esox lucius (Northern pike) | 1 | 107 | 43 | 51 | 9 | KKAFYVIDQ | 82.09 |
| DP01025 | P02619 | Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2) | Esox lucius (Northern pike) | 1 | 107 | 53 | 88 | 36 | KSGFIEEDELKLFLQNFSPSARALTDAETKAFLADG | 77.19 |
| DP01025 | P02619 | Parvalbumin beta (Parvalbumin II) (Parvalbumin pI 4.10) (Parvalbumin-2) | Esox lucius (Northern pike) | 1 | 107 | 92 | 102 | 11 | GDGMIGVDEFA | 79.93 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2131 | 2145 | 15 | AVAHILGIRDVASIN | 81.03 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2155 | 2169 | 15 | LDSLMGVEVRQILER | 73.58 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2171 | 2177 | 7 | HDLVLSM | 85.67 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2180 | 2196 | 17 | VRQLSLRKLQELSSKTS | 78.52 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2213 | 2228 | 16 | RQQATLNLSTLLVNPE | 80.1 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2251 | 2277 | 27 | IEGSITVFHGLAAKLSIPTYGLQCTGA | 75.87 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2280 | 2296 | 17 | LDSIQSLASYYIECIRQ | 80.56 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2301 | 2320 | 20 | GPYRIAGYSYGACVAFEMCS | 78.11 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2332 | 2354 | 23 | NHSLFLFDGSHTFVLAYTQSVRA | 87.09 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2359 | 2379 | 21 | GCEAEAEAKAMYFFVQQFTDM | 78.26 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2382 | 2407 | 26 | GKVLEALIPLQGLEARVAATVDLITQ | 81.98 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2415 | 2449 | 35 | HALSFAARSFYQKLRAAENYWPQATYHGNVTLLRA | 82.7 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2459 | 2467 | 9 | LGADYNLSQ | 79.82 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2474 | 2480 | 7 | SVHVIEG | 79.55 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2112 | 2512 | 2490 | 2501 | 12 | GLESILSIIHSC | 88.46 |
| DP01026 | A5YV76 | 3-hydroxyacyl-acyl-carrier-protein dehydratase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59) (3-oxoacyl-acyl-carrier-protein reductase) (3-oxoacyl-acyl-carrier-protein synthase) (Acyl-acyl-carrier-protein hydrolase) (Enoyl-acyl-carrier-protein reductase) (Fatty acid synthase) (Acyl-carrier-protein S-acetyltransferase) (Acyl-carrier-protein S-malonyltransferase) | Sus scrofa (Pig) | 2188 | 2212 | 2188 | 2196 | 9 | LQELSSKTS | 82.61 |
| DP01028 | Q59471 | Diol dehydrase beta subunit (EC 4.2.1.28) | Klebsiella oxytoca | 1 | 45 | 7 | 19 | 13 | LLRQIIEDVLSEM | 79.5 |
| DP01028 | Q59471 | Diol dehydrase beta subunit (EC 4.2.1.28) | Klebsiella oxytoca | 1 | 45 | 24 | 35 | 12 | KPVSFNAPAASA | 81.61 |
| DP01029 | Q59472 | Diol dehydrase gamma subunit (EC 4.2.1.28) (Propanediol dehydratase) (Propanediol dehydratase small subunit PduE) | Klebsiella oxytoca | 1 | 36 | 2 | 16 | 15 | NTDAIESMVRDVLSR | 77.61 |
| DP01031 | Q99IB8 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 2a (isolate JFH-1) (HCV) | 2224 | 2317 | 2231 | 2246 | 16 | VDANLLMEGGVAQTEP | 80.27 |
| DP01032 | Q06556 | Fibronectin binding protein | Streptococcus dysgalactiae | 810 | 969 | 815 | 831 | 17 | GENNLGGQSEEITITED | 81.84 |
| DP01032 | Q06556 | Fibronectin binding protein | Streptococcus dysgalactiae | 810 | 969 | 855 | 873 | 19 | SQEDIVLGGPGQVIDFTED | 77.57 |
| DP01032 | Q06556 | Fibronectin binding protein | Streptococcus dysgalactiae | 810 | 969 | 882 | 889 | 8 | NSHTITED | 79.93 |
| DP01032 | Q06556 | Fibronectin binding protein | Streptococcus dysgalactiae | 810 | 969 | 895 | 901 | 7 | EDEVIIG | 94.46 |
| DP01032 | Q06556 | Fibronectin binding protein | Streptococcus dysgalactiae | 810 | 969 | 903 | 912 | 10 | QGQVIDFTED | 80 |
| DP01032 | Q06556 | Fibronectin binding protein | Streptococcus dysgalactiae | 810 | 969 | 926 | 932 | 7 | GTVLEED | 80.27 |
| DP01032 | Q06556 | Fibronectin binding protein | Streptococcus dysgalactiae | 810 | 969 | 938 | 944 | 7 | EDEVIIG | 94.46 |
| DP01032 | Q06556 | Fibronectin binding protein | Streptococcus dysgalactiae | 810 | 969 | 946 | 955 | 10 | QGQVIDFTED | 80 |
| DP01033 | Q91006 | Tropomodulin | Gallus gallus (Chicken) | 1 | 92 | 18 | 27 | 10 | ILGALTEEEL | 73.91 |
| DP01033 | Q91006 | Tropomodulin | Gallus gallus (Chicken) | 1 | 92 | 29 | 38 | 10 | KLENELEELD | 76.25 |
| DP01034 | P73124 | Ssl1911 protein | Synechocystis sp. (strain PCC 6803 / Kazusa) | 1 | 65 | 4 | 12 | 9 | QQQARALMM | 73.91 |
| DP01034 | P73124 | Ssl1911 protein | Synechocystis sp. (strain PCC 6803 / Kazusa) | 1 | 65 | 14 | 20 | 7 | HHQFIKN | 84.09 |
| DP01034 | P73124 | Ssl1911 protein | Synechocystis sp. (strain PCC 6803 / Kazusa) | 1 | 65 | 29 | 45 | 17 | AAAEIGVEAEKDFWTTV | 81.88 |
| DP01035 | Q39805 | Dehydrin-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 226 | 14 | 20 | 7 | KVDEYGN | 75.35 |
| DP01035 | Q39805 | Dehydrin-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 226 | 24 | 30 | 7 | QTDEYGN | 73.91 |
| DP01035 | Q39805 | Dehydrin-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 226 | 34 | 43 | 10 | AASVTYVATR | 85.15 |
| DP01035 | Q39805 | Dehydrin-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 226 | 45 | 51 | 7 | AAGGYSD | 74.77 |
| DP01035 | Q39805 | Dehydrin-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 226 | 59 | 65 | 7 | TTNAYGV | 87.29 |
| DP01035 | Q39805 | Dehydrin-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 226 | 100 | 108 | 9 | TTGVYGIDT | 79.93 |
| DP01035 | Q39805 | Dehydrin-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 226 | 126 | 140 | 15 | QHGNIGGPYYGTNTA | 80.71 |
| DP01036 | I1JLC8 | Protein SLE2 (Em protein) (Protein Glycine max physiologically mature 11) (Protein GmD-19) (Soybean group-1 late embryogenesis abundant protein 2) (Soybean group-1 lea protein 2) (Sle2) | Glycine max (Soybean) (Glycine hispida) | 1 | 105 | 33 | 40 | 8 | AQQHLAEG | 82.94 |
| DP01036 | I1JLC8 | Protein SLE2 (Em protein) (Protein Glycine max physiologically mature 11) (Protein GmD-19) (Soybean group-1 late embryogenesis abundant protein 2) (Soybean group-1 lea protein 2) (Sle2) | Glycine max (Soybean) (Glycine hispida) | 1 | 105 | 53 | 61 | 9 | GTEGYQEMG | 75.59 |
| DP01038 | Q9FUM5 | BN28a | Brassica napus (Rape) | 1 | 65 | 4 | 12 | 9 | NKQSFQAGQ | 74.58 |
| DP01038 | Q9FUM5 | BN28a | Brassica napus (Rape) | 1 | 65 | 29 | 48 | 20 | KDAATAAGASAQTAGQKITE | 76.27 |
| DP01038 | Q9FUM5 | BN28a | Brassica napus (Rape) | 1 | 65 | 52 | 60 | 9 | GAVNLVKEK | 91.97 |
| DP01039 | Q85258 | Polyprotein (Fragment) | Potato virus Y | 336 | 523 | 356 | 375 | 20 | AGFEIDNNDDTIEEFFGSAY | 82.78 |
| DP01039 | Q85258 | Polyprotein (Fragment) | Potato virus Y | 336 | 523 | 392 | 413 | 22 | SRRFINMYGFDPTEYSFIQFVD | 81.96 |
| DP01039 | Q85258 | Polyprotein (Fragment) | Potato virus Y | 336 | 523 | 416 | 436 | 21 | TGAQIEENVYADIRDIQERFS | 83.39 |
| DP01039 | Q85258 | Polyprotein (Fragment) | Potato virus Y | 336 | 523 | 453 | 464 | 12 | LGSNTTIHAYFR | 79.77 |
| DP01039 | Q85258 | Polyprotein (Fragment) | Potato virus Y | 336 | 523 | 487 | 495 | 9 | KTNGIAKFP | 78.6 |
| DP01040 | Q9FUW7 | Omega gliadin storage protein | Triticum aestivum (Wheat) | 1 | 280 | 2 | 24 | 23 | KTFLIFVLLAMAMKIATAARELN | 83.03 |
| DP01040 | Q9FUW7 | Omega gliadin storage protein | Triticum aestivum (Wheat) | 1 | 280 | 33 | 45 | 13 | PQQSFSYQQQPFP | 77.64 |
| DP01040 | Q9FUW7 | Omega gliadin storage protein | Triticum aestivum (Wheat) | 1 | 280 | 77 | 83 | 7 | SQQPFTQ | 77.26 |
| DP01040 | Q9FUW7 | Omega gliadin storage protein | Triticum aestivum (Wheat) | 1 | 280 | 125 | 131 | 7 | TQQSFPL | 82.94 |
| DP01040 | Q9FUW7 | Omega gliadin storage protein | Triticum aestivum (Wheat) | 1 | 280 | 155 | 169 | 15 | QSEQIIPQQLQQPFP | 81.76 |
| DP01040 | Q9FUW7 | Omega gliadin storage protein | Triticum aestivum (Wheat) | 1 | 280 | 195 | 201 | 7 | PQQSFPQ | 73.91 |
| DP01040 | Q9FUW7 | Omega gliadin storage protein | Triticum aestivum (Wheat) | 1 | 280 | 213 | 225 | 13 | PQQLFPELQQPIP | 79.39 |
| DP01040 | Q9FUW7 | Omega gliadin storage protein | Triticum aestivum (Wheat) | 1 | 280 | 252 | 258 | 7 | PQQSFPQ | 73.91 |
| DP01040 | Q9FUW7 | Omega gliadin storage protein | Triticum aestivum (Wheat) | 1 | 280 | 266 | 275 | 10 | QQQPYGSSLT | 77.99 |
| DP01043 | Q80FJ1 | Membrane fusion protein p14 | Reptilian orthoreovirus | 2 | 31 | 4 | 21 | 18 | GPSNFVNHAPGEAIVTGL | 83.22 |
| DP01044 | Q47785 | Bacteriocin immunity protein (EntI protein) (Immunity protein for enterocin A) (Orf2 protein) (Probable immunity protein) | Enterococcus faecium (Streptococcus faecium) | 82 | 103 | 89 | 95 | 7 | INGLYRA | 80.6 |
| DP01045 | Q7DB66 | Lipoprotein | Escherichia coli O157:H7 | 60 | 85 | 66 | 79 | 14 | FVRAITILNNNGFP | 81.75 |
| DP01047 | O50835 | Fibronectin-binding protein BBK32 | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) | 56 | 205 | 87 | 103 | 17 | NKSNFLQKNVILEEESL | 79.52 |
| DP01047 | O50835 | Fibronectin-binding protein BBK32 | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) | 56 | 205 | 130 | 139 | 10 | TQGSLNSLSG | 76.05 |
| DP01047 | O50835 | Fibronectin-binding protein BBK32 | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) | 56 | 205 | 148 | 158 | 11 | IESNEIDLTID | 85.77 |
| DP01047 | O50835 | Fibronectin-binding protein BBK32 | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) | 56 | 205 | 166 | 197 | 32 | SLQGIAGSNSISYTDEIEEEDYDQYYLDEYDE | 79.71 |
| DP01048 | Q39532 | Opaque 2 | "Coix lacryma-jobi (Jobs tears)" | 224 | 276 | 250 | 271 | 22 | KAENSCLLRRLAALNQKYNEAN | 81.86 |
| DP01049 | Q6QCC2 | Factor H-binding protein (Lipoprotein) (Lipoprotein GNA1870) | Neisseria meningitidis | 101 | 137 | 104 | 132 | 29 | DGQLITLESGEFQVYKQSHSALTAFQTEQ | 79.01 |
| DP01050 | P0A6X3 | RNA-binding protein Hfq (HF-1) (Host factor-I protein) (HF-I) | Escherichia coli (strain K12) | 75 | 102 | 88 | 94 | 7 | SAQNTSA | 81.41 |
| DP01051 | Q7LKB1 | ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) | "Saccharomyces cerevisiae (Bakers yeast)" | 1 | 253 | 9 | 21 | 13 | NQQNYQQYSQNGN | 86.57 |
| DP01051 | Q7LKB1 | ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) | "Saccharomyces cerevisiae (Bakers yeast)" | 1 | 253 | 25 | 39 | 15 | GNNRYQGYQAYNAQA | 78.35 |
| DP01051 | Q7LKB1 | ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) | "Saccharomyces cerevisiae (Bakers yeast)" | 1 | 253 | 42 | 95 | 54 | AGGYYQNYQGYSGYQQGGYQQYNPDAGYQQQYNPQGGYQQYNPQGGYQQQFNPQ | 86.72 |
| DP01051 | Q7LKB1 | ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) | "Saccharomyces cerevisiae (Bakers yeast)" | 1 | 253 | 97 | 118 | 22 | GRGNYKNFNYNNNLQGYQAGFQ | 80.92 |
| DP01051 | Q7LKB1 | ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) | "Saccharomyces cerevisiae (Bakers yeast)" | 1 | 253 | 145 | 159 | 15 | KLVSSSGIKLANATK | 75.52 |
| DP01051 | Q7LKB1 | ERF-3 (ERF2) (Eukaryotic peptide chain release factor GTP-binding subunit) (Polypeptide release factor 3) (Translation release factor 3) | "Saccharomyces cerevisiae (Bakers yeast)" | 1 | 253 | 216 | 246 | 31 | EDLKISESTHNTNNANVTSADALIKEQEEEV | 83.26 |
| DP01052 | Q8MWS6 | DNA repair enzyme | Toxoplasma gondii | 283 | 343 | 287 | 293 | 7 | VLPSYID | 85 |
| DP01054 | Q76LA1 | CSTB protein (Cystatin B) (Cystatin B (Stefin B)) (Cystatin B (Stefin B); isoform CRA_a) (Epididymis secretory sperm binding protein) (cDNA; FLJ92415; Homo sapiens cystatin B (stefin B) (CSTB); mRNA) | Homo sapiens (Human) | 1 | 67 | 15 | 32 | 18 | ETQHIADQVRSQLEEKEN | 85.95 |
| DP01054 | Q76LA1 | CSTB protein (Cystatin B) (Cystatin B (Stefin B)) (Cystatin B (Stefin B); isoform CRA_a) (Epididymis secretory sperm binding protein) (cDNA; FLJ92415; Homo sapiens cystatin B (stefin B) (CSTB); mRNA) | Homo sapiens (Human) | 1 | 67 | 39 | 57 | 19 | KAVSFKSQVVAGTNYFIKV | 85.44 |
| DP01055 | Q8GT36 | Thylakoid soluble phosphoprotein | Spinacia oleracea (Spinach) | 1 | 103 | 4 | 20 | 17 | LPFVFGAAASSRVVTAA | 77.2 |
| DP01055 | Q8GT36 | Thylakoid soluble phosphoprotein | Spinacia oleracea (Spinach) | 1 | 103 | 29 | 43 | 15 | KQEKSFVDWLLGKIT | 82.14 |
| DP01055 | Q8GT36 | Thylakoid soluble phosphoprotein | Spinacia oleracea (Spinach) | 1 | 103 | 45 | 52 | 8 | EDQFYETD | 82.32 |
| DP01055 | Q8GT36 | Thylakoid soluble phosphoprotein | Spinacia oleracea (Spinach) | 1 | 103 | 79 | 85 | 7 | GTVSIPS | 84.62 |
| DP01055 | Q8GT36 | Thylakoid soluble phosphoprotein | Spinacia oleracea (Spinach) | 1 | 103 | 91 | 98 | 8 | NGGVFGGL | 82.27 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 11 | 17 | 7 | RVEVILD | 86.96 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 51 | 59 | 9 | PSFAISSEG | 81.12 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 88 | 99 | 12 | SESLSEKQVKEA | 76.92 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 102 | 113 | 12 | KCKSIALLLTAA | 83.58 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 119 | 125 | 7 | KGVLMFK | 80.22 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 130 | 141 | 12 | RARKYTLVSYGT | 85.01 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 161 | 203 | 43 | KENTFEVSLLATSESEIDEDFFSDIDNDKKIVTFDWDSGLLEV | 82.47 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 234 | 244 | 11 | MDQITAEQEEM | 80.94 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 257 | 275 | 19 | VTVSENFQKVSSSAYQTKE | 85.14 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 290 | 306 | 17 | ADVSQNDGKIVQQNGFG | 79.82 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 310 | 320 | 11 | DTSLSFQSSEA | 79.54 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 336 | 346 | 11 | GVQNRAAAPFS | 75.8 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 385 | 395 | 11 | KAAPILWSHTE | 79.39 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 428 | 435 | 8 | PMFSFKEA | 73.91 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 443 | 451 | 9 | ALLSLVHNA | 79.93 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 458 | 464 | 7 | GAGFESG | 75.25 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 467 | 481 | 15 | EDYLSLGAEACNFMQ | 78.86 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 515 | 522 | 8 | PAVASNKA | 76.25 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 531 | 537 | 7 | PQAAYPA | 79.93 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 554 | 560 | 7 | NTLNLSG | 79.93 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 600 | 607 | 8 | GAQLFARR | 97.66 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 610 | 630 | 21 | RMEKYVVDSETVQANMARASS | 79.82 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 649 | 657 | 9 | PPVAYNPIH | 76.59 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 686 | 693 | 8 | GLNALDIM | 80.69 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 700 | 708 | 9 | LDASLFTFQ | 90.9 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 728 | 735 | 8 | KQATSLRL | 75.92 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 746 | 775 | 30 | ASSVYSVPAYSSQPSFQSNASTPVNESYTP | 78.54 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 788 | 794 | 7 | TSSLFTA | 77.35 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 803 | 813 | 11 | KAGVIAQERSS | 76.8 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 833 | 839 | 7 | TSPLIFQ | 82.51 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 882 | 894 | 13 | MQESIAANVVSAA | 84.26 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 919 | 926 | 8 | ASLALLGG | 76.25 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 936 | 947 | 12 | KSSLSVSNATTQ | 75.81 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 950 | 959 | 10 | SQQQYAYCSQ | 79.1 |
| DP01056 | A7UMX5 | Synaptopodin 2 variant | Meleagris gallopavo (Wild turkey) | 1 | 996 | 975 | 986 | 12 | DYGLSTADSNYN | 86.45 |
| DP01057 | Q42512 | Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) | Arabidopsis thaliana (Mouse-ear cress) | 41 | 139 | 44 | 51 | 8 | KKSLIYAA | 77.88 |
| DP01057 | Q42512 | Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) | Arabidopsis thaliana (Mouse-ear cress) | 41 | 139 | 53 | 75 | 23 | GDGNILDDLNEATKKASDFVTDK | 78 |
| DP01057 | Q42512 | Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) | Arabidopsis thaliana (Mouse-ear cress) | 41 | 139 | 89 | 98 | 10 | YVVEKNSETA | 73.91 |
| DP01057 | Q42512 | Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) | Arabidopsis thaliana (Mouse-ear cress) | 41 | 139 | 107 | 115 | 9 | KAAAYVEEK | 82.16 |
| DP01057 | Q42512 | Protein COLD-REGULATED 15A; chloroplastic (AtCOR15A) | Arabidopsis thaliana (Mouse-ear cress) | 41 | 139 | 122 | 129 | 8 | KAAEFAEG | 81.69 |
| DP01058 | Q9SIN5 | Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B) | Arabidopsis thaliana (Mouse-ear cress) | 41 | 139 | 45 | 76 | 32 | KKSLIYAVKSDGNILDDLNEATKKASDFVTDK | 78.33 |
| DP01058 | Q9SIN5 | Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B) | Arabidopsis thaliana (Mouse-ear cress) | 41 | 139 | 87 | 104 | 18 | TKDYIVEKTIEANETATE | 79.45 |
| DP01058 | Q9SIN5 | Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B) | Arabidopsis thaliana (Mouse-ear cress) | 41 | 139 | 108 | 116 | 9 | KALDYVTEK | 75.66 |
| DP01058 | Q9SIN5 | Protein COLD-REGULATED 15B; chloroplastic (AtCOR15B) | Arabidopsis thaliana (Mouse-ear cress) | 41 | 139 | 123 | 130 | 8 | KAAEFVEG | 78.76 |
| DP01060 | A8CDV5 | Latent membrane protein 2A (Fragment) | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) | 1 | 118 | 1 | 7 | 7 | MGSLEMV | 75.25 |
| DP01060 | A8CDV5 | Latent membrane protein 2A (Fragment) | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) | 1 | 118 | 25 | 32 | 8 | GGNNSQYP | 74.25 |
| DP01060 | A8CDV5 | Latent membrane protein 2A (Fragment) | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) | 1 | 118 | 80 | 89 | 10 | QDQSLYLGLQ | 77.69 |
| DP01060 | A8CDV5 | Latent membrane protein 2A (Fragment) | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) | 1 | 118 | 107 | 113 | 7 | SSQHIYE | 81.94 |
| DP01065 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 236 | 13 | 22 | 10 | HMSSYVPIFE | 83.01 |
| DP01065 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 236 | 30 | 37 | 8 | NGDNFNRT | 82.94 |
| DP01065 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 236 | 61 | 69 | 9 | SGRNFGNRD | 75.92 |
| DP01065 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 236 | 95 | 102 | 8 | GFSNSRFE | 79.26 |
| DP01065 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 236 | 213 | 221 | 9 | GLNEEVITG | 80.53 |
| DP01066 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 204 | 13 | 22 | 10 | HMSSYVPIFE | 83.01 |
| DP01066 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 204 | 30 | 37 | 8 | NGDNFNRT | 82.94 |
| DP01066 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 204 | 61 | 69 | 9 | SGRNFGNRD | 75.92 |
| DP01066 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 204 | 95 | 102 | 8 | GFSNSRFE | 79.26 |
| DP01066 | Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 (EC 3.6.4.13) (DEAD box protein 4) (Vasa homolog) | Homo sapiens (Human) | 1 | 204 | 179 | 187 | 9 | GLNEEVITG | 80.53 |
| DP01067 | P19599 | Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) | Plasmodium falciparum (isolate FC27 / Papua New Guinea) | 21 | 238 | 22 | 40 | 19 | NESKYSNTFINNAYNMSIR | 80.44 |
| DP01067 | P19599 | Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) | Plasmodium falciparum (isolate FC27 / Papua New Guinea) | 21 | 238 | 46 | 53 | 8 | EGSNTNSV | 75.92 |
| DP01067 | P19599 | Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) | Plasmodium falciparum (isolate FC27 / Papua New Guinea) | 21 | 238 | 59 | 65 | 7 | NADTIAS | 83.61 |
| DP01067 | P19599 | Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) | Plasmodium falciparum (isolate FC27 / Papua New Guinea) | 21 | 238 | 91 | 97 | 7 | AADTIAS | 86.29 |
| DP01067 | P19599 | Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) | Plasmodium falciparum (isolate FC27 / Papua New Guinea) | 21 | 238 | 129 | 135 | 7 | ATESISP | 85.62 |
| DP01067 | P19599 | Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) | Plasmodium falciparum (isolate FC27 / Papua New Guinea) | 21 | 238 | 143 | 151 | 9 | ESSKFWQCT | 73.58 |
| DP01067 | P19599 | Merozoite surface antigen 2 (MSA-2) (AG513) (Merozoite 45 kDa surface antigen) | Plasmodium falciparum (isolate FC27 / Papua New Guinea) | 21 | 238 | 163 | 173 | 11 | KQNELNESTEE | 79.93 |
| DP01068 | Q9UBB5 | Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) | Homo sapiens (Human) | 238 | 356 | 238 | 253 | 16 | DLNTTLPIRQTASIFK | 82.17 |
| DP01068 | Q9UBB5 | Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) | Homo sapiens (Human) | 238 | 356 | 278 | 303 | 26 | PRQLFWEKRLQGLSASDVTEQIIKTM | 81.53 |
| DP01068 | Q9UBB5 | Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) | Homo sapiens (Human) | 238 | 356 | 317 | 333 | 17 | NDETLLSAVASALHTSS | 76.79 |
| DP01068 | Q9UBB5 | Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2) | Homo sapiens (Human) | 238 | 356 | 338 | 351 | 14 | GQVSAAVEKNPAVW | 76.64 |
| DP01069 | Q6MRH6 | Hit locus orf4 | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) | 1 | 101 | 4 | 28 | 25 | LLVLSILLTLGFSFAGTASADENAN | 82.81 |
| DP01069 | Q6MRH6 | Hit locus orf4 | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) | 1 | 101 | 46 | 54 | 9 | FEATTSALG | 74.25 |
| DP01070 | P42568 | Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3) | Homo sapiens (Human) | 490 | 568 | 499 | 511 | 13 | CDKAYLDELVELH | 77.26 |
| DP01070 | P42568 | Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3) | Homo sapiens (Human) | 490 | 568 | 518 | 555 | 38 | RERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTV | 79.21 |
| DP01070 | P42568 | Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3) | Homo sapiens (Human) | 490 | 568 | 557 | 563 | 7 | KLQSYLE | 79.84 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 56 | 64 | 9 | NDEEINTSP | 79.82 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 79 | 94 | 16 | QGGEYGGLSERDVNIP | 84.32 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 160 | 166 | 7 | KGVNYGG | 92.98 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 176 | 182 | 7 | EHQTISD | 76.68 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 218 | 224 | 7 | PQDTITG | 73.91 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 229 | 236 | 8 | VPAVIIDR | 89.97 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 242 | 249 | 8 | NVVASKLG | 79.93 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 254 | 260 | 7 | QAQESAA | 75.92 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 274 | 292 | 19 | TAAEYKNLVAEKLTPVYEK | 78.49 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 326 | 342 | 17 | GGAASNKGVFTKDYLSE | 75.53 |
| DP01071 | O23764 | CDet11-24 protein | Craterostigma plantagineum (Blue gem) (Torenia plantagineum) | 1 | 422 | 353 | 365 | 13 | LSQAIMEKLQLSK | 76.15 |
| DP01073 | Q61548 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) (Phosphoprotein F1-20) | Mus musculus (Mouse) | 623 | 680 | 633 | 652 | 20 | SSGVIDLFGDAFGSGASETQ | 81.61 |
| DP01073 | Q61548 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) (Phosphoprotein F1-20) | Mus musculus (Mouse) | 623 | 680 | 656 | 675 | 20 | QAVSSSSASADLLAGFGGSF | 77.22 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 325 | 341 | 17 | DKESIVLPTVGFDFIKD | 75.94 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 357 | 365 | 9 | AGAVFKSSV | 79.78 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 380 | 388 | 9 | PTLSFNFSQ | 80.82 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 395 | 410 | 16 | AVDNTVPSTTLFNFGG | 86.62 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 413 | 428 | 16 | DTVTSASQPFKFGKTS | 78.32 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 444 | 456 | 13 | TAPIFSFGKQEEN | 80.94 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 508 | 516 | 9 | PSFVFGASD | 76.81 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 521 | 528 | 8 | GTPLFTFG | 84.87 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 531 | 538 | 8 | ADVTSNID | 90.72 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 540 | 551 | 12 | SAQFTFGKAATA | 96.71 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 569 | 583 | 15 | PTFTFGQSTSENKIS | 80.94 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 589 | 597 | 9 | PTFSFSKSE | 78.15 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 634 | 641 | 8 | PTFSFTEP | 81.19 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 655 | 665 | 11 | PSFTFASSKTS | 80.12 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 669 | 677 | 9 | PLFSFGKSD | 80.27 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 686 | 693 | 8 | NTSFSFTK | 79.26 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 706 | 722 | 17 | PSFTFGGSTTNNTTTTS | 77.99 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 742 | 761 | 20 | AAANTEKLSNGFSFTKFNHN | 82.47 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 768 | 778 | 11 | PTSFFDGSASS | 79.93 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 790 | 825 | 36 | ATGNTTSKSAFSFGTANTNGTNASANSTSFSFNAPA | 76.93 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 832 | 848 | 17 | TTSNTSGTNIAGTFNVG | 83.55 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 850 | 860 | 11 | PDQSIASGNTN | 78.47 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 862 | 891 | 30 | AGSAFGFSSSGTAATGAASNQSSFNFGNNG | 80.28 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 894 | 915 | 22 | GLNPFTSATSSTNANAGLFNKP | 82.59 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 919 | 937 | 19 | NAQNVNVPSAFNFTGNNST | 79.62 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 940 | 962 | 23 | GGSVFNMNGNTNANTVFAGSNNQ | 79.56 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 969 | 979 | 11 | PSFNTNSSFTP | 78.47 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 981 | 1003 | 23 | TVPNINFSGLNGGITNTATNALR | 80.6 |
| DP01075 | P20676 | Nucleoporin NUP1 (Nuclear pore protein NUP1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 300 | 1076 | 1014 | 1028 | 15 | SGSNSNVTNPSSIFG | 76.1 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 10 | 24 | 15 | GGSNLSFGSNTSSFG | 78.1 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 31 | 47 | 17 | PNSLFGNSNNNNNSTSN | 79.22 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 49 | 137 | 89 | AQSGFGGFTSAAGSNSNSLFGNNNTQNNGAFGQSMGATQNSPFGSLNSSNASNGNTFGGSSSMGSFGGNTNNAFNNNSNSTNSPFGFNK | 78.61 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 141 | 178 | 38 | GGTLFGSQNNNSAGTSSLFGGQSTSTTGTFGNTGSSFG | 79.94 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 184 | 245 | 62 | NGSNIFGAGNNSQSNTTGSLFGNQQSSAFGTNNQQGSLFGQQSQNTNNAFGNQNQLGGSSFG | 81.66 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 251 | 341 | 91 | SGSLFGQSNNTLGNTTNNRNGLFGQMNSSNQGSSNSGLFGQNSMNSSTQGVFGQNNNQMQINGNNNNSLFGKANTFSNSASGGLFGQNNQQ | 79.84 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 343 | 396 | 54 | GSGLFGQNSQTSGSSGLFGQNNQKQPNTFTQSNTGIGLFGQNNNQQQQSTGLFG | 79.72 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 403 | 423 | 21 | TGSLFGGNSSTQPNSLFGTTN | 83.95 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 432 | 445 | 14 | QQGNSLFGATKLTN | 78.43 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 472 | 485 | 14 | TGSLFGNNTASTTV | 81.27 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 488 | 509 | 22 | TNGLFGNNANNSTSTTNTGLFG | 82.02 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 521 | 536 | 16 | GGGLFGNSNSNSSTIG | 82.84 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 545 | 582 | 38 | TTQNTGLFGATGTNSSAVGSTGKLFGQNNNTLNVGTQN | 77.59 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 590 | 608 | 19 | TQNALLGTTAVPSLQQAPV | 77.17 |
| DP01076 | Q02629 | Nucleoporin NUP100/NSP100 (Nuclear pore protein NUP100/NSP100) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 640 | 610 | 625 | 16 | NEQLFSKISIPNSITN | 82.46 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 1 | 78 | 78 | MNFNTPQQNKTPFSFGTANNNSNTTNQNSSTGAGAFGTGQSTFGFNNSAPNNTNNANSSITPAFGSNNTGNTAFGNSN | 80.14 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 80 | 108 | 29 | TSNVFGSNNSTTNTFGSNSAGTSLFGSSS | 81.33 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 118 | 139 | 22 | AGGNTFGSSSLFNNSTNSNTTK | 81.48 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 143 | 155 | 13 | GGLNFGGGNNTTP | 82.35 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 159 | 186 | 28 | GNANTSNNLFGATANANKPAFSFGATTN | 79.06 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 196 | 209 | 14 | PAFSFNSSVGNKTD | 77.09 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 214 | 221 | 8 | TTGFSFGS | 75.75 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 264 | 288 | 25 | PALSFGTATSDNKTTNTTPSFSFGA | 73.91 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 301 | 307 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 320 | 331 | 12 | PAFSFGAKSNED | 77.48 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 339 | 345 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 358 | 364 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 377 | 383 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 396 | 402 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 415 | 426 | 12 | PAFSFGAKSNED | 77.48 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 434 | 440 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 453 | 459 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 472 | 478 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 491 | 497 | 7 | PAFSFGT | 75.92 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 510 | 516 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 529 | 535 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 546 | 554 | 9 | SKSAFSFGS | 78.08 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 565 | 573 | 9 | AKAAISFGA | 78.11 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 603 | 586 | 596 | 11 | PAFTFGAQKDN | 85.28 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 498 | 607 | 510 | 516 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 498 | 607 | 529 | 535 | 7 | PAFSFGA | 77.64 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 498 | 607 | 546 | 554 | 9 | SKSAFSFGS | 78.08 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 498 | 607 | 565 | 573 | 9 | AKAAISFGA | 78.11 |
| DP01077 | P14907 | Nucleoporin NSP1 (Nuclear pore protein NSP1) (Nucleoskeletal-like protein) (p110) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 498 | 607 | 586 | 596 | 11 | PAFTFGAQKDN | 85.28 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 441 | 449 | 9 | SGFTFLKTQ | 78.71 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 451 | 478 | 28 | AAANSLQSQSSSTFGAPSFGSSAFKIDL | 81.28 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 486 | 493 | 8 | TGVASSEQ | 77.26 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 518 | 525 | 8 | STSEYAFG | 86.71 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 606 | 637 | 32 | SFGTSAFGTASSNETNSGSIFGKAAFGSSSFA | 80.57 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 639 | 652 | 14 | ANNELFGSNFTISK | 80.51 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 700 | 722 | 23 | KTNAFDFGSSSFGSGFSKALESV | 78.25 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 724 | 743 | 20 | SDTTFKFGTQASPFSSQLGN | 79.38 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 746 | 752 | 7 | PFSSFTK | 79.93 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 809 | 816 | 8 | GEVVEEEA | 75.25 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 824 | 848 | 25 | LTETIKKSANIDMAGLKNPVFGNHV | 82.17 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 855 | 865 | 11 | PFSAFATNITK | 81.7 |
| DP01078 | P40477 | Nucleoporin NUP159 (Nuclear pore protein NUP159) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 441 | 881 | 869 | 876 | 8 | TTPAFSFG | 77.42 |
| DP01079 | P40517 | Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 203 | 43 | 49 | 7 | QAEETSD | 74.25 |
| DP01079 | P40517 | Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 203 | 84 | 92 | 9 | VESGIVEDD | 79.93 |
| DP01079 | P40517 | Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 203 | 94 | 107 | 14 | KEDKFVFGAASKFG | 82.25 |
| DP01079 | P40517 | Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 203 | 120 | 128 | 9 | GDATTSTES | 77.26 |
| DP01079 | P40517 | Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 203 | 138 | 157 | 20 | KPFAFGSGLSFGSGFNILKN | 80.54 |
| DP01079 | P40517 | Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 203 | 159 | 166 | 8 | TENNSESE | 75.25 |
| DP01080 | Q9C1S9 | Exoglucanase-6A (EC 3.2.1.91) (1;4-beta-cellobiohydrolase 6A) (Avicelase 2) (Beta-glucancellobiohydrolase 6A) (Exocellobiohydrolase 6A) | Humicola insolens (Soft-rot fungus) | 44 | 96 | 52 | 59 | 8 | KQNDWYSQ | 88.09 |
| DP01080 | Q9C1S9 | Exoglucanase-6A (EC 3.2.1.91) (1;4-beta-cellobiohydrolase 6A) (Avicelase 2) (Beta-glucancellobiohydrolase 6A) (Exocellobiohydrolase 6A) | Humicola insolens (Soft-rot fungus) | 44 | 96 | 64 | 81 | 18 | SQVTTTSTTSTSSSSTTS | 76.44 |
| DP01082 | Q7X2A1 | Immunoglobulin-like B protein | Leptospira interrogans serovar Pomona | 1119 | 1165 | 1129 | 1160 | 32 | QSVVSLSPTTIQVVYSESINNKEALDLSNYKI | 81.52 |
| DP01083 | Q7TP21 | Replication protein A subunit | Rattus norvegicus (Rat) | 91 | 167 | 95 | 106 | 12 | VGVKIGNPVPYN | 83.61 |
| DP01083 | Q7TP21 | Replication protein A subunit | Rattus norvegicus (Rat) | 91 | 167 | 142 | 150 | 9 | VAKAYGASK | 80.6 |
| DP01084 | Q1K7R9 | Replication protein A subunit | Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) | 111 | 173 | 138 | 147 | 10 | STGFYGVKSE | 76.49 |
| DP01085 | Q9SKI4 | Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A) | Arabidopsis thaliana (Mouse-ear cress) | 106 | 193 | 109 | 118 | 10 | GNPTIFGETD | 74.85 |
| DP01085 | Q9SKI4 | Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A) | Arabidopsis thaliana (Mouse-ear cress) | 106 | 193 | 120 | 130 | 11 | EAQKTFSGTGN | 83.46 |
| DP01085 | Q9SKI4 | Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A) | Arabidopsis thaliana (Mouse-ear cress) | 106 | 193 | 135 | 151 | 17 | NRVVFNEPMVQHSVNRA | 79.42 |
| DP01085 | Q9SKI4 | Replication protein A 70 kDa DNA-binding subunit A (AtRPA70A) (AtRPA1-3) (Replication factor A protein 1A) (Replication protein A 1A) (AtRPA1A) | Arabidopsis thaliana (Mouse-ear cress) | 106 | 193 | 154 | 166 | 13 | RGVNIQNQANNTP | 78.39 |
| DP01086 | Q10Q08 | Replication protein A 70 kDa DNA-binding subunit B (OsRPA70b) (Replication factor A protein 1B) (Replication protein A 1B) | Oryza sativa subsp. japonica (Rice) | 105 | 180 | 105 | 117 | 13 | LEVVFKALDSEIK | 86.54 |
| DP01086 | Q10Q08 | Replication protein A 70 kDa DNA-binding subunit B (OsRPA70b) (Replication factor A protein 1B) (Replication protein A 1B) | Oryza sativa subsp. japonica (Rice) | 105 | 180 | 158 | 170 | 13 | QEVKSASQIVNEQ | 81.68 |
| DP01087 | Q1PAB4 | Protein Tat (Transactivating regulatory protein) | Human immunodeficiency virus 1 | 1 | 101 | 34 | 49 | 16 | CQVCFIRKALGISYGR | 83.3 |
| DP01088 | Q9XES8 | Seed maturation protein PM28 | Glycine max (Soybean) (Glycine hispida) | 1 | 89 | 6 | 19 | 14 | EDITYATSQARLSE | 77.64 |
| DP01088 | Q9XES8 | Seed maturation protein PM28 | Glycine max (Soybean) (Glycine hispida) | 1 | 89 | 43 | 50 | 8 | PVDLFSSA | 76.63 |
| DP01088 | Q9XES8 | Seed maturation protein PM28 | Glycine max (Soybean) (Glycine hispida) | 1 | 89 | 56 | 66 | 11 | SGQTTMDSNTS | 77.53 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 3546 | 3795 | 3651 | 3658 | 8 | QQAASEEE | 75.25 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 3546 | 3795 | 3667 | 3683 | 17 | TVVQTNEDVKEAEVPEN | 76.04 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 3546 | 3795 | 3695 | 3716 | 22 | LQVAASEIAHLAIDEAVLETSN | 83.19 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 3546 | 3795 | 3730 | 3738 | 9 | SVVHENEHV | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 3546 | 3795 | 3750 | 3766 | 17 | DSEQIVSDVIVAEVGYD | 81.9 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 3546 | 3795 | 3769 | 3790 | 22 | ECSTIADTITSLSSSPLYTAPV | 78.73 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 4654 | 4661 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 4693 | 4700 | 8 | QPAEIVEQ | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 4705 | 4748 | 44 | CEEEIKELLTEVEVELFFSQAEVFSGLELDLLMECSEYVTTSIQ | 79.21 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 4776 | 4783 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 4814 | 4822 | 9 | VQQAEIVEQ | 90.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 4854 | 4861 | 8 | QPAEIVEQ | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 4866 | 4909 | 44 | CEEEIKELLTEVEVELFFSQAEVFSGLELDLLMECSEYVTTSIQ | 79.21 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 4936 | 4944 | 9 | VQQAEIIEQ | 82.65 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 4975 | 4983 | 9 | VQQVEIIEQ | 82.39 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5014 | 5022 | 9 | VQQAEIIEQ | 82.65 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5053 | 5061 | 9 | VQQVEIIEQ | 82.39 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5092 | 5100 | 9 | VQQAEIIEQ | 82.65 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5131 | 5139 | 9 | VQQVEIIEQ | 82.39 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5171 | 5178 | 8 | QPAEIVEQ | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5210 | 5217 | 8 | QPAEILEQ | 79.26 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5222 | 5265 | 44 | CEEEIKELLTEVEVELFFSKAEVFSGLELDLLMECSEYVTTSIQ | 79.38 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5293 | 5300 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5331 | 5339 | 9 | VQQAEIIEQ | 82.65 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5371 | 5378 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5383 | 5426 | 44 | CEEEIKELLTEVEVELLFSQAEVFSGLELDLLMECSEYVTTSIQ | 78.95 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5454 | 5461 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5492 | 5500 | 9 | VQQAEIIEQ | 82.65 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5532 | 5539 | 8 | QPAEIVEQ | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5571 | 5578 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5610 | 5617 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5630 | 5638 | 9 | VEPTIEKLA | 75.47 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5649 | 5656 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5669 | 5677 | 9 | VEPTIEKLA | 75.47 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5688 | 5695 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5727 | 5734 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5766 | 5774 | 9 | QPAEIVEHK | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5805 | 5812 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5844 | 5851 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5883 | 5890 | 8 | QPAEIVEQ | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5922 | 5929 | 8 | QPAEIVEQ | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 5961 | 5969 | 9 | QPAEIVEHK | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6000 | 6007 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6039 | 6047 | 9 | QPAEIVEHK | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6059 | 6067 | 9 | VEPTIEKLA | 75.47 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6078 | 6085 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6098 | 6106 | 9 | VEPTIEKLA | 75.47 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6117 | 6125 | 9 | QPAEIVEHK | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6156 | 6163 | 8 | QPAEIVEQ | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6168 | 6211 | 44 | CEEEIKELLTEVEVELFFSQAEVFSGLELDLLMECSEYVTTSIQ | 79.21 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6239 | 6246 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6278 | 6285 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6317 | 6324 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6356 | 6363 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6395 | 6402 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6415 | 6423 | 9 | VEPTIEKLA | 75.47 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6434 | 6441 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6454 | 6462 | 9 | VEPTIEKLA | 75.47 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6473 | 6480 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6512 | 6519 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6551 | 6559 | 9 | QPAEIVEHK | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6590 | 6597 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6629 | 6636 | 8 | EPAEIVEQ | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6668 | 6676 | 9 | QPAEIVEHK | 79.93 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6683 | 6689 | 7 | TTATTFE | 79.46 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6707 | 6714 | 8 | QTAEIVEQ | 86.96 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6746 | 6754 | 9 | QQAAIVEQK | 78.74 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6780 | 6792 | 13 | ETSEIQTAEIVEQ | 84.38 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6824 | 6832 | 9 | QQAAIVEQK | 78.74 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6858 | 6871 | 14 | ETSEIQQAAVVEQK | 78.74 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6902 | 6910 | 9 | QQAAIVEQK | 78.74 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6918 | 6930 | 13 | NAPTFEPTVEKLA | 75.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 4627 | 7026 | 6941 | 6949 | 9 | QQAAIVEQK | 78.74 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 7013 | 8512 | 7601 | 7614 | 14 | KDDNFKQEANAKLQ | 76.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 7013 | 8512 | 7625 | 7638 | 14 | KDDNFKQEANAKLQ | 76.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 7013 | 8512 | 8057 | 8070 | 14 | KDDNFKQEANAKLQ | 76.59 |
| DP01090 | G4SLH0 | Titin homolog (EC 2.7.11.1) | Caenorhabditis elegans | 7013 | 8512 | 8492 | 8507 | 16 | NQSRIFEETSIEVTSL | 77.59 |
| DP01092 | O66683 | Anti sigma factor FlgM | Aquifex aeolicus (strain VF5) | 5 | 88 | 7 | 19 | 13 | LSRLIGLLLETEK | 77.51 |
| DP01092 | O66683 | Anti sigma factor FlgM | Aquifex aeolicus (strain VF5) | 5 | 88 | 38 | 54 | 17 | TLSKIAQELSKNDVEEK | 79.91 |
| DP01092 | O66683 | Anti sigma factor FlgM | Aquifex aeolicus (strain VF5) | 5 | 88 | 63 | 76 | 14 | LKEKIEKGEYEVSD | 74.96 |
| DP01094 | Q9BP37 | Aragonite protein AP7 | Haliotis rufescens (California red abalone) | 23 | 52 | 24 | 47 | 24 | DNGNYGNGMASVRTQGNTYDDLAS | 82.61 |
| DP01094 | Q9BP37 | Aragonite protein AP7 | Haliotis rufescens (California red abalone) | 56 | 88 | 62 | 72 | 11 | HECALCYSITD | 77.93 |
| DP01095 | Q9BP38 | Aragonite protein AP24 | Haliotis rufescens (California red abalone) | 25 | 54 | 34 | 46 | 13 | GLCNQYNQNVTTR | 80.81 |
| DP01097 | P61244 | Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) | Homo sapiens (Human) | 81 | 102 | 81 | 92 | 12 | RQNALLEQQVRA | 79.77 |
| DP01097 | P61244 | Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) | Homo sapiens (Human) | 93 | 150 | 100 | 107 | 8 | AQLQTNYP | 85.2 |
| DP01097 | P61244 | Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) | Homo sapiens (Human) | 93 | 150 | 110 | 126 | 17 | DNSLYTNAKGSTISAFD | 87.19 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 5 | 19 | 15 | RQEFEVMEDHAGTYG | 81.14 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 25 | 31 | 7 | DQGGYTM | 75.82 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 256 | 267 | 12 | VKSKIGSTENLK | 74.58 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 273 | 280 | 8 | GKVQIINK | 95.74 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 304 | 312 | 9 | GSVQIVYKP | 77.15 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 350 | 362 | 13 | VQSKIGSLDNITH | 82.04 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 374 | 381 | 8 | HKLTFREN | 74.58 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 388 | 396 | 9 | HGAEIVYKS | 78.97 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 413 | 419 | 7 | STGSIDM | 75.59 |
| DP01100 | P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | Homo sapiens (Human) | 1 | 441 | 424 | 436 | 13 | QLATLADEVSASL | 76.69 |
| DP01101 | P04370 | Myelin basic protein (MBP) (Myelin A1 protein) | Mus musculus (Mouse) | 1 | 169 | 9 | 21 | 13 | QRSKYLATASTMD | 80.19 |
| DP01101 | P04370 | Myelin basic protein (MBP) (Myelin A1 protein) | Mus musculus (Mouse) | 1 | 169 | 36 | 46 | 11 | ILDSIGRFFSG | 75.19 |
| DP01101 | P04370 | Myelin basic protein (MBP) (Myelin A1 protein) | Mus musculus (Mouse) | 1 | 169 | 83 | 92 | 10 | PVVHFFKNIV | 86.76 |
| DP01101 | P04370 | Myelin basic protein (MBP) (Myelin A1 protein) | Mus musculus (Mouse) | 1 | 169 | 106 | 116 | 11 | GLSLSRFSWGA | 76.28 |
| DP01101 | P04370 | Myelin basic protein (MBP) (Myelin A1 protein) | Mus musculus (Mouse) | 1 | 169 | 139 | 156 | 18 | FKGAYDAQGTLSKIFKLG | 78.99 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 2 | 18 | 17 | ASNDYTQQATQSYGAYP | 79.22 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 22 | 70 | 49 | GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS | 79.75 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 87 | 98 | 12 | SQSSYGQQSSYP | 84.81 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 126 | 151 | 26 | QSGSYSQQPSYGGQQQSYGQQQSYNP | 83.39 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 156 | 165 | 10 | GQQNQYNSSS | 86.42 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 173 | 184 | 12 | GGGNYGQDQSSM | 80.6 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 228 | 236 | 9 | GGGGYNRSS | 75.25 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 260 | 266 | 7 | GGFNKFG | 86.24 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 282 | 314 | 33 | SDNNTIFVQGLGENVTIESVADYFKQIGIIKTN | 81.78 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 318 | 327 | 10 | GQPMINLYTD | 81.74 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 347 | 360 | 14 | AKAAIDWFDGKEFS | 89.18 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 364 | 371 | 8 | IKVSFATR | 80.94 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 526 | 432 | 446 | 15 | TCENMNFSWRNECNQ | 82.32 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 2 | 18 | 17 | ASNDYTQQATQSYGAYP | 79.22 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 22 | 70 | 49 | GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS | 79.75 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 87 | 98 | 12 | SQSSYGQQSSYP | 84.81 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 126 | 151 | 26 | QSGSYSQQPSYGGQQQSYGQQQSYNP | 83.39 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 156 | 165 | 10 | GQQNQYNSSS | 86.42 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 173 | 184 | 12 | GGGNYGQDQSSM | 80.6 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 228 | 236 | 9 | GGGGYNRSS | 75.25 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 260 | 266 | 7 | GGFNKFG | 86.24 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 282 | 314 | 33 | SDNNTIFVQGLGENVTIESVADYFKQIGIIKTN | 81.78 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 318 | 327 | 10 | GQPMINLYTD | 81.74 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 347 | 360 | 14 | AKAAIDWFDGKEFS | 89.18 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 364 | 371 | 8 | IKVSFATR | 80.94 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 507 | 432 | 446 | 15 | TCENMNFSWRNECNQ | 82.32 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 2 | 18 | 17 | ASNDYTQQATQSYGAYP | 79.22 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 22 | 70 | 49 | GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS | 79.75 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 87 | 98 | 12 | SQSSYGQQSSYP | 84.81 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 126 | 151 | 26 | QSGSYSQQPSYGGQQQSYGQQQSYNP | 83.39 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 156 | 165 | 10 | GQQNQYNSSS | 86.42 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 173 | 184 | 12 | GGGNYGQDQSSM | 80.6 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 228 | 236 | 9 | GGGGYNRSS | 75.25 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 260 | 266 | 7 | GGFNKFG | 86.24 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 282 | 314 | 33 | SDNNTIFVQGLGENVTIESVADYFKQIGIIKTN | 81.78 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 318 | 327 | 10 | GQPMINLYTD | 81.74 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 347 | 360 | 14 | AKAAIDWFDGKEFS | 89.18 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 422 | 364 | 371 | 8 | IKVSFATR | 80.94 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 214 | 2 | 18 | 17 | ASNDYTQQATQSYGAYP | 79.22 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 214 | 22 | 70 | 49 | GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS | 79.75 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 214 | 87 | 98 | 12 | SQSSYGQQSSYP | 84.81 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 214 | 126 | 151 | 26 | QSGSYSQQPSYGGQQQSYGQQQSYNP | 83.39 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 214 | 156 | 165 | 10 | GQQNQYNSSS | 86.42 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 214 | 173 | 184 | 12 | GGGNYGQDQSSM | 80.6 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 163 | 2 | 18 | 17 | ASNDYTQQATQSYGAYP | 79.22 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 163 | 22 | 70 | 49 | GQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS | 79.75 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 163 | 87 | 98 | 12 | SQSSYGQQSSYP | 84.81 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 1 | 163 | 126 | 151 | 26 | QSGSYSQQPSYGGQQQSYGQQQSYNP | 83.39 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 2 | 36 | 2 | 18 | 17 | ASNDYTQQATQSYGAYP | 79.22 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 2 | 36 | 22 | 31 | 10 | GQGYSQQSSQ | 80.27 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 39 | 95 | 51 | 70 | 20 | GQSSYSSYGQSQNTGYGTQS | 78.56 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 98 | 214 | 126 | 151 | 26 | QSGSYSQQPSYGGQQQSYGQQQSYNP | 83.39 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 98 | 214 | 156 | 165 | 10 | GQQNQYNSSS | 86.42 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 98 | 214 | 173 | 184 | 12 | GGGNYGQDQSSM | 80.6 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 285 | 370 | 293 | 314 | 22 | GENVTIESVADYFKQIGIIKTN | 79.23 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 285 | 370 | 318 | 327 | 10 | GQPMINLYTD | 81.74 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 285 | 370 | 347 | 360 | 14 | AKAAIDWFDGKEFS | 89.18 |
| DP01102 | P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | Homo sapiens (Human) | 421 | 455 | 432 | 446 | 15 | TCENMNFSWRNECNQ | 82.32 |
| DP01103 | Q13698 | Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1) | Homo sapiens (Human) | 665 | 785 | 667 | 673 | 7 | AESLTSA | 82.27 |
| DP01103 | Q13698 | Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1) | Homo sapiens (Human) | 665 | 785 | 718 | 732 | 15 | AKLKIDEFESNVNEV | 79.55 |
| DP01103 | Q13698 | Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1) | Homo sapiens (Human) | 665 | 785 | 769 | 780 | 12 | KAVPIPEASSFF | 81.22 |
| DP01103 | Q13698 | Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1) | Homo sapiens (Human) | 666 | 791 | 667 | 673 | 7 | AESLTSA | 82.27 |
| DP01103 | Q13698 | Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1) | Homo sapiens (Human) | 666 | 791 | 718 | 732 | 15 | AKLKIDEFESNVNEV | 79.55 |
| DP01103 | Q13698 | Voltage-dependent L-type calcium channel subunit alpha-1S (Calcium channel; L type; alpha-1 polypeptide; isoform 3; skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1) | Homo sapiens (Human) | 666 | 791 | 769 | 786 | 18 | KAVPIPEASSFFIFSPTN | 79.9 |
| DP01104 | P46531 | Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD) | Homo sapiens (Human) | 1758 | 1888 | 1764 | 1771 | 8 | HGQLWFPE | 95.53 |
| DP01104 | P46531 | Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD) | Homo sapiens (Human) | 1758 | 1888 | 1840 | 1849 | 10 | HRQWTQQHLD | 76.96 |
| DP01105 | P20444 | Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13) | Mus musculus (Mouse) | 606 | 672 | 622 | 633 | 12 | GAENFDKFFTRG | 80.82 |
| DP01105 | P20444 | Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13) | Mus musculus (Mouse) | 606 | 672 | 641 | 667 | 27 | DQLVIANIDQSDFEGFSYVNPQFVHPI | 83.22 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 236 | 268 | 33 | TVWISVAVLSAVICLIIVWAVALKGYSMVTCIF | 84.24 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 279 | 286 | 8 | FDAHLLEK | 73.91 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 289 | 302 | 14 | SEELLSALGCQDFP | 76.47 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 310 | 317 | 8 | LLVEYLEV | 82.48 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 321 | 331 | 11 | EDQHLMSVHSK | 75.25 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 370 | 382 | 13 | NPSTFYDPEVIEK | 80.6 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 394 | 407 | 14 | PQCISMEGKIPYFH | 75.78 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 429 | 441 | 13 | SYHNITDVCELAV | 78.03 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 477 | 487 | 11 | REVESFHSETD | 75.92 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 508 | 514 | 7 | DYVEIHK | 87.29 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 519 | 525 | 7 | GALSLLP | 79.26 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 553 | 559 | 7 | MDNNILV | 83.52 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 568 | 576 | 9 | NVACFEESA | 79.41 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 598 | 583 | 593 | 11 | LEQNQAEKALA | 77.47 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 396 | 236 | 268 | 33 | TVWISVAVLSAVICLIIVWAVALKGYSMVTCIF | 84.24 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 396 | 279 | 286 | 8 | FDAHLLEK | 73.91 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 396 | 289 | 302 | 14 | SEELLSALGCQDFP | 76.47 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 396 | 310 | 317 | 8 | LLVEYLEV | 82.48 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 396 | 321 | 331 | 11 | EDQHLMSVHSK | 75.25 |
| DP01106 | P16471 | Prolactin receptor (PRL-R) | Homo sapiens (Human) | 236 | 396 | 370 | 382 | 13 | NPSTFYDPEVIEK | 80.6 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 1 | 10 | 10 | MSEYIRVTED | 84.28 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 12 | 19 | 8 | NDEPIEIP | 74.58 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 24 | 36 | 13 | GTVLLSTVTAQFP | 79.93 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 56 | 62 | 7 | LVEGILH | 79.93 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 67 | 76 | 10 | GWGNLVYVVN | 87.56 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 99 | 116 | 18 | AVQKTSDLIVLGLPWKTT | 79.86 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 119 | 142 | 24 | DLKEYFSTFGEVLMVQVKKDLKTG | 85.93 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 145 | 162 | 18 | KGFGFVRFTEYETQVKVM | 78.35 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 206 | 223 | 18 | ELREFFSQYGDVMDVFIP | 87.22 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 225 | 261 | 37 | PFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAE | 83.11 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 285 | 293 | 9 | NQGGFGNSR | 74.58 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 309 | 320 | 12 | GGMNFGAFSINP | 92.06 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 326 | 336 | 11 | AQAALQSSWGM | 80.27 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 338 | 347 | 10 | GMLASQQNQS | 74.98 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 363 | 390 | 28 | PNQAFGSGNNSYSGSNSGAAIGWGSASN | 76.19 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 1 | 414 | 400 | 409 | 10 | GFGSSMDSKS | 74.25 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 263 | 414 | 285 | 293 | 9 | NQGGFGNSR | 74.58 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 263 | 414 | 309 | 320 | 12 | GGMNFGAFSINP | 92.06 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 263 | 414 | 326 | 336 | 11 | AQAALQSSWGM | 80.27 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 263 | 414 | 338 | 347 | 10 | GMLASQQNQS | 74.98 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 263 | 414 | 363 | 390 | 28 | PNQAFGSGNNSYSGSNSGAAIGWGSASN | 76.19 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 263 | 414 | 400 | 409 | 10 | GFGSSMDSKS | 74.25 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 266 | 414 | 285 | 293 | 9 | NQGGFGNSR | 74.58 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 266 | 414 | 309 | 320 | 12 | GGMNFGAFSINP | 92.06 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 266 | 414 | 326 | 336 | 11 | AQAALQSSWGM | 80.27 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 266 | 414 | 338 | 347 | 10 | GMLASQQNQS | 74.98 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 266 | 414 | 363 | 390 | 28 | PNQAFGSGNNSYSGSNSGAAIGWGSASN | 76.19 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 266 | 414 | 400 | 409 | 10 | GFGSSMDSKS | 74.25 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 267 | 414 | 285 | 293 | 9 | NQGGFGNSR | 74.58 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 267 | 414 | 309 | 320 | 12 | GGMNFGAFSINP | 92.06 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 267 | 414 | 326 | 336 | 11 | AQAALQSSWGM | 80.27 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 267 | 414 | 338 | 347 | 10 | GMLASQQNQS | 74.98 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 267 | 414 | 363 | 390 | 28 | PNQAFGSGNNSYSGSNSGAAIGWGSASN | 76.19 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 267 | 414 | 400 | 409 | 10 | GFGSSMDSKS | 74.25 |
| DP01108 | Q13148 | TAR DNA-binding protein 43 (TDP-43) | Homo sapiens (Human) | 321 | 343 | 326 | 336 | 11 | AQAALQSSWGM | 80.27 |
| DP01109 | P22626 | Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1) | Homo sapiens (Human) | 190 | 341 | 203 | 211 | 9 | RGGNFGFGD | 77.26 |
| DP01109 | P22626 | Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1) | Homo sapiens (Human) | 190 | 341 | 286 | 314 | 29 | GYDNYGGGNYGSGNYNDFGNYNQQPSNYG | 87.71 |
| DP01110 | Q9UHD9 | Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) | Homo sapiens (Human) | 450 | 624 | 451 | 477 | 27 | AMQALMQIQQGLQTLATEAPGLIPSFT | 77.55 |
| DP01110 | Q9UHD9 | Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) | Homo sapiens (Human) | 450 | 624 | 556 | 570 | 15 | NQQFIQQMVQALAGA | 81.98 |
| DP01110 | Q9UHD9 | Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) | Homo sapiens (Human) | 450 | 624 | 578 | 619 | 42 | PEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLL | 79.06 |
| DP01113 | D0PV95 | ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1) | Caenorhabditis elegans | 1 | 168 | 12 | 23 | 12 | GNAALNRGGRYV | 76.25 |
| DP01113 | D0PV95 | ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1) | Caenorhabditis elegans | 1 | 168 | 91 | 101 | 11 | RDRNYEDRGYN | 80.6 |
| DP01113 | D0PV95 | ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1) | Caenorhabditis elegans | 1 | 168 | 119 | 126 | 8 | GGGGYNRQ | 75.25 |
| DP01113 | D0PV95 | ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1) | Caenorhabditis elegans | 1 | 168 | 132 | 145 | 14 | GSSNFSRGGYNNRD | 88.63 |
| DP01113 | D0PV95 | ATP-dependent RNA helicase laf-1 (EC 3.6.4.13) (DEAD-box RNA helicase laf-1) | Caenorhabditis elegans | 1 | 168 | 153 | 159 | 7 | SGRSYNN | 75.92 |
| DP01116 | Q03164 | Histone-lysine N-methyltransferase 2A (Lysine N-methyltransferase 2A) (EC 2.1.1.354) (ALL-1) (CXXC-type zinc finger protein 7) (Cysteine methyltransferase KMT2A) (EC 2.1.1.-) (Myeloid/lymphoid or mixed-lineage leukemia) (Myeloid/lymphoid or mixed-lineage leukemia protein 1) (Trithorax-like protein) (Zinc finger protein HRX) Cleaved into: MLL cleavage product N320 (N-terminal cleavage product of 320 kDa) (p320); MLL cleavage product C180 (C-terminal cleavage product of 180 kDa) (p180) | Homo sapiens (Human) | 140 | 160 | 144 | 152 | 9 | EDEQFLGFG | 79.12 |
| DP01117 | O60566 | Mitotic checkpoint serine/threonine-protein kinase BUB1 beta (EC 2.7.11.1) (MAD3/BUB1-related protein kinase) (hBUBR1) (Mitotic checkpoint kinase MAD3L) (Protein SSK1) | Homo sapiens (Human) | 20 | 42 | 20 | 28 | 9 | DEWELSKEN | 79.26 |
| DP01118 | Q12834 | Cell division cycle protein 20 homolog (p55CDC) | Homo sapiens (Human) | 81 | 164 | 85 | 99 | 15 | AAQMEVASFLLSKEN | 77.75 |
| DP01118 | Q12834 | Cell division cycle protein 20 homolog (p55CDC) | Homo sapiens (Human) | 81 | 164 | 112 | 135 | 24 | HQKAWALNLNGFDVEEAKILRLSG | 81.56 |
| DP01118 | Q12834 | Cell division cycle protein 20 homolog (p55CDC) | Homo sapiens (Human) | 81 | 164 | 143 | 154 | 12 | GYQNRLKVLYSQ | 79.77 |
| DP01119 | P35222 | Catenin beta-1 (Beta-catenin) | Homo sapiens (Human) | 1 | 137 | 21 | 48 | 28 | AVSHWQQQSYLDSGIHSGATTTAPSLSG | 85.2 |
| DP01119 | P35222 | Catenin beta-1 (Beta-catenin) | Homo sapiens (Human) | 1 | 137 | 60 | 76 | 17 | SQVLYEWEQGFSQSFTQ | 80.54 |
| DP01119 | P35222 | Catenin beta-1 (Beta-catenin) | Homo sapiens (Human) | 1 | 137 | 78 | 89 | 12 | QVADIDGQYAMT | 76.37 |
| DP01119 | P35222 | Catenin beta-1 (Beta-catenin) | Homo sapiens (Human) | 19 | 44 | 21 | 39 | 19 | AVSHWQQQSYLDSGIHSGA | 85 |
| DP01119 | P35222 | Catenin beta-1 (Beta-catenin) | Homo sapiens (Human) | 683 | 781 | 688 | 694 | 7 | MAWNETA | 75.59 |
| DP01119 | P35222 | Catenin beta-1 (Beta-catenin) | Homo sapiens (Human) | 683 | 781 | 769 | 776 | 8 | GDSNQLAW | 79.89 |
| DP01119 | P35222 | Catenin beta-1 (Beta-catenin) | Homo sapiens (Human) | 687 | 781 | 688 | 694 | 7 | MAWNETA | 75.59 |
| DP01119 | P35222 | Catenin beta-1 (Beta-catenin) | Homo sapiens (Human) | 687 | 781 | 769 | 776 | 8 | GDSNQLAW | 79.89 |
| DP01119 | P35222 | Catenin beta-1 (Beta-catenin) | Homo sapiens (Human) | 692 | 781 | 769 | 776 | 8 | GDSNQLAW | 79.89 |
| DP01126 | O43561 | Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) | Homo sapiens (Human) | 28 | 233 | 36 | 46 | 11 | YDSTSSDSLYP | 82.82 |
| DP01126 | O43561 | Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) | Homo sapiens (Human) | 28 | 233 | 105 | 119 | 15 | NSVASYENEGASGIR | 76.19 |
| DP01126 | O43561 | Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) | Homo sapiens (Human) | 28 | 233 | 161 | 167 | 7 | YLVVLPD | 77.26 |
| DP01126 | O43561 | Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) | Homo sapiens (Human) | 28 | 233 | 188 | 204 | 17 | RDSAFSMESIDDYVNVP | 80.62 |
| DP01126 | O43561 | Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) | Homo sapiens (Human) | 28 | 233 | 207 | 225 | 19 | GESAEASLDGSREYVNVSQ | 75.02 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 608 | 616 | 9 | QKAEYSKYE | 82.39 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 625 | 633 | 9 | PQSLEMMAI | 74.43 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 650 | 661 | 12 | KMTTFQDSELSG | 76.09 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 663 | 669 | 7 | LQAALSG | 76.21 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 726 | 733 | 8 | RSQEYLLD | 80.69 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 831 | 839 | 9 | RGFAYVLPQ | 79.6 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 883 | 891 | 9 | SLNRYAASD | 82.94 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 904 | 911 | 8 | AAGPYATV | 79.26 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 959 | 965 | 7 | ASANLAD | 77.26 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1001 | 1015 | 15 | SVKSIAAMLELSSIG | 78.22 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1039 | 1048 | 10 | GRVATVLASV | 79.67 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1071 | 1078 | 8 | VTGLLATA | 80.69 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1120 | 1126 | 7 | EASATLK | 75.25 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1137 | 1146 | 10 | ENVKFILTES | 80.9 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1167 | 1178 | 12 | PLSVYQNGTATI | 80.1 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1290 | 1296 | 7 | GLQSSSA | 75.25 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1309 | 1315 | 7 | PAALIKP | 79.93 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1370 | 1390 | 21 | KLEETSACLAAALQAVEEKIR | 76.33 |
| DP01127 | Q8VHK2 | Caskin-1 (CASK-interacting protein 1) | Rattus norvegicus (Rat) | 603 | 1430 | 1406 | 1419 | 14 | STGSILEDIGSMFD | 76.06 |
| DP01128 | O43806 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) (Fragment) | Homo sapiens (Human) | 25 | 93 | 28 | 34 | 7 | ACRNLFG | 75.35 |
| DP01128 | O43806 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) (Fragment) | Homo sapiens (Human) | 25 | 93 | 56 | 68 | 13 | SQRKWNFDFQNHK | 80.55 |
| DP01128 | O43806 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) (Fragment) | Homo sapiens (Human) | 25 | 93 | 70 | 81 | 12 | LEGKYEWQEVEK | 75.42 |
| DP01131 | O14558 | Heat shock protein beta-6 (HspB6) (Heat shock 20 kDa-like protein p20) | Homo sapiens (Human) | 1 | 56 | 29 | 46 | 18 | FDQRFGEGLLEAELAALC | 75.75 |
| DP01133 | Q00987 | E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) | Homo sapiens (Human) | 216 | 302 | 239 | 276 | 38 | GDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSD | 78.81 |
| DP01133 | Q00987 | E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) | Homo sapiens (Human) | 216 | 302 | 278 | 297 | 20 | DDEVYQVTVYQAGESDTDSF | 79.41 |
| DP01134 | P10071 | Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83) | Homo sapiens (Human) | 106 | 236 | 106 | 112 | 7 | GTVFAMD | 77.07 |
| DP01134 | P10071 | Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83) | Homo sapiens (Human) | 106 | 236 | 158 | 166 | 9 | MTSALSSSP | 73.91 |
| DP01134 | P10071 | Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83) | Homo sapiens (Human) | 106 | 236 | 196 | 206 | 11 | YINPYMDYIRS | 78.66 |
| DP01134 | P10071 | Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83) | Homo sapiens (Human) | 106 | 236 | 212 | 220 | 9 | SLSMISATR | 77.93 |
| DP01135 | P40019 | Histone H2A.Z-specific chaperone CHZ1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 153 | 91 | 104 | 14 | DLAEIDTSNIITSG | 81.87 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 164 | 18 | 28 | 11 | NAENNNNSNAA | 78.72 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 164 | 36 | 54 | 19 | AEQTRNITVSIQYSYFTPE | 87.1 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 164 | 56 | 73 | 18 | LAHLSNISNNDNNENNSA | 79.43 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 164 | 75 | 83 | 9 | SGSTIANGT | 86.62 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 164 | 98 | 106 | 9 | GALVLSFRD | 81.27 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 164 | 115 | 136 | 22 | RLNSFISVAAQLAMERFNRLLN | 82.12 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 164 | 151 | 157 | 7 | VLQVSDL | 75.59 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 300 | 316 | 17 | VAANEAAFERIRRVLYD | 83.93 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 318 | 329 | 12 | TAVNSTNENSSA | 76.98 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 331 | 347 | 17 | SENTSNTTVPTIGNASS | 75.23 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 354 | 361 | 8 | RTGFFLVP | 78.05 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 412 | 421 | 10 | PLTLFQFHSP | 77.46 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 441 | 447 | 7 | NSNNTSS | 76.92 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 460 | 469 | 10 | VLDHIFNVAQ | 82.78 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 501 | 518 | 18 | QGSSFLENISRLTGHFTN | 78.87 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 525 | 531 | 7 | NDNNHSN | 74.25 |
| DP01136 | P22470 | Protein SAN1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 281 | 610 | 540 | 576 | 37 | GENNRNNLFSSGVASYRNQNGDVTTVELRNNNSAAFP | 77.88 |
| DP01137 | Q6FI81 | Anamorsin (Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog) | Homo sapiens (Human) | 173 | 266 | 174 | 180 | 7 | LKLSITK | 77.26 |
| DP01137 | Q6FI81 | Anamorsin (Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog) | Homo sapiens (Human) | 173 | 266 | 194 | 204 | 11 | AAKLWTLSAND | 84.92 |
| DP01137 | Q6FI81 | Anamorsin (Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog) | Homo sapiens (Human) | 173 | 266 | 209 | 220 | 12 | SMDLIDSDELLD | 78.6 |
| DP01139 | A0A0G2JXC5 | Myocardin-related transcription factor A | Rattus norvegicus (Rat) | 85 | 116 | 89 | 97 | 9 | KNVLQLKLQ | 76.14 |
| DP01140 | P38293 | Proteasome maturation factor UMP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 148 | 19 | 25 | 7 | KSVLSSA | 79.93 |
| DP01140 | P38293 | Proteasome maturation factor UMP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 148 | 56 | 64 | 9 | TLKNWETTQ | 76.48 |
| DP01140 | P38293 | Proteasome maturation factor UMP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 148 | 71 | 80 | 10 | QYRQIFGIAE | 87.19 |
| DP01140 | P38293 | Proteasome maturation factor UMP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 148 | 86 | 133 | 48 | MEMEIVNRTDFNPLSTNGSIHRDILLNKECSIDWEDVYPGTGLQASTM | 77.95 |
| DP01140 | P38293 | Proteasome maturation factor UMP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 84 | 19 | 25 | 7 | KSVLSSA | 79.93 |
| DP01140 | P38293 | Proteasome maturation factor UMP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 84 | 56 | 64 | 9 | TLKNWETTQ | 76.48 |
| DP01140 | P38293 | Proteasome maturation factor UMP1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 84 | 71 | 79 | 9 | QYRQIFGIA | 87.07 |
| DP01141 | P70604 | Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2) | Rattus norvegicus (Rat) | 396 | 424 | 406 | 412 | 7 | HVHNFMM | 87.96 |
| DP01141 | P70604 | Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2) | Rattus norvegicus (Rat) | 436 | 487 | 452 | 466 | 15 | HQRKFLQAIHQLRSV | 77.84 |
| DP01141 | P70604 | Small conductance calcium-activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2) | Rattus norvegicus (Rat) | 436 | 487 | 475 | 482 | 8 | DQANTLVD | 79.93 |
| DP01142 | O92972 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (strain HC-J4) (HCV) | 191 | 447 | 196 | 222 | 27 | NVSGIYHVTNDCSNSSIVYEAADVIMH | 81.52 |
| DP01142 | O92972 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (strain HC-J4) (HCV) | 191 | 447 | 261 | 277 | 17 | HVDLLVGTAAFCSAMYV | 77 |
| DP01142 | O92972 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (strain HC-J4) (HCV) | 191 | 447 | 280 | 292 | 13 | LCGSIFLVSQLFT | 86.75 |
| DP01142 | O92972 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (strain HC-J4) (HCV) | 191 | 447 | 304 | 310 | 7 | CNCSIYP | 89.68 |
| DP01142 | O92972 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (strain HC-J4) (HCV) | 191 | 447 | 322 | 328 | 7 | MMMNWSP | 74.49 |
| DP01142 | O92972 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (strain HC-J4) (HCV) | 191 | 447 | 331 | 341 | 11 | ALVVSQLLRIP | 79.17 |
| DP01142 | O92972 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (strain HC-J4) (HCV) | 191 | 447 | 349 | 381 | 33 | AGAHWGVLAGLAYYSMVGNWAKVLIVALLFAGV | 82.79 |
| DP01142 | O92972 | Genome polyprotein Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68) | Hepatitis C virus genotype 1b (strain HC-J4) (HCV) | 191 | 447 | 397 | 442 | 46 | SGFTSLFSSGASQKIQLVNTNGSWHINRTALNCNDSLQTGFFAALF | 83.63 |
| DP01144 | P08008 | Outer membrane virulence protein YopE | Yersinia pseudotuberculosis serotype I (strain IP32953) | 1 | 100 | 2 | 11 | 10 | KISSFISTSL | 80.97 |
| DP01144 | P08008 | Outer membrane virulence protein YopE | Yersinia pseudotuberculosis serotype I (strain IP32953) | 1 | 100 | 32 | 44 | 13 | SQQTSDQYANNLA | 79.57 |
| DP01144 | P08008 | Outer membrane virulence protein YopE | Yersinia pseudotuberculosis serotype I (strain IP32953) | 1 | 100 | 55 | 82 | 28 | LASRIIERLSSVAHSVIGFIQRMFSEGS | 82.74 |
| DP01146 | O34800 | Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) | Bacillus subtilis (strain 168) | 1 | 56 | 1 | 9 | 9 | MERAFQNRC | 79.93 |
| DP01146 | O34800 | Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) | Bacillus subtilis (strain 168) | 1 | 56 | 26 | 51 | 26 | TSVASYQVSPHTARIFKENERLIDEY | 79.91 |
| DP01146 | O34800 | Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) | Bacillus subtilis (strain 168) | 9 | 52 | 26 | 47 | 22 | TSVASYQVSPHTARIFKENERL | 79.9 |
| DP01146 | O34800 | Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) | Bacillus subtilis (strain 168) | 13 | 53 | 26 | 48 | 23 | TSVASYQVSPHTARIFKENERLI | 79.9 |
| DP01147 | Q9I322 | Type III secretion regulatory protein ExsE | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) | 1 | 81 | 2 | 8 | 7 | KIESISP | 87.29 |
| DP01147 | Q9I322 | Type III secretion regulatory protein ExsE | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) | 1 | 81 | 43 | 49 | 7 | GLARWLA | 79.36 |
| DP01147 | Q9I322 | Type III secretion regulatory protein ExsE | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) | 1 | 81 | 58 | 66 | 9 | SEQALQRLA | 74.36 |
| DP01148 | A0A068MVV3 | Glutamine synthetase inactivating factor IF7 | Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714)) | 1 | 65 | 4 | 12 | 9 | QQQARALMM | 73.91 |
| DP01148 | A0A068MVV3 | Glutamine synthetase inactivating factor IF7 | Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714)) | 1 | 65 | 14 | 20 | 7 | HHQFIKN | 84.09 |
| DP01148 | A0A068MVV3 | Glutamine synthetase inactivating factor IF7 | Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714)) | 1 | 65 | 22 | 45 | 24 | QQSLLSRAAAEIGVQAEKDFWTTV | 82.97 |
| DP01149 | Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa | Homo sapiens (Human) | 1 | 150 | 11 | 18 | 8 | TMQVSFVC | 93.81 |
| DP01149 | Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa | Homo sapiens (Human) | 1 | 150 | 29 | 50 | 22 | TSFKILDRVTIQELTAPLLTTA | 79.4 |
| DP01149 | Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa | Homo sapiens (Human) | 1 | 150 | 66 | 72 | 7 | EEPFIET | 73.91 |
| DP01149 | Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa | Homo sapiens (Human) | 1 | 150 | 93 | 105 | 13 | SANSFTLIGEASD | 86.26 |
| DP01149 | Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa | Homo sapiens (Human) | 1 | 150 | 108 | 114 | 7 | TMENLSR | 76.92 |
| DP01149 | Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa | Homo sapiens (Human) | 1 | 150 | 119 | 128 | 10 | TGDLFDIMSG | 84.01 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 139 | 1 | 30 | 30 | MRHIICHGGVITEEMAASLLDQLIEEVLAD | 80.52 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 139 | 43 | 53 | 11 | LHELYDLDVTA | 90.97 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 139 | 61 | 67 | 7 | AVSQIFP | 87 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 139 | 74 | 83 | 10 | VQEGIDLLTF | 81.24 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 139 | 116 | 127 | 12 | VPEVIDLTCHEA | 74.5 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 91 | 1 | 30 | 30 | MRHIICHGGVITEEMAASLLDQLIEEVLAD | 80.52 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 91 | 43 | 53 | 11 | LHELYDLDVTA | 90.97 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 91 | 61 | 67 | 7 | AVSQIFP | 87 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 91 | 74 | 83 | 10 | VQEGIDLLTF | 81.24 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 1 | 36 | 1 | 30 | 30 | MRHIICHGGVITEEMAASLLDQLIEEVLAD | 80.52 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 27 | 91 | 43 | 53 | 11 | LHELYDLDVTA | 90.97 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 27 | 91 | 61 | 67 | 7 | AVSQIFP | 87 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 27 | 91 | 74 | 83 | 10 | VQEGIDLLTF | 81.24 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 36 | 91 | 43 | 53 | 11 | LHELYDLDVTA | 90.97 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 36 | 91 | 61 | 67 | 7 | AVSQIFP | 87 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 36 | 91 | 74 | 83 | 10 | VQEGIDLLTF | 81.24 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 53 | 91 | 61 | 67 | 7 | AVSQIFP | 87 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 53 | 91 | 74 | 83 | 10 | VQEGIDLLTF | 81.24 |
| DP01150 | P03255 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 106 | 139 | 116 | 127 | 12 | VPEVIDLTCHEA | 74.5 |
| DP01151 | P03259 | Early E1A protein (Early E1A 29.5 kDa protein) | Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) | 1 | 266 | 7 | 14 | 8 | PLVLSYQE | 76.46 |
| DP01151 | P03259 | Early E1A protein (Early E1A 29.5 kDa protein) | Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) | 1 | 266 | 18 | 30 | 13 | ILEHLVDNFFNEV | 87.81 |
| DP01151 | P03259 | Early E1A protein (Early E1A 29.5 kDa protein) | Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) | 1 | 266 | 33 | 52 | 20 | DDDLYVPSLYELYDLDVESA | 87.53 |
| DP01151 | P03259 | Early E1A protein (Early E1A 29.5 kDa protein) | Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) | 1 | 266 | 54 | 79 | 26 | EDNNEQAVNEFFPESLILAASEGLFL | 78.6 |
| DP01151 | P03259 | Early E1A protein (Early E1A 29.5 kDa protein) | Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) | 1 | 266 | 105 | 112 | 8 | MDLLCYEM | 81.73 |
| DP01151 | P03259 | Early E1A protein (Early E1A 29.5 kDa protein) | Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) | 1 | 266 | 130 | 140 | 11 | HVSASAAAAAA | 76.59 |
| DP01151 | P03259 | Early E1A protein (Early E1A 29.5 kDa protein) | Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) | 1 | 266 | 176 | 191 | 16 | CSLCYLRAYNMFIYSP | 82.04 |
| DP01151 | P03259 | Early E1A protein (Early E1A 29.5 kDa protein) | Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) | 1 | 266 | 237 | 249 | 13 | AVESILDLIQEEE | 78.08 |
| DP01152 | Q9JK11 | Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) | Rattus norvegicus (Rat) | 544 | 725 | 544 | 569 | 26 | TGTKIAYETKVDLVQTSEAIQESLYP | 81.23 |
| DP01152 | Q9JK11 | Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) | Rattus norvegicus (Rat) | 544 | 725 | 590 | 602 | 13 | DIVMEAPLNSLLP | 75.92 |
| DP01152 | Q9JK11 | Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) | Rattus norvegicus (Rat) | 544 | 725 | 641 | 649 | 9 | MNVALKALG | 74.58 |
| DP01152 | Q9JK11 | Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) | Rattus norvegicus (Rat) | 544 | 725 | 662 | 682 | 21 | AAVQETEAPYISIACDLIKET | 78.34 |
| DP01152 | Q9JK11 | Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) | Rattus norvegicus (Rat) | 544 | 725 | 691 | 705 | 15 | DFSNYSEIAKFEKSV | 81.2 |
| DP01153 | P9WI73 | Serine/threonine-protein kinase PknG (EC 2.7.11.1) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 75 | 19 | 27 | 9 | AQTATSATV | 78.71 |
| DP01153 | P9WI73 | Serine/threonine-protein kinase PknG (EC 2.7.11.1) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 75 | 32 | 38 | 7 | TQAVFRP | 81.61 |
| DP01154 | P19594 | 2S albumin (GM2S-1) (Napin-type 2S albumin 3) Cleaved into: 2S albumin small chain (Aspartic acid-rich peptide) (Lunasin); 2S albumin large chain (8 kDa methionine-rich protein) (8 kDa MRP) | Glycine max (Soybean) (Glycine hispida) | 22 | 64 | 36 | 42 | 7 | QGVNLTP | 76.88 |
| DP01155 | O66858 | RNA polymerase sigma factor RpoN | Aquifex aeolicus (strain VF5) | 1 | 60 | 3 | 54 | 52 | NQRLEVRQKLNLKLLLKQDLELLTYQTQELEKLIHEEVLVNPLIKGVFKKIP | 77.91 |
| DP01156 | P07305 | "Histone H1.0 (Histone H1) (Histone H1(0)) Cleaved into: Histone H1.0; N-terminally processed" | Homo sapiens (Human) | 1 | 22 | 1 | 8 | 8 | MTENSTSA | 73.91 |
| DP01157 | P04908 | Histone H2A type 1-B/E (Histone H2A.2) (Histone H2A/a) (Histone H2A/m) | Homo sapiens (Human) | 98 | 130 | 106 | 118 | 13 | GGVLPNIQAVLLP | 79.52 |
| DP01159 | A6NF83 | Nuclear protein 2 (Nuclear transcriptional regulator 1-like protein) (Nuclear transcriptional regulator protein 2) | Homo sapiens (Human) | 1 | 97 | 24 | 39 | 16 | YEEELYDCLDYYYLRD | 82.36 |
| DP01159 | A6NF83 | Nuclear protein 2 (Nuclear transcriptional regulator 1-like protein) (Nuclear transcriptional regulator protein 2) | Homo sapiens (Human) | 1 | 97 | 72 | 80 | 9 | VAQKLLNGQ | 79.78 |
| DP01160 | P9WPI9 | Tyrosine-protein kinase PtkA (EC 2.7.10.-) (Protein tyrosine kinase A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 81 | 37 | 54 | 18 | GSGLSNRFVNDNGIVTDT | 77.31 |
| DP01161 | Q9UMS4 | Pre-mRNA-processing factor 19 (EC 2.3.2.27) (Nuclear matrix protein 200) (PRP19/PSO4 homolog) (hPso4) (RING-type E3 ubiquitin transferase PRP19) (Senescence evasion factor) | Homo sapiens (Human) | 169 | 194 | 169 | 186 | 18 | TPEIIQKLQDKATVLTTE | 78.26 |
| DP01162 | Q96SD1 | Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein) | Homo sapiens (Human) | 480 | 575 | 486 | 508 | 23 | VPQWEVFFKRNDEITDESLENFP | 82.46 |
| DP01162 | Q96SD1 | Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein) | Homo sapiens (Human) | 480 | 575 | 539 | 546 | 8 | QSTHITEQ | 74.58 |
| DP01162 | Q96SD1 | Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein) | Homo sapiens (Human) | 480 | 575 | 556 | 563 | 8 | DTVLLSSQ | 80.31 |
| DP01163 | O14974 | Protein phosphatase 1 regulatory subunit 12A (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (Protein phosphatase myosin-binding subunit) | Homo sapiens (Human) | 1 | 40 | 14 | 23 | 10 | LKRWIGSETD | 79.93 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 346 | 356 | 11 | AVGPYIQSSTM | 77.17 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 374 | 382 | 9 | GSLVIQASE | 80.68 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 417 | 423 | 7 | NADLFPS | 79.93 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 488 | 497 | 10 | AQVANKNVAK | 75.25 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 507 | 518 | 12 | KQINLPYFGQTN | 76.03 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 530 | 540 | 11 | SQQLSTVVPSM | 80.02 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 603 | 615 | 13 | TVAASSIYSMYTQ | 84.64 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 625 | 633 | 9 | QAVQSALTK | 79 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 641 | 657 | 17 | FSSVYGKPVIAAAQNQQ | 78.73 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 331 | 692 | 659 | 668 | 10 | HPENIYSNSQ | 80.67 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 693 | 918 | 701 | 710 | 10 | KLLPFLSNPY | 79.26 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 693 | 918 | 734 | 740 | 7 | KRSSITE | 74.25 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 693 | 918 | 745 | 767 | 23 | NGPNIQKLLYQRTTIAAMETISV | 78.86 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 693 | 918 | 774 | 794 | 21 | SASVTASSESPVEIQNPYLHV | 77.75 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 693 | 918 | 798 | 804 | 7 | KEVVSLV | 77.78 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 693 | 918 | 815 | 822 | 8 | NASTENSD | 79.93 |
| DP01164 | Q13625 | Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2) | Homo sapiens (Human) | 693 | 918 | 858 | 866 | 9 | VLDVYLEEY | 83.61 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 148 | 2 | 34 | 33 | QIQSFYHSASLKTQEAFKSLQKTLYNGMQILSG | 79.09 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 148 | 46 | 54 | 9 | RPEIIVLRE | 80.94 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 148 | 58 | 64 | 7 | TWGNYLQ | 80.46 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 148 | 72 | 93 | 22 | SLHNLYNLQRDLLTVAATVLGK | 82.58 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 148 | 95 | 110 | 16 | DPVLTSMANQMELAKV | 75.25 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 148 | 128 | 139 | 12 | KKNLIELIAART | 92.92 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 29 | 168 | 46 | 54 | 9 | RPEIIVLRE | 80.94 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 29 | 168 | 58 | 64 | 7 | TWGNYLQ | 80.46 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 29 | 168 | 72 | 93 | 22 | SLHNLYNLQRDLLTVAATVLGK | 82.58 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 29 | 168 | 95 | 110 | 16 | DPVLTSMANQMELAKV | 75.25 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 29 | 168 | 128 | 139 | 12 | KKNLIELIAART | 92.92 |
| DP01166 | O30916 | Inositol phosphate phosphatase SopB (EC 3.1.3.-) (Effector protein SopB) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 29 | 168 | 154 | 163 | 10 | AAVAFRDAQV | 88.26 |
| DP01167 | P02730 | Band 3 anion transport protein (Anion exchange protein 1) (AE 1) (Anion exchanger 1) (Solute carrier family 4 member 1) (CD antigen CD233) | Homo sapiens (Human) | 1 | 54 | 12 | 23 | 12 | MEENLEQEEYED | 76.42 |
| DP01169 | P24255 | RNA polymerase sigma-54 factor | Escherichia coli (strain K12) | 1 | 105 | 4 | 16 | 13 | GLQLRLSQQLAMT | 75.77 |
| DP01169 | P24255 | RNA polymerase sigma-54 factor | Escherichia coli (strain K12) | 1 | 105 | 19 | 57 | 39 | LQQAIRLLQLSTLELQQELQQALESNPLLEQIDTHEEID | 78.81 |
| DP01169 | P24255 | RNA polymerase sigma-54 factor | Escherichia coli (strain K12) | 1 | 105 | 70 | 78 | 9 | ADALEQKEM | 79.93 |
| DP01169 | P24255 | RNA polymerase sigma-54 factor | Escherichia coli (strain K12) | 1 | 105 | 84 | 95 | 12 | LDASWDTIYTAG | 79.88 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 442 | 453 | 12 | NPTNIQNFQLPP | 77.62 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 462 | 488 | 27 | NGQLLMIPQQALAQMQAQAHAQPQTTM | 75.82 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 501 | 507 | 7 | VQISTVQ | 79.93 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 549 | 571 | 23 | QLVLGGAAQTASLGTATAVQTGT | 75.25 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 595 | 607 | 13 | KCKNFLSTLIKLA | 77.77 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 618 | 657 | 40 | ANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFL | 79.49 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 670 | 679 | 10 | DSAAFIQQSQ | 82.41 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 687 | 718 | 32 | SQATTALTAVVLSSSVQRTAGKTAATVTSALQ | 77.07 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 739 | 745 | 7 | TPLVIQQ | 79.93 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 756 | 762 | 7 | PQVTLTQ | 74.25 |
| DP01170 | O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | Homo sapiens (Human) | 408 | 838 | 774 | 788 | 15 | RIMLTTPQQIQLNPL | 74.94 |
| DP01172 | O43516 | WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein) | Homo sapiens (Human) | 2 | 101 | 14 | 22 | 9 | TFALANTEK | 79.6 |
| DP01172 | O43516 | WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein) | Homo sapiens (Human) | 2 | 65 | 14 | 22 | 9 | TFALANTEK | 79.6 |
| DP01172 | O43516 | WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein) | Homo sapiens (Human) | 407 | 503 | 447 | 460 | 14 | EDEWESRFYFHPIS | 78.17 |
| DP01172 | O43516 | WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein) | Homo sapiens (Human) | 407 | 503 | 468 | 476 | 9 | YVQTTKSYP | 75.25 |
| DP01173 | Q15726 | Metastasis-suppressor KiSS-1 (Kisspeptin-1) Cleaved into: Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10 | Homo sapiens (Human) | 20 | 138 | 35 | 45 | 11 | GQQLESLGLLA | 79.72 |
| DP01173 | Q15726 | Metastasis-suppressor KiSS-1 (Kisspeptin-1) Cleaved into: Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10 | Homo sapiens (Human) | 20 | 138 | 108 | 122 | 15 | DLPNYNWNSFGLRFG | 81.2 |
| DP01174 | O43474 | Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) | Homo sapiens (Human) | 1 | 130 | 16 | 26 | 11 | LLPSFSTFASG | 77.74 |
| DP01174 | O43474 | Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) | Homo sapiens (Human) | 1 | 130 | 65 | 77 | 13 | LAAATVATDLESG | 80.7 |
| DP01174 | O43474 | Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) | Homo sapiens (Human) | 1 | 130 | 95 | 115 | 21 | ETEEFNDLLDLDFILSNSLTH | 82.39 |
| DP01174 | O43474 | Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) | Homo sapiens (Human) | 1 | 130 | 119 | 125 | 7 | SVAATVS | 76.68 |
| DP01175 | P28235 | Gap junction alpha-4 protein (Connexin-37) (Cx37) | Mus musculus (Mouse) | 233 | 333 | 260 | 269 | 10 | PEQVFFYLPM | 81.64 |
| DP01175 | P28235 | Gap junction alpha-4 protein (Connexin-37) (Cx37) | Mus musculus (Mouse) | 233 | 333 | 287 | 301 | 15 | TEQNWANLTTEERLT | 76.9 |
| DP01176 | P08033 | Gap junction beta-1 protein (Connexin-32) (Cx32) (GAP junction 28 kDa liver protein) | Rattus norvegicus (Rat) | 217 | 283 | 244 | 255 | 12 | KQNEINKLLSEQ | 94.31 |
| DP01177 | P0AE98 | Curli production assembly/transport component CsgF | Escherichia coli (strain K12) | 19 | 49 | 20 | 32 | 13 | GTMTFQFRNPNFG | 80.09 |
| DP01177 | P0AE98 | Curli production assembly/transport component CsgF | Escherichia coli (strain K12) | 19 | 49 | 36 | 44 | 9 | NNGAFLLNS | 82.98 |
| DP01178 | Q14978 | Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) | Homo sapiens (Human) | 1 | 699 | 17 | 35 | 19 | LVLGFLRDNQLSEVANKFA | 81.76 |
| DP01178 | Q14978 | Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) | Homo sapiens (Human) | 1 | 699 | 46 | 61 | 16 | NASSLLDIYSFWLKSA | 81.21 |
| DP01178 | Q14978 | Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) | Homo sapiens (Human) | 1 | 699 | 440 | 446 | 7 | KMVATTK | 79.93 |
| DP01178 | Q14978 | Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) | Homo sapiens (Human) | 1 | 699 | 452 | 459 | 8 | KAALSLPA | 77.26 |
| DP01178 | Q14978 | Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) | Homo sapiens (Human) | 1 | 699 | 548 | 556 | 9 | GTSALTAQN | 75.77 |
| DP01178 | Q14978 | Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) | Homo sapiens (Human) | 1 | 699 | 574 | 581 | 8 | AVVVSKSG | 77.26 |
| DP01178 | Q14978 | Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) | Homo sapiens (Human) | 1 | 699 | 629 | 635 | 7 | REEEIEV | 76.49 |
| DP01178 | Q14978 | Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) | Homo sapiens (Human) | 1 | 699 | 659 | 666 | 8 | NQVLKFTK | 86.29 |
| DP01178 | Q14978 | Nucleolar and coiled-body phosphoprotein 1 (140 kDa nucleolar phosphoprotein) (Nopp140) (Hepatitis C virus NS5A-transactivated protein 13) (HCV NS5A-transactivated protein 13) (Nucleolar 130 kDa protein) (Nucleolar phosphoprotein p130) | Homo sapiens (Human) | 1 | 699 | 684 | 694 | 11 | GGSISVQVNSI | 80.85 |
| DP01180 | Q8RY59 | Inactive poly ADP-ribose polymerase RCD1 (Protein RADICAL-INDUCED CELL DEATH 1) | Arabidopsis thaliana (Mouse-ear cress) | 468 | 509 | 491 | 501 | 11 | GSANSVGSSTT | 75.59 |
| DP01181 | P56621 | Nickel and cobalt resistance protein CnrY | Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) | 2 | 38 | 2 | 10 | 9 | ADVEEWLTH | 78.26 |
| DP01181 | P56621 | Nickel and cobalt resistance protein CnrY | Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) | 2 | 38 | 15 | 33 | 19 | TQEASIGVDVTSIQECISA | 79.18 |
| DP01181 | P56621 | Nickel and cobalt resistance protein CnrY | Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) | 2 | 30 | 2 | 10 | 9 | ADVEEWLTH | 78.26 |
| DP01181 | P56621 | Nickel and cobalt resistance protein CnrY | Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) | 2 | 30 | 15 | 25 | 11 | TQEASIGVDVT | 78.47 |
| DP01182 | P22216 | Serine/threonine-protein kinase RAD53 (EC 2.7.12.1) (CHEK2 homolog) (Serine-protein kinase 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 165 | 190 | 166 | 174 | 9 | NLKNTSKIA | 82.61 |
| DP01183 | Q9R224 | Protein BEX1 (Brain-expressed X-linked protein 1 homolog) (Reduced expression protein 3) (REX-3) | Mus musculus (Mouse) | 1 | 55 | 7 | 15 | 9 | GVKNLNMEN | 75.03 |
| DP01183 | Q9R224 | Protein BEX1 (Brain-expressed X-linked protein 1 homolog) (Reduced expression protein 3) (REX-3) | Mus musculus (Mouse) | 1 | 55 | 35 | 42 | 8 | PAVALTSE | 76.09 |
| DP01184 | O96013 | Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) | Homo sapiens (Human) | 9 | 68 | 13 | 24 | 12 | APSNFEHRVHTG | 82.61 |
| DP01184 | O96013 | Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) | Homo sapiens (Human) | 9 | 68 | 28 | 34 | 7 | HEQKFTG | 86.29 |
| DP01184 | O96013 | Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) | Homo sapiens (Human) | 9 | 68 | 37 | 46 | 10 | RQWQSLIEES | 82.41 |
| DP01184 | O96013 | Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) | Homo sapiens (Human) | 9 | 68 | 57 | 63 | 7 | ACITSIQ | 74.2 |
| DP01186 | P03086 | Agnoprotein (Agno) | JC polyomavirus (JCPyV) (JCV) | 41 | 71 | 58 | 66 | 9 | TEQTYSALP | 77.15 |
| DP01189 | P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 359 | 11 | 31 | 21 | VDRILSNPLQFNAAMISNKSN | 78.4 |
| DP01189 | P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 359 | 40 | 76 | 37 | ENSSYIVIGKQHNNNSNSTAIAATAESKQIKENNLID | 81.19 |
| DP01189 | P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 359 | 90 | 100 | 11 | MAEALLLYTSK | 86.14 |
| DP01189 | P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 359 | 114 | 124 | 11 | SAELSTELSTE | 76.25 |
| DP01189 | P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 359 | 141 | 153 | 13 | EEGEIFHEARDYV | 80.01 |
| DP01189 | P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 359 | 220 | 232 | 13 | LSTSISSDDEIED | 74.76 |
| DP01189 | P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 359 | 267 | 286 | 20 | KKSLYQDLMENSTVEVNRYE | 79.68 |
| DP01189 | P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 359 | 320 | 339 | 20 | PPVTISNLSNFYQFNENIND | 87.59 |
| DP01189 | P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 359 | 341 | 354 | 14 | GSLNSTRIVKNWGD | 75.35 |
| DP01191 | O14140 | 26S proteasome complex subunit rpn15 (mRNA export factor dss1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 54 | 8 | 28 | 21 | SLENLEDDDEFEDFATENWPM | 77.77 |
| DP01191 | O14140 | 26S proteasome complex subunit rpn15 (mRNA export factor dss1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 54 | 37 | 49 | 13 | DDTLWENNWDDED | 84.1 |
| DP01192 | P55036 | 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) | Homo sapiens (Human) | 305 | 377 | 330 | 343 | 14 | QDPEFLQSVLENLP | 76.11 |
| DP01192 | P55036 | 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) | Homo sapiens (Human) | 305 | 377 | 348 | 363 | 16 | NNEAIRNAMGSLASQA | 74.94 |
| DP01192 | P55036 | 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) | Homo sapiens (Human) | 328 | 361 | 330 | 343 | 14 | QDPEFLQSVLENLP | 76.11 |
| DP01192 | P55036 | 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) | Homo sapiens (Human) | 328 | 361 | 348 | 356 | 9 | NNEAIRNAM | 75.21 |
| DP01195 | P39007 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 (Oligosaccharyl transferase subunit STT3) (EC 2.4.99.18) (Staurosporine and temperature sensitivity protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 299 | 351 | 299 | 346 | 48 | MVSLFLILVLGVVGLSALTYMGLIAPWTGRFYSLWDTNYAKIHIPIIA | 85.37 |
| DP01196 | P48439 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 23 | 215 | 43 | 52 | 10 | KDSSFENILA | 82.54 |
| DP01196 | P48439 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 23 | 215 | 55 | 92 | 38 | HENAYIVALFTATAPEIGCSLCLELESEYDTIVASWFD | 83.23 |
| DP01196 | P48439 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 23 | 215 | 102 | 115 | 14 | SDTSIFFTKVNLED | 78.95 |
| DP01196 | P48439 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 23 | 215 | 122 | 155 | 34 | KAFQFFQLNNVPRLFIFKPNSPSILDHSVISIST | 86.68 |
| DP01196 | P48439 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 23 | 215 | 162 | 182 | 21 | MKQIIQAIKQFSQVNDFSLHL | 78.72 |
| DP01196 | P48439 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 (Oligosaccharyl transferase 34 kDa subunit) (Oligosaccharyl transferase subunit OST3) (Oligosaccharyl transferase subunit gamma) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 23 | 215 | 186 | 210 | 25 | WTPIITSTIITFITVLLFKKQSKLM | 85.54 |
| DP01199 | B9KDD4 | Undecaprenyl-diphosphooligosaccharide--protein glycotransferase (EC 2.4.99.19) (Protein glycosylation B) | Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) | 281 | 327 | 284 | 322 | 39 | DPVLYQLKFYVFKASDVQNLKDAAFMYFNVNETIMEVNT | 84.57 |
| DP01200 | O29867 | Dolichyl-phosphooligosaccharide-protein glycotransferase 3 (EC 2.4.99.21) (Archaeal glycosylation protein B) (AglB-L) (AglB-Long) (Oligosaccharyl transferase) (OST) (OTase) | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) | 336 | 373 | 339 | 348 | 10 | ARNLLSVVRV | 75.25 |
| DP01200 | O29867 | Dolichyl-phosphooligosaccharide-protein glycotransferase 3 (EC 2.4.99.21) (Archaeal glycosylation protein B) (AglB-L) (AglB-Long) (Oligosaccharyl transferase) (OST) (OTase) | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) | 336 | 373 | 353 | 368 | 16 | GGALTIAEVYPFFFTH | 82.09 |
| DP01201 | Q47184 | EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) | Escherichia coli | 1 | 30 | 7 | 23 | 17 | ASVASANASTSTSMAYD | 78.24 |
| DP01201 | Q47184 | EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) | Escherichia coli | 60 | 147 | 60 | 70 | 11 | SIAKFADMNEA | 81.09 |
| DP01201 | Q47184 | EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) | Escherichia coli | 60 | 147 | 72 | 96 | 25 | KESTTAQKMANLVDAKIADVQSSSD | 78.27 |
| DP01201 | Q47184 | EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) | Escherichia coli | 60 | 147 | 104 | 112 | 9 | PDEVISYIN | 93.5 |
| DP01201 | Q47184 | EspA (Secreted protein A) (Secretion protein EspA) (Translocon EspA) | Escherichia coli | 60 | 147 | 116 | 142 | 27 | NDITISGIDNINAQLGAGDLQTVKAAI | 78.61 |
| DP01202 | O55000 | Serine/threonine-protein phosphatase 1 regulatory subunit 10 (MHC class I region proline-rich protein CAT53) (Phosphatase 1 nuclear targeting subunit) (Protein PNUTS) | Rattus norvegicus (Rat) | 309 | 433 | 406 | 417 | 12 | KLREYFYFELDE | 84.59 |
| DP01203 | O75807 | Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog) | Homo sapiens (Human) | 513 | 631 | 562 | 573 | 12 | VTVHFLAVWAGP | 80.07 |
| DP01203 | O75807 | Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog) | Homo sapiens (Human) | 513 | 631 | 598 | 605 | 8 | QAQEELSP | 79.18 |
| DP01203 | O75807 | Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog) | Homo sapiens (Human) | 513 | 631 | 612 | 621 | 10 | RARAWARLRN | 73.91 |
| DP01228 | Q9UMZ1 | Prothymosin a14 | Homo sapiens (Human) | 1 | 101 | 8 | 15 | 8 | TSSEITTE | 74.79 |
| DP01228 | Q9UMZ1 | Prothymosin a14 | Homo sapiens (Human) | 1 | 101 | 22 | 29 | 8 | EVVEEAEN | 75.92 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 195 | 208 | 14 | EENTFEIALARLIP | 80.55 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 213 | 220 | 8 | SHAAYTYN | 94.44 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 252 | 267 | 16 | AGANSQATLHINITTA | 78.6 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 295 | 303 | 9 | KQSTIGKTA | 89.97 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 309 | 326 | 18 | NEEEFDPVVTASAMDSIN | 84.17 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 332 | 342 | 11 | AQETSYQNNRT | 76.1 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 356 | 365 | 10 | TLNDYYAALA | 80.17 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 409 | 419 | 11 | LEDEFEDVTDT | 74.58 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 425 | 440 | 16 | TESNTSNDVKQESIND | 84.76 |
| DP01237 | P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 195 | 482 | 444 | 452 | 9 | DAVNATATA | 79.86 |
| DP01239 | P20591 | Interferon-induced GTP-binding protein Mx1 (Interferon-induced protein p78) (IFI-78K) (Interferon-regulated resistance GTP-binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) Cleaved into: Interferon-induced GTP-binding protein Mx1; N-terminally processed | Homo sapiens (Human) | 532 | 572 | 534 | 540 | 7 | QDQVYRG | 78.6 |
| DP01239 | P20591 | Interferon-induced GTP-binding protein Mx1 (Interferon-induced protein p78) (IFI-78K) (Interferon-regulated resistance GTP-binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) Cleaved into: Interferon-induced GTP-binding protein Mx1; N-terminally processed | Homo sapiens (Human) | 532 | 572 | 557 | 567 | 11 | KSWDFGAFQSS | 77.26 |
| DP01240 | Q9UJX2 | Cell division cycle protein 23 homolog (Anaphase-promoting complex subunit 8) (APC8) (Cyclosome subunit 8) | Homo sapiens (Human) | 1 | 25 | 10 | 20 | 11 | VAVTAAVAPVL | 75.89 |
| DP01241 | P19634 | Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1) | Homo sapiens (Human) | 680 | 815 | 680 | 686 | 7 | INNYLTV | 81.13 |
| DP01241 | P19634 | Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1) | Homo sapiens (Human) | 680 | 815 | 714 | 720 | 7 | LPVITID | 80.22 |
| DP01241 | P19634 | Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1) | Homo sapiens (Human) | 680 | 815 | 731 | 737 | 7 | DLVNEEL | 79.93 |
| DP01241 | P19634 | Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1) | Homo sapiens (Human) | 680 | 815 | 774 | 781 | 8 | TDDVFTPA | 77.26 |
| DP01241 | P19634 | Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1) | Homo sapiens (Human) | 680 | 815 | 787 | 794 | 8 | SSQRIQRC | 74.58 |
| DP01241 | P19634 | Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1) | Homo sapiens (Human) | 686 | 815 | 714 | 720 | 7 | LPVITID | 80.22 |
| DP01241 | P19634 | Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1) | Homo sapiens (Human) | 686 | 815 | 731 | 737 | 7 | DLVNEEL | 79.93 |
| DP01241 | P19634 | Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1) | Homo sapiens (Human) | 686 | 815 | 774 | 781 | 8 | TDDVFTPA | 77.26 |
| DP01241 | P19634 | Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter; amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1) | Homo sapiens (Human) | 686 | 815 | 787 | 794 | 8 | SSQRIQRC | 74.58 |
| DP01246 | O13916 | Anaphase-promoting complex subunit hcn1 (20S cyclosome/APC complex protein hcn1) (Chaperone-like protein hcn1) (High copy suppressor of cut9 protein 1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 25 | 80 | 34 | 43 | 10 | TEEALQKNEE | 74.25 |
| DP01246 | O13916 | Anaphase-promoting complex subunit hcn1 (20S cyclosome/APC complex protein hcn1) (Chaperone-like protein hcn1) (High copy suppressor of cut9 protein 1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 25 | 80 | 59 | 69 | 11 | RIGITQIFDSS | 88.23 |
| DP01248 | O95292 | Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) | Homo sapiens (Human) | 1 | 125 | 4 | 12 | 9 | VEQVLSLEP | 76.89 |
| DP01248 | O95292 | Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) | Homo sapiens (Human) | 1 | 125 | 23 | 29 | 7 | TDVVTTN | 84.57 |
| DP01248 | O95292 | Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) | Homo sapiens (Human) | 1 | 125 | 38 | 48 | 11 | RNVCFKVKTTA | 75.25 |
| DP01248 | O95292 | Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) | Homo sapiens (Human) | 1 | 125 | 57 | 79 | 23 | NSGIIDAGASINVSVMLQPFDYD | 79.86 |
| DP01248 | O95292 | Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) | Homo sapiens (Human) | 1 | 125 | 103 | 109 | 7 | EAVWKEA | 79.36 |
| DP01249 | P61073 | C-X-C chemokine receptor type 4 (CXC-R4) (CXCR-4) (FB22) (Fusin) (HM89) (LCR1) (Leukocyte-derived seven transmembrane domain receptor) (LESTR) (Lipopolysaccharide-associated protein 3) (LAP-3) (LPS-associated protein 3) (NPYRL) (Stromal cell-derived factor 1 receptor) (SDF-1 receptor) (CD antigen CD184) | Homo sapiens (Human) | 1 | 26 | 1 | 16 | 16 | MEGISIYTSDNYTEEM | 79.87 |
| DP01252 | P01137 | Transforming growth factor beta-1 proprotein Cleaved into: Latency-associated peptide (LAP); Transforming growth factor beta-1 (TGF-beta-1) | Homo sapiens (Human) | 240 | 261 | 245 | 251 | 7 | GDLATIH | 80.22 |
| DP01254 | P12956 | "X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5-deoxyribose-5-phosphate lyase Ku70) (5-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6)" | Homo sapiens (Human) | 533 | 609 | 555 | 563 | 9 | PKVEYSEEE | 76.37 |
| DP01254 | P12956 | "X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5-deoxyribose-5-phosphate lyase Ku70) (5-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6)" | Homo sapiens (Human) | 533 | 609 | 572 | 578 | 7 | TLGKFTV | 81.27 |
| DP01254 | P12956 | "X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5-deoxyribose-5-phosphate lyase Ku70) (5-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6)" | Homo sapiens (Human) | 533 | 609 | 584 | 592 | 9 | ACRAYGLKS | 82.94 |
| DP01254 | P12956 | "X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5-deoxyribose-5-phosphate lyase Ku70) (5-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6)" | Homo sapiens (Human) | 533 | 609 | 596 | 604 | 9 | KQELLEALT | 76.59 |
| DP01256 | Q32ZE1 | Genome polyprotein Cleaved into: Capsid protein C (Capsid protein) (Core protein); Protein prM (Precursor membrane protein); Peptide pr (Peptide precursor); Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | Zika virus (ZIKV) | 1417 | 1463 | 1417 | 1431 | 15 | VDMYIERAGDITWEK | 88.16 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 1 | 216 | 6 | 16 | 11 | KLKLSNTVLPS | 80.97 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 1 | 216 | 20 | 58 | 39 | KVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFM | 79.93 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 1 | 216 | 69 | 99 | 31 | SDIDYALKLKNVEPLYGFHAQEFIPFRFASG | 79.11 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 1 | 216 | 101 | 120 | 20 | GRELYFYEEKEVDLSDIINT | 84.23 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 1 | 216 | 132 | 140 | 9 | KAHWLSIEG | 79.67 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 1 | 216 | 182 | 188 | 7 | GQGATTA | 77.26 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 437 | 677 | 444 | 455 | 12 | NQDAYRAEFGSL | 76.92 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 437 | 677 | 468 | 486 | 19 | AQAALQAQQVNRTTLTITQ | 77.87 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 437 | 677 | 535 | 545 | 11 | PTKFIVMSSSS | 78.47 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 437 | 677 | 550 | 560 | 11 | TQQVLSLSTSA | 79.81 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 437 | 677 | 577 | 591 | 15 | SVQPIVKLVSTATTA | 79 |
| DP01262 | P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | Homo sapiens (Human) | 437 | 677 | 602 | 611 | 10 | SVQKYIVVSL | 87.79 |
| DP01268 | Q9H816 | "5 exonuclease Apollo (EC 3.1.-.-) (DNA cross-link repair 1B protein) (SNM1 homolog B) (SNMIB) (hSNM1B)" | Homo sapiens (Human) | 314 | 335 | 322 | 330 | 9 | SVQQYMSSS | 76.29 |
| DP01269 | Q8NG31 | Kinetochore scaffold 1 (ALL1-fused gene from chromosome 15q14 protein) (AF15q14) (Bub-linking kinetochore protein) (Blinkin) (Cancer susceptibility candidate gene 5 protein) (Cancer/testis antigen 29) (CT29) (Kinetochore-null protein 1) (Protein CASC5) (Protein D40/AF15q14) | Homo sapiens (Human) | 150 | 175 | 150 | 159 | 10 | KEFSIIEHTR | 94.92 |
| DP01280 | P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31 | Homo sapiens (Human) | 672 | 711 | 677 | 706 | 30 | HDSGYEVHHQKLVFFAEDVGSNKGAIIGLM | 80.52 |
| DP01281 | Q9JM54 | Phorbol-12-myristate-13-acetate-induced protein 1 (Protein Noxa) | Mus musculus (Mouse) | 16 | 42 | 26 | 37 | 12 | QLRKIGDKVYCT | 78.6 |
| DP01284 | P24928 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit) (RNA-directed RNA polymerase II subunit RPB1) (EC 2.7.7.48) | Homo sapiens (Human) | 1773 | 1970 | 1953 | 1962 | 10 | TYSLTSPAIS | 84.62 |
| DP01285 | Q97W59 | Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) | Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) | 18 | 139 | 27 | 52 | 26 | TQSLPNMIILNIGNTTIIRNFAEYCD | 83.25 |
| DP01285 | Q97W59 | Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) | Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) | 18 | 139 | 60 | 70 | 11 | ICMKYLLKELA | 76.22 |
| DP01285 | Q97W59 | Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) | Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) | 18 | 139 | 79 | 109 | 31 | GELVIQGKFSSQVINTLMERFLKAYVECSTC | 80.91 |
| DP01285 | Q97W59 | Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) | Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) | 18 | 139 | 111 | 117 | 7 | SLDTILK | 80.27 |
| DP01285 | Q97W59 | Translation initiation factor 2 subunit beta (aIF2-beta) (eIF-2-beta) | Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) | 18 | 139 | 120 | 130 | 11 | KKSWYIVCLAC | 85.77 |
| DP01287 | Q9VZU1 | ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) | Drosophila melanogaster (Fruit fly) | 241 | 388 | 241 | 251 | 11 | MDVSYALEMSS | 84.13 |
| DP01287 | Q9VZU1 | ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) | Drosophila melanogaster (Fruit fly) | 241 | 388 | 263 | 275 | 13 | DDLNEIRNEVLAP | 79.88 |
| DP01287 | Q9VZU1 | ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) | Drosophila melanogaster (Fruit fly) | 241 | 388 | 307 | 332 | 26 | VGSHFHAYSETEPMFDLQTSAHMYTQ | 77.84 |
| DP01287 | Q9VZU1 | ASCIZ zinc finger protein; isoform A (ASCIZ zinc finger protein; isoform B) (AT25633p) | Drosophila melanogaster (Fruit fly) | 241 | 388 | 334 | 383 | 50 | CDDLFEELGLSHIQTQTHWPDGLYNTQHTQTCDEIMDELFPDNFQSTCTQ | 82.58 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 365 | 381 | 17 | SLPLFKIANPIAGEPIS | 79.3 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 396 | 433 | 38 | LQELGNTCQKNSISSINVQTDLSYASQNFIPSAQWATA | 85.94 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 455 | 465 | 11 | ISVHTQTFLPS | 84.46 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 468 | 487 | 20 | VTSSIAAQTDAFMDTCFQSG | 79.4 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 513 | 548 | 36 | MCGDIFESVHSSYNVATGNIISNSLVAETVTHSLLP | 80.22 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 562 | 575 | 14 | SAPIINFSAQNSML | 81.46 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 584 | 608 | 25 | QTQTIDLLSDLENILSSNLPAQTLD | 81.2 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 634 | 660 | 27 | IDFDIEEFFSASNIQTQTEESELSTMT | 78.83 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 668 | 688 | 21 | LDIETQTDFLLADTSAQSYGC | 81.68 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 690 | 701 | 12 | GNSNFLGLEMFD | 86.18 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 706 | 715 | 10 | TDLNFFLDSS | 83.41 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 719 | 734 | 16 | PLGSILKHSSFSVSTD | 75.23 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 758 | 765 | 8 | VQLNSTET | 83.95 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 770 | 786 | 17 | SGFETLGSLFFTSNETQ | 87.59 |
| DP01288 | O43313 | ATM interactor (ATM/ATR-substrate CHK2-interacting zinc finger protein) (ASCIZ) (Zinc finger protein 822) | Homo sapiens (Human) | 362 | 823 | 790 | 815 | 26 | DDFLLADLAWNTMESQFSSVETQTSA | 84.74 |
| DP01289 | Q9KMA5 | Antitoxin HigA-2 | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 1 | 36 | 3 | 18 | 16 | NRDLFAELSSALVEAK | 76.21 |
| DP01289 | Q9KMA5 | Antitoxin HigA-2 | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 3 | 36 | 3 | 18 | 16 | NRDLFAELSSALVEAK | 76.21 |
| DP01289 | Q9KMA5 | Antitoxin HigA-2 | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) | 3 | 33 | 3 | 18 | 16 | NRDLFAELSSALVEAK | 76.21 |
| DP01291 | P0AE72 | Antitoxin MazE | Escherichia coli (strain K12) | 48 | 82 | 50 | 63 | 14 | EPVFTLAELVNDIT | 76.3 |
| DP01291 | P0AE72 | Antitoxin MazE | Escherichia coli (strain K12) | 48 | 76 | 50 | 63 | 14 | EPVFTLAELVNDIT | 76.3 |
| DP01291 | P0AE72 | Antitoxin MazE | Escherichia coli (strain K12) | 50 | 82 | 50 | 63 | 14 | EPVFTLAELVNDIT | 76.3 |
| DP01291 | P0AE72 | Antitoxin MazE | Escherichia coli (strain K12) | 51 | 82 | 51 | 63 | 13 | PVFTLAELVNDIT | 76.49 |
| DP01292 | P49768 | Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) | Homo sapiens (Human) | 1 | 77 | 6 | 29 | 24 | APLSYFQNAQMSEDNHLSNTVRSQ | 80.35 |
| DP01292 | P49768 | Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) | Homo sapiens (Human) | 1 | 77 | 60 | 72 | 13 | RQVVEQDEEEDEE | 76.07 |
| DP01292 | P49768 | Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) | Homo sapiens (Human) | 262 | 378 | 270 | 299 | 30 | MLVETAQERNETLFPALIYSSTMVWLVNMA | 82.92 |
| DP01292 | P49768 | Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) | Homo sapiens (Human) | 262 | 378 | 311 | 322 | 12 | KNSKYNAESTER | 78.18 |
| DP01292 | P49768 | Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) | Homo sapiens (Human) | 262 | 378 | 326 | 342 | 17 | DTVAENDDGGFSEEWEA | 78.02 |
| DP01292 | P49768 | Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12) | Homo sapiens (Human) | 262 | 378 | 359 | 370 | 12 | AAVQELSSSILA | 78.26 |
| DP01293 | Q13542 | Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) | Homo sapiens (Human) | 1 | 120 | 20 | 26 | 7 | RTVAISD | 80.98 |
| DP01293 | Q13542 | Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) | Homo sapiens (Human) | 1 | 120 | 39 | 47 | 9 | GGTLFSTTP | 77.15 |
| DP01293 | Q13542 | Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) | Homo sapiens (Human) | 1 | 120 | 49 | 61 | 13 | GTRIIYDRKFLLD | 82.89 |
| DP01293 | Q13542 | Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) | Homo sapiens (Human) | 1 | 120 | 93 | 105 | 13 | VEVNNLNNLNNHD | 78.72 |
| DP01293 | Q13542 | Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) | Homo sapiens (Human) | 18 | 62 | 20 | 26 | 7 | RTVAISD | 80.98 |
| DP01293 | Q13542 | Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) | Homo sapiens (Human) | 18 | 62 | 39 | 47 | 9 | GGTLFSTTP | 77.15 |
| DP01293 | Q13542 | Eukaryotic translation initiation factor 4E-binding protein 2 (4E-BP2) (eIF4E-binding protein 2) | Homo sapiens (Human) | 18 | 62 | 49 | 57 | 9 | GTRIIYDRK | 84.21 |
| DP01294 | P41695 | Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 29 | 230 | 34 | 54 | 21 | SQLNQTKIAYEQRLLNDLEDM | 77.8 |
| DP01294 | P41695 | Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 29 | 230 | 57 | 137 | 81 | PLDLFLDYMIWISTSYIEVDSESGQEVLRSTMERCLIYIQDMETYRNDPRFLKIWIWYINLFLSNNFHESENTFKYMFNKG | 81.63 |
| DP01294 | P41695 | Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 29 | 230 | 141 | 178 | 38 | KLSLFYEEFSKLLENAQFFLEAKVLLELGAENNCRPYN | 80.77 |
| DP01294 | P41695 | Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 29 | 230 | 181 | 189 | 9 | LRSLSNYED | 76.14 |
| DP01294 | P41695 | Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 29 | 230 | 192 | 203 | 12 | REMNIVENQNSV | 78.29 |
| DP01294 | P41695 | Checkpoint serine/threonine-protein kinase BUB1 (EC 2.7.11.1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 29 | 230 | 211 | 225 | 15 | KGRLIYRTAPFFIRK | 83.57 |
| DP01295 | Q98XH7 | Protein Tat (Fragment) | Human immunodeficiency virus 1 | 1 | 72 | 21 | 27 | 7 | ACNNCYC | 75.25 |
| DP01295 | Q98XH7 | Protein Tat (Fragment) | Human immunodeficiency virus 1 | 1 | 72 | 34 | 49 | 16 | CQVCFMTKGLGIYYGR | 89.17 |
| DP01296 | Q6BBK3 | CP12 | Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2) | 1 | 52 | 14 | 22 | 9 | EAHAISEEK | 75.51 |
| DP01296 | Q6BBK3 | CP12 | Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2) | 1 | 52 | 29 | 46 | 18 | AAAAWDAVEELQAEAAHQ | 75.99 |
| DP01299 | Q96273 | Late embryogenesis abundant protein 18 (Late embryogenesis abundant protein 4-2) (AtLEA4-2) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 97 | 4 | 14 | 11 | AKEKISDMAST | 79.93 |
| DP01299 | Q96273 | Late embryogenesis abundant protein 18 (Late embryogenesis abundant protein 4-2) (AtLEA4-2) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 97 | 17 | 23 | 7 | EKLNIGG | 79.93 |
| DP01300 | Q9SLJ2 | Dehydrin HIRD11 (Histidine-rich dehydrin of 11 kDa) (AtHIRD11) (Protein SRC1 homolog) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 98 | 1 | 15 | 15 | MAGLINKIGDALHIG | 88.36 |
| DP01303 | O14519 | Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Deleted in oral cancer 1) (DOC-1) (Putative oral cancer suppressor) | Homo sapiens (Human) | 1 | 60 | 13 | 25 | 13 | AAALNAAGSVHSP | 75.82 |
| DP01303 | O14519 | Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Deleted in oral cancer 1) (DOC-1) (Putative oral cancer suppressor) | Homo sapiens (Human) | 1 | 60 | 35 | 43 | 9 | YRQLLSDYG | 78.08 |
| DP01303 | O14519 | Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Deleted in oral cancer 1) (DOC-1) (Putative oral cancer suppressor) | Homo sapiens (Human) | 1 | 60 | 46 | 55 | 10 | SLGYTQGTGN | 78.26 |
| DP01304 | Q99LJ8 | Dehydrodolichyl diphosphate synthase complex subunit Nus1 (EC 2.5.1.87) (Nogo-B receptor) (NgBR) (Nuclear undecaprenyl pyrophosphate synthase 1 homolog) | Mus musculus (Mouse) | 47 | 120 | 93 | 102 | 10 | ADVRSLQKLP | 75.25 |
| DP01304 | Q99LJ8 | Dehydrodolichyl diphosphate synthase complex subunit Nus1 (EC 2.5.1.87) (Nogo-B receptor) (NgBR) (Nuclear undecaprenyl pyrophosphate synthase 1 homolog) | Mus musculus (Mouse) | 47 | 120 | 104 | 113 | 10 | HMGLLVTEEV | 79.03 |
| DP01306 | Q03518 | Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) | Homo sapiens (Human) | 61 | 172 | 78 | 111 | 34 | ASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTA | 81.19 |
| DP01306 | Q03518 | Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) | Homo sapiens (Human) | 61 | 172 | 114 | 132 | 19 | LLRVWAVGLSRWAVLWLGA | 79.25 |
| DP01306 | Q03518 | Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) | Homo sapiens (Human) | 61 | 172 | 148 | 157 | 10 | GAQGWLAALK | 76.52 |
| DP01306 | Q03518 | Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) | Homo sapiens (Human) | 61 | 172 | 159 | 167 | 9 | LAAALGLAL | 74.25 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 1 | 265 | 24 | 34 | 11 | PEEEIIAEDYD | 81.73 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 1 | 265 | 49 | 57 | 9 | PPSWYKVFD | 78.26 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 1 | 265 | 61 | 69 | 9 | GLPYYWNAD | 82.09 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 1 | 265 | 71 | 77 | 7 | DLVSWLS | 78.93 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 1 | 265 | 249 | 260 | 12 | GAVLRANAEASR | 80.27 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 1 | 35 | 24 | 30 | 7 | PEEEIIA | 85.05 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 82 | 265 | 249 | 260 | 12 | GAVLRANAEASR | 80.27 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 95 | 265 | 249 | 260 | 12 | GAVLRANAEASR | 80.27 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 220 | 265 | 249 | 260 | 12 | GAVLRANAEASR | 80.27 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 223 | 265 | 249 | 260 | 12 | GAVLRANAEASR | 80.27 |
| DP01308 | O60828 | Polyglutamine-binding protein 1 (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1) | Homo sapiens (Human) | 238 | 260 | 249 | 255 | 7 | GAVLRAN | 80.27 |
| DP01310 | Q8WUP2 | Filamin-binding LIM protein 1 (FBLP-1) (Migfilin) (Mitogen-inducible 2-interacting protein) (MIG2-interacting protein) | Homo sapiens (Human) | 1 | 85 | 10 | 18 | 9 | ASSVFITLA | 85.88 |
| DP01310 | Q8WUP2 | Filamin-binding LIM protein 1 (FBLP-1) (Migfilin) (Mitogen-inducible 2-interacting protein) (MIG2-interacting protein) | Homo sapiens (Human) | 1 | 85 | 24 | 30 | 7 | VAVAEEV | 75.92 |
| DP01311 | Q6NUK1 | Calcium-binding mitochondrial carrier protein SCaMC-1 (Mitochondrial ATP-Mg/Pi carrier protein 1) (Mitochondrial Ca(2+)-dependent solute carrier protein 1) (Small calcium-binding mitochondrial carrier protein 1) (Solute carrier family 25 member 24) | Homo sapiens (Human) | 50 | 78 | 59 | 72 | 14 | AEEKIFTTGDVNKD | 79 |
| DP01312 | Q9UMX1 | Suppressor of fused homolog (SUFUH) | Homo sapiens (Human) | 279 | 360 | 314 | 321 | 8 | RGLEINSK | 75.92 |
| DP01312 | Q9UMX1 | Suppressor of fused homolog (SUFUH) | Homo sapiens (Human) | 279 | 360 | 344 | 355 | 12 | KDSLESDSSTAI | 78.43 |
| DP01313 | Q9N4U5 | Smu-2 suppressor of mec-8 and unc-52 protein (RED homolog) (Suppressor of Mec and Unc defects 2) | Caenorhabditis elegans | 163 | 223 | 194 | 208 | 15 | EASLLAQELAQSHSE | 77.08 |
| DP01315 | Q9QWH1 | Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36) | Mus musculus (Mouse) | 1 | 79 | 14 | 33 | 20 | ASVTTNTSGTNSSSGCISSS | 81.3 |
| DP01315 | Q9QWH1 | Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36) | Mus musculus (Mouse) | 1 | 79 | 45 | 55 | 11 | APQISVYSGIP | 77.47 |
| DP01315 | Q9QWH1 | Polyhomeotic-like protein 2 (mPH2) (Early development regulatory protein 2) (p36) | Mus musculus (Mouse) | 1 | 79 | 59 | 69 | 11 | TVQVIQQALHR | 78.5 |
| DP01316 | P25916 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) | Mus musculus (Mouse) | 106 | 240 | 121 | 140 | 20 | EKRIITDDEIISLSIEFFDQ | 83.43 |
| DP01316 | P25916 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) | Mus musculus (Mouse) | 106 | 240 | 183 | 196 | 14 | IPNTFQIDVMYEEE | 86.86 |
| DP01316 | P25916 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) | Mus musculus (Mouse) | 106 | 240 | 198 | 214 | 17 | LKDYYTLMDIAYIYTWR | 83.75 |
| DP01317 | O60741 | Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 (Brain cyclic nucleotide-gated channel 1) (BCNG-1) | Homo sapiens (Human) | 1 | 93 | 15 | 23 | 9 | DDGNSVFPA | 76.81 |
| DP01317 | O60741 | Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 (Brain cyclic nucleotide-gated channel 1) (BCNG-1) | Homo sapiens (Human) | 1 | 93 | 55 | 61 | 7 | NSVCFKV | 79.93 |
| DP01319 | Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | Homo sapiens (Human) | 1 | 262 | 43 | 52 | 10 | KAVKSLVKKL | 77.26 |
| DP01319 | Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | Homo sapiens (Human) | 1 | 262 | 61 | 78 | 18 | LEKAITTQNCNTKCVTIP | 79.47 |
| DP01319 | Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | Homo sapiens (Human) | 1 | 262 | 80 | 108 | 29 | TCSEIWGLSTPNTIDQWDTTGLYSFSEQT | 81.21 |
| DP01319 | Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | Homo sapiens (Human) | 1 | 262 | 124 | 135 | 12 | PHVIYCRLWRWP | 78.71 |
| DP01319 | Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | Homo sapiens (Human) | 1 | 262 | 142 | 157 | 16 | ELKAIENCEYAFNLKK | 80.81 |
| DP01319 | Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | Homo sapiens (Human) | 1 | 262 | 160 | 168 | 9 | VCVNPYHYQ | 78.15 |
| DP01319 | Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | Homo sapiens (Human) | 1 | 262 | 183 | 190 | 8 | HTEILTEL | 76.09 |
| DP01319 | Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | Homo sapiens (Human) | 1 | 262 | 235 | 241 | 7 | QQLNQSM | 75.92 |
| DP01320 | P36152 | Fe-S cluster assembly protein DRE2 (Anamorsin homolog) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 234 | 348 | 243 | 252 | 10 | GKSMITMITC | 78.96 |
| DP01320 | P36152 | Fe-S cluster assembly protein DRE2 (Anamorsin homolog) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 234 | 348 | 271 | 282 | 12 | KEQEENEINDIR | 83.89 |
| DP01320 | P36152 | Fe-S cluster assembly protein DRE2 (Anamorsin homolog) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 234 | 348 | 287 | 304 | 18 | KVVKFTEDELTEIDFTID | 87.89 |
| DP01322 | Q01924 | Fibronectin-binding protein | Streptococcus pyogenes | 396 | 591 | 400 | 408 | 9 | NQQNPVDID | 75.25 |
| DP01322 | Q01924 | Fibronectin-binding protein | Streptococcus pyogenes | 396 | 591 | 420 | 426 | 7 | NMVETED | 77.26 |
| DP01322 | Q01924 | Fibronectin-binding protein | Streptococcus pyogenes | 396 | 591 | 436 | 446 | 11 | GQSESVEFTKD | 84.07 |
| DP01322 | Q01924 | Fibronectin-binding protein | Streptococcus pyogenes | 396 | 591 | 473 | 483 | 11 | GQSESVEFTKD | 84.07 |
| DP01322 | Q01924 | Fibronectin-binding protein | Streptococcus pyogenes | 396 | 591 | 494 | 500 | 7 | SQVETED | 80.27 |
| DP01322 | Q01924 | Fibronectin-binding protein | Streptococcus pyogenes | 396 | 591 | 510 | 520 | 11 | GQSESVEFTKD | 84.07 |
| DP01322 | Q01924 | Fibronectin-binding protein | Streptococcus pyogenes | 396 | 591 | 547 | 557 | 11 | GQSESVEFTKD | 84.07 |
| DP01322 | Q01924 | Fibronectin-binding protein | Streptococcus pyogenes | 396 | 591 | 561 | 575 | 15 | GMSGFSETVTIVEDT | 87.36 |
| DP01322 | Q01924 | Fibronectin-binding protein | Streptococcus pyogenes | 396 | 591 | 578 | 586 | 9 | KLVFHFDNN | 91.56 |
| DP01323 | Q8R316 | HMG box-containing protein 1 (HMG box transcription factor 1) (High mobility group box transcription factor 1) | Mus musculus (Mouse) | 358 | 380 | 364 | 374 | 11 | SSAVYVLSSMA | 77.5 |
| DP01327 | Q8IV16 | Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPI-HBP1) (GPI-anchored HDL-binding protein 1) (High density lipoprotein-binding protein 1) | Homo sapiens (Human) | 21 | 54 | 22 | 28 | 7 | TQQEEEE | 74.25 |
| DP01329 | P28324 | ETS domain-containing protein Elk-4 (Serum response factor accessory protein 1) (SAP-1) (SRF accessory protein 1) | Homo sapiens (Human) | 94 | 136 | 97 | 116 | 20 | TVGRIEGDCESLNFSEVSSS | 75.22 |
| DP01330 | P32639 | Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 112 | 12 | 38 | 27 | KIREIYRYDEMSNKVLKVDKRFMNTSQ | 79.49 |
| DP01330 | P32639 | Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 112 | 42 | 48 | 7 | RDAEISQ | 77.21 |
| DP01330 | P32639 | Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 112 | 62 | 70 | 9 | GQGLCNNIN | 90.64 |
| DP01330 | P32639 | Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 112 | 88 | 103 | 16 | SLKKIQQHNTILNSSS | 79.68 |
| DP01330 | P32639 | Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 193 | 257 | 205 | 213 | 9 | QAVAILADD | 87.81 |
| DP01330 | P32639 | Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 193 | 257 | 219 | 238 | 20 | EEVTEMSNNANVLGGEINDN | 79.8 |
| DP01330 | P32639 | Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 193 | 257 | 241 | 252 | 12 | DDEEYDYNDVEV | 78.73 |
| DP01332 | P17931 | Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen) | Homo sapiens (Human) | 1 | 115 | 1 | 13 | 13 | MADNFSLHDALSG | 77.51 |
| DP01332 | P17931 | Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen) | Homo sapiens (Human) | 1 | 112 | 1 | 13 | 13 | MADNFSLHDALSG | 77.51 |
| DP01332 | P17931 | Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen) | Homo sapiens (Human) | 1 | 40 | 1 | 13 | 13 | MADNFSLHDALSG | 77.51 |
| DP01334 | B7T1D9 | Teg14 | uncultured soil bacterium | 215 | 240 | 215 | 224 | 10 | QQGQWASMTG | 87.69 |
| DP01336 | P03709 | DNA-packaging protein FI | Escherichia phage lambda (Bacteriophage lambda) | 42 | 80 | 57 | 70 | 14 | ENVLTGHENEVGSA | 76.33 |
| DP01339 | P0A903 | Outer membrane protein assembly factor BamC | Escherichia coli (strain K12) | 26 | 98 | 37 | 52 | 16 | GDEAYLEAAPLAELHA | 77.13 |
| DP01339 | P0A903 | Outer membrane protein assembly factor BamC | Escherichia coli (strain K12) | 26 | 98 | 63 | 71 | 9 | GDYAIPVTN | 87.63 |
| DP01344 | Q13469 | Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1) | Homo sapiens (Human) | 131 | 294 | 132 | 140 | 9 | DAGLLVEQP | 75.18 |
| DP01344 | Q13469 | Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1) | Homo sapiens (Human) | 131 | 294 | 174 | 187 | 14 | SSASFISDTFSPYT | 80.03 |
| DP01344 | Q13469 | Nuclear factor of activated T-cells; cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1) | Homo sapiens (Human) | 131 | 294 | 204 | 213 | 10 | QFQNIPAHYS | 84.08 |
| DP01347 | Q9UNL4 | Inhibitor of growth protein 4 (p29ING4) | Homo sapiens (Human) | 119 | 188 | 163 | 172 | 10 | KLVRTSPEYG | 73.58 |
| DP01347 | Q9UNL4 | Inhibitor of growth protein 4 (p29ING4) | Homo sapiens (Human) | 119 | 188 | 174 | 181 | 8 | PSVTFGSV | 79.6 |
| DP01356 | Q49492 | "Mycinamicin III 3-O-methyltransferase (EC 2.1.1.237) (Mycinamicin biosynthesis protein F)" | Micromonospora griseorubida | 116 | 144 | 133 | 139 | 7 | NLHQYNE | 82.27 |
| DP01361 | P15927 | Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) | Homo sapiens (Human) | 1 | 42 | 4 | 22 | 19 | SGFESYGSSSYGGAGGYTQ | 80.94 |
| DP01361 | P15927 | Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) | Homo sapiens (Human) | 175 | 270 | 190 | 200 | 11 | EAGNFGGNSFM | 83.55 |
| DP01361 | P15927 | Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) | Homo sapiens (Human) | 175 | 270 | 202 | 218 | 17 | ANGLTVAQNQVLNLIKA | 84.04 |
| DP01361 | P15927 | Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) | Homo sapiens (Human) | 175 | 270 | 223 | 229 | 7 | EGLNFQD | 86.96 |
| DP01361 | P15927 | Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) | Homo sapiens (Human) | 175 | 270 | 238 | 259 | 22 | SVSSIKQAVDFLSNEGHIYSTV | 81.07 |
| DP01364 | P62826 | GTP-binding nuclear protein Ran (Androgen receptor-associated protein 24) (GTPase Ran) (Ras-like protein TC4) (Ras-related nuclear protein) | Homo sapiens (Human) | 123 | 144 | 132 | 139 | 8 | KAKSIVFH | 77.26 |
| DP01364 | P62826 | GTP-binding nuclear protein Ran (Androgen receptor-associated protein 24) (GTPase Ran) (Ras-like protein TC4) (Ras-related nuclear protein) | Homo sapiens (Human) | 170 | 198 | 172 | 180 | 9 | PNLEFVAMP | 77.26 |
| DP01368 | Q8WXE9 | Stonin-2 (Stoned B) | Homo sapiens (Human) | 301 | 340 | 311 | 321 | 11 | ATNPFLNETLQ | 76.53 |
| DP01368 | Q8WXE9 | Stonin-2 (Stoned B) | Homo sapiens (Human) | 301 | 331 | 311 | 321 | 11 | ATNPFLNETLQ | 76.53 |
| DP01377 | J7M799 | Cytosolic-abundant heat soluble protein 1 (CAHS1) (Tardigrade-specific intrinsically disordered protein CAHS1) (TDP CAHS1) | Ramazzottius varieornatus (Water bear) (Tardigrade) | 90 | 190 | 113 | 126 | 14 | EHEMINRQAEATLQ | 78.02 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 4 | 14 | 11 | YQQESSYQYSD | 80.78 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 31 | 37 | 7 | EHSSYTH | 79.26 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 44 | 56 | 13 | MPNLIAPFISSSA | 78.83 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 58 | 75 | 18 | LAQELVGEGFQASVSRIT | 81.49 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 78 | 91 | 14 | SGELTVIDTEAETE | 74.53 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 103 | 109 | 7 | EQELLSR | 80.27 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 126 | 134 | 9 | QEVETEKIR | 77.26 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 152 | 160 | 9 | MEQTIENQK | 76.7 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 194 | 200 | 7 | IQVNMEA | 80.6 |
| DP01378 | P0CU43 | Cytosolic-abundant heat soluble protein 77580 (CAHS 77580) (Tardigrade-specific intrinsically disordered protein CAHS 77580) (TDP CAHS 77580) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 212 | 219 | 8 | VAVSESEK | 74.75 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 4 | 14 | 11 | YQQESSYQYSD | 80.78 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 31 | 37 | 7 | EHSSYTH | 79.26 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 44 | 56 | 13 | MPNLIAPFISSSA | 78.83 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 58 | 75 | 18 | LAQELVGEGFQASVSRIT | 81.49 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 78 | 91 | 14 | SGELTVIDTEAETE | 74.53 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 103 | 109 | 7 | EQELLSR | 80.27 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 126 | 134 | 9 | QEVETEKIR | 77.26 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 152 | 160 | 9 | MEQTIENQK | 76.7 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 194 | 200 | 7 | IQVNMEA | 80.6 |
| DP01379 | P0CU44 | Cytosolic-abundant heat soluble protein 77611 (CAHS 77611) (Tardigrade-specific intrinsically disordered protein CAHS 77611) (TDP CAHS 77611) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 224 | 212 | 219 | 8 | VAVSESEK | 74.75 |
| DP01380 | P0CU45 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 16 | 22 | 7 | VVVNNSG | 77.64 |
| DP01380 | P0CU45 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 31 | 41 | 11 | QQVEHTEFTHT | 75.25 |
| DP01380 | P0CU45 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 51 | 80 | 30 | APPIISTGAAGLAEEIVGQGFTASAARISG | 79 |
| DP01380 | P0CU45 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 122 | 138 | 17 | KTEAYRKTAEAEAEKIR | 77.51 |
| DP01380 | P0CU45 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 147 | 161 | 15 | RDVEFRKDLIESTID | 84.21 |
| DP01380 | P0CU45 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Cytosolic-abundant heat soluble protein a) (SAHS-a) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 212 | 220 | 9 | GGTTISSSD | 79.93 |
| DP01381 | P0CU46 | Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 237 | 1 | 7 | 7 | MSQQYEK | 77.26 |
| DP01381 | P0CU46 | Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 237 | 12 | 18 | 7 | TEVVYGG | 91.97 |
| DP01381 | P0CU46 | Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 237 | 25 | 43 | 19 | SASASAEKTTNYTHTEIRA | 80.11 |
| DP01381 | P0CU46 | Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 237 | 60 | 89 | 30 | LAQEIVGEGFTASATRISGAAATTQVLESQ | 76.38 |
| DP01381 | P0CU46 | Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 237 | 92 | 103 | 12 | REQAFKDQEKYS | 83.95 |
| DP01381 | P0CU46 | Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 237 | 105 | 112 | 8 | EQAAIARA | 91.97 |
| DP01381 | P0CU46 | Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 237 | 127 | 136 | 10 | TAEAEAEKIR | 75.59 |
| DP01381 | P0CU46 | Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 237 | 152 | 159 | 8 | DLVESAID | 86.71 |
| DP01381 | P0CU46 | Cytosolic-abundant heat soluble protein 86272 (CAHS 86272) (Cytosolic-abundant heat soluble protein b) (SAHS-b) (Tardigrade-specific intrinsically disordered protein CAHS 86272) (TDP CAHS 86272) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 237 | 183 | 201 | 19 | AMNALEQSKMATNVQVQMD | 75.25 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 18 | 28 | 11 | ADGATLVKNIG | 80.36 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 54 | 62 | 9 | AGVIPNRIE | 75.92 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 93 | 134 | 42 | KSSSFVEPSLKYRGEIGPIGKNGEFVASSNRQNSSSNVSSSD | 80.33 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 156 | 179 | 24 | TQRTTVITESSVQGLGAQRTVPIQ | 75.01 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 186 | 194 | 9 | DHEVITHES | 79.93 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 201 | 207 | 7 | TTVVTIP | 89.87 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 253 | 284 | 32 | GTSATIHATTDLHLASEAQINDMGPEEYERYR | 76.39 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 286 | 294 | 9 | KVEALARIH | 75.92 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 301 | 318 | 18 | KAAAYRNAVEADAELIRQ | 77.98 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 333 | 339 | 7 | DLVESSV | 79.26 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 342 | 355 | 14 | QQQEIRLEAEYAMR | 83.76 |
| DP01382 | P0CU47 | Cytosolic-abundant heat soluble protein 89226 (CAHS 89226) (Tardigrade-specific intrinsically disordered protein CAHS 89226) (TDP CAHS 89226) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 414 | 368 | 389 | 22 | LDQAMASTNIDVNIDSAIGTTH | 85.8 |
| DP01383 | P0CU51 | Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 229 | 29 | 43 | 15 | EKQEIQQTSYLQSQV | 78.8 |
| DP01383 | P0CU51 | Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 229 | 52 | 89 | 38 | APFFSTSFSAQEILGEGFQASISRISAVSEELSSIEIP | 79.39 |
| DP01383 | P0CU51 | Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 229 | 106 | 117 | 12 | QEMLSANYQKEV | 79.18 |
| DP01383 | P0CU51 | Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 229 | 127 | 133 | 7 | QQEVEAD | 74.58 |
| DP01383 | P0CU51 | Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 229 | 152 | 162 | 11 | DIVEMAIENQK | 76.1 |
| DP01383 | P0CU51 | Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 229 | 188 | 202 | 15 | EQQKFHSDIQVNLDS | 83.84 |
| DP01383 | P0CU51 | Cytosolic-abundant heat soluble protein 107838 (CAHS 107838) (Tardigrade-specific intrinsically disordered protein CAHS 107838) (TDP CAHS 107838) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 229 | 211 | 222 | 12 | GQVVSESQKFTE | 77.26 |
| DP01384 | P0CU50 | Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 16 | 22 | 7 | VVVNNSG | 77.64 |
| DP01384 | P0CU50 | Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 31 | 41 | 11 | QQVEHTEFTHT | 75.25 |
| DP01384 | P0CU50 | Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 51 | 80 | 30 | APPIISTGAAGLAEEIVGQGFTASAARISG | 79 |
| DP01384 | P0CU50 | Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 122 | 138 | 17 | KTEAYRKTAEAEAEKIR | 77.51 |
| DP01384 | P0CU50 | Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 147 | 161 | 15 | RDVEFRKDLIESTID | 84.21 |
| DP01384 | P0CU50 | Cytosolic-abundant heat soluble protein 94063 (CAHS 94063) (Tardigrade-specific intrinsically disordered protein CAHS 94063) (TDP CAHS 94063) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 214 | 220 | 7 | TTVSTSD | 74.15 |
| DP01385 | P0CU48 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 16 | 22 | 7 | VVVNNSG | 77.64 |
| DP01385 | P0CU48 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 31 | 41 | 11 | QQVEHTEFTHT | 75.25 |
| DP01385 | P0CU48 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 51 | 80 | 30 | APPIISTGAAGLAEEIVGQGFTASAARISG | 79 |
| DP01385 | P0CU48 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 122 | 138 | 17 | KTEAYRKTAEAEAEKIR | 77.51 |
| DP01385 | P0CU48 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 147 | 161 | 15 | RDVEFRKDLIESTID | 84.21 |
| DP01385 | P0CU48 | Cytosolic-abundant heat soluble protein 94205 (CAHS 94205) (Tardigrade-specific intrinsically disordered protein CAHS 94205) (TDP CAHS 94205) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 227 | 214 | 220 | 7 | TTVSTSD | 74.15 |
| DP01386 | P0CU49 | Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 238 | 28 | 43 | 16 | AGVAAVYAVRFASSSG | 79.12 |
| DP01386 | P0CU49 | Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 238 | 48 | 54 | 7 | ADNWAES | 75.25 |
| DP01386 | P0CU49 | Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 238 | 81 | 87 | 7 | AAGGIEQ | 75.25 |
| DP01386 | P0CU49 | Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 238 | 103 | 111 | 9 | GSRTFENAK | 75.25 |
| DP01386 | P0CU49 | Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 238 | 134 | 159 | 26 | GVVENVKEAAENAWEKTKDVAENLKD | 78.76 |
| DP01386 | P0CU49 | Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 238 | 171 | 178 | 8 | AANAWETV | 86.25 |
| DP01386 | P0CU49 | Cytosolic-abundant heat soluble protein 68135 (CAHS 68135) (Tardigrade-specific intrinsically disordered protein CAHS 68135) (TDP CAHS 68135) | Hypsibius dujardini (Water bear) (Macrobiotus dujardini) | 1 | 238 | 200 | 210 | 11 | AQQVIHDATTQ | 78.5 |
| DP01388 | P0CU52 | Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 227 | 4 | 15 | 12 | MNMNIPRDAMFV | 79.77 |
| DP01388 | P0CU52 | Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 227 | 31 | 38 | 8 | VQQTSYMQ | 85.66 |
| DP01388 | P0CU52 | Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 227 | 42 | 80 | 39 | KVPHYNFPTPYFTTSFSAQELLGEGFQASISRISAVTED | 78.36 |
| DP01388 | P0CU52 | Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 227 | 85 | 93 | 9 | EIPEFVEEA | 78.93 |
| DP01388 | P0CU52 | Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 227 | 107 | 115 | 9 | LGQQYEKEL | 80.23 |
| DP01388 | P0CU52 | Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 227 | 125 | 131 | 7 | HQEVEAD | 74.58 |
| DP01388 | P0CU52 | Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 227 | 143 | 160 | 18 | RDIEFRKEIAELAIENQK | 78.93 |
| DP01388 | P0CU52 | Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 227 | 186 | 200 | 15 | EQQKFHSDIQVNLDS | 83.84 |
| DP01388 | P0CU52 | Cytosolic-abundant heat soluble protein 106094 (CAHS 106094) (Tardigrade-specific intrinsically disordered protein CAHS 106094) (TDP CAHS 106094) | Paramacrobiotus richtersi (Water bear) (Macrobiotus richtersi) | 1 | 227 | 209 | 219 | 11 | GHVVSQSEKFT | 77.44 |
| DP01391 | P03520 | Phosphoprotein (P protein) (Protein M1) | Vesicular stomatitis Indiana virus (strain San Juan) (VSIV) | 1 | 60 | 1 | 15 | 15 | MDNLTKVREYLKSYS | 78.93 |
| DP01391 | P03520 | Phosphoprotein (P protein) (Protein M1) | Vesicular stomatitis Indiana virus (strain San Juan) (VSIV) | 1 | 60 | 20 | 29 | 10 | AVGEIDEIEA | 81.74 |
| DP01391 | P03520 | Phosphoprotein (P protein) (Protein M1) | Vesicular stomatitis Indiana virus (strain San Juan) (VSIV) | 1 | 60 | 33 | 43 | 11 | EKSNYELFQED | 91.94 |
| DP01392 | P53330 | Regulator of Ty1 transposition protein 102 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 91 | 157 | 117 | 123 | 7 | GDEALSV | 76.4 |
| DP01392 | P53330 | Regulator of Ty1 transposition protein 102 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 91 | 157 | 129 | 137 | 9 | AVGNSEAIP | 78.6 |
| DP01392 | P53330 | Regulator of Ty1 transposition protein 102 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 91 | 157 | 141 | 147 | 7 | AGVNNDN | 73.91 |
| DP01393 | P04880 | Phosphoprotein (Protein P) (Protein M1) | Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV) | 1 | 60 | 1 | 15 | 15 | MDNLTKVREYLKSYS | 78.93 |
| DP01393 | P04880 | Phosphoprotein (Protein P) (Protein M1) | Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV) | 1 | 60 | 20 | 29 | 10 | AVGEIDEIEA | 81.74 |
| DP01393 | P04880 | Phosphoprotein (Protein P) (Protein M1) | Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV) | 1 | 60 | 33 | 43 | 11 | EKSNYELFQED | 91.94 |
| DP01394 | P04879 | Phosphoprotein (Protein P) (Protein M1) | Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV) | 1 | 60 | 1 | 15 | 15 | MDNLTKVREYLKSYS | 78.93 |
| DP01394 | P04879 | Phosphoprotein (Protein P) (Protein M1) | Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV) | 1 | 60 | 20 | 29 | 10 | AVGEIDEIEA | 81.74 |
| DP01394 | P04879 | Phosphoprotein (Protein P) (Protein M1) | Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV) | 1 | 60 | 33 | 43 | 11 | EKSNYELFQED | 91.94 |
| DP01395 | Q8B0H3 | Phosphoprotein (Protein P) (NS) (Protein M1) | Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV) | 1 | 60 | 20 | 29 | 10 | AVGEIDEIEA | 81.74 |
| DP01395 | Q8B0H3 | Phosphoprotein (Protein P) (NS) (Protein M1) | Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV) | 1 | 60 | 33 | 43 | 11 | EKSNYELFQED | 91.94 |
| DP01396 | P01130 | Low-density lipoprotein receptor (LDL receptor) | Homo sapiens (Human) | 354 | 393 | 367 | 376 | 10 | LCVNLEGGYK | 85.28 |
| DP01397 | Q9Z0P7 | Suppressor of fused homolog | Mus musculus (Mouse) | 279 | 359 | 314 | 321 | 8 | RGLEINSK | 75.92 |
| DP01398 | G0SCY6 | HYPK_UBA domain-containing protein | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 25 | 12 | 20 | 9 | VEGATAGDV | 75.25 |
| DP01400 | P45985 | Dual specificity mitogen-activated protein kinase kinase 4 (MAP kinase kinase 4) (MAPKK 4) (EC 2.7.12.2) (JNK-activating kinase 1) (MAPK/ERK kinase 4) (MEK 4) (SAPK/ERK kinase 1) (SEK1) (Stress-activated protein kinase kinase 1) (SAPK kinase 1) (SAPKK-1) (SAPKK1) (c-Jun N-terminal kinase kinase 1) (JNKK) | Homo sapiens (Human) | 1 | 86 | 42 | 50 | 9 | KALKLNFAN | 75.62 |
| DP01400 | P45985 | Dual specificity mitogen-activated protein kinase kinase 4 (MAP kinase kinase 4) (MAPKK 4) (EC 2.7.12.2) (JNK-activating kinase 1) (MAPK/ERK kinase 4) (MEK 4) (SAPK/ERK kinase 1) (SEK1) (Stress-activated protein kinase kinase 1) (SAPK kinase 1) (SAPKK-1) (SAPKK1) (c-Jun N-terminal kinase kinase 1) (JNKK) | Homo sapiens (Human) | 1 | 86 | 57 | 64 | 8 | ARFTLNPN | 80.27 |
| DP01401 | P47093 | U6 snRNA-associated Sm-like protein LSm8 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 68 | 109 | 89 | 104 | 16 | TKNKIENEHVIWEKVY | 77.24 |
| DP01405 | Q5V913 | Nucleoprotein (Nucleocapsid protein) (Protein N) | Influenza B virus (B/Memphis/13/2003) | 1 | 70 | 17 | 24 | 8 | APEEITSG | 79.93 |
| DP01405 | Q5V913 | Nucleoprotein (Nucleocapsid protein) (Protein N) | Influenza B virus (B/Memphis/13/2003) | 1 | 70 | 53 | 59 | 7 | RATTISE | 79.93 |
| DP01420 | Q16543 | Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) Cleaved into: Hsp90 co-chaperone Cdc37; N-terminally processed | Homo sapiens (Human) | 1 | 26 | 1 | 14 | 14 | MVDYSVWDHIEVSD | 76.59 |
| DP01424 | Q2KIG3 | Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI) | Bos taurus (Bovine) | 1 | 117 | 3 | 33 | 31 | LYSLGVLVATVLFCGEHAFAFQRGQVLSALP | 90.51 |
| DP01424 | Q2KIG3 | Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI) | Bos taurus (Bovine) | 1 | 117 | 37 | 80 | 44 | RQVQILQNVTTTYKIVLWQPVAAEYIVKGYEVHFFVNASDVSNV | 86.04 |
| DP01424 | Q2KIG3 | Carboxypeptidase B2 (EC 3.4.17.20) (Carboxypeptidase U) (CPU) (Plasma carboxypeptidase B) (pCPB) (Thrombin-activable fibrinolysis inhibitor) (TAFI) | Bos taurus (Bovine) | 1 | 117 | 93 | 112 | 20 | VLVENVEDLIRQQTSNDTIS | 77.36 |
| DP01425 | Q15004 | PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor) | Homo sapiens (Human) | 1 | 111 | 29 | 40 | 12 | STSATNSTSVSS | 75.92 |
| DP01425 | Q15004 | PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor) | Homo sapiens (Human) | 1 | 111 | 64 | 73 | 10 | GIGEFFRLSP | 77.53 |
| DP01425 | Q15004 | PCNA-associated factor (Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor) | Homo sapiens (Human) | 50 | 77 | 64 | 72 | 9 | GIGEFFRLS | 77.78 |
| DP01426 | P06400 | Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) | Homo sapiens (Human) | 346 | 370 | 347 | 353 | 7 | SIDSFET | 75.63 |
| DP01426 | P06400 | Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) | Homo sapiens (Human) | 577 | 615 | 596 | 609 | 14 | LQNNHTAADMYLSP | 78.38 |
| DP01426 | P06400 | Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) | Homo sapiens (Human) | 590 | 635 | 596 | 609 | 14 | LQNNHTAADMYLSP | 78.38 |
| DP01426 | P06400 | Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) | Homo sapiens (Human) | 590 | 635 | 620 | 630 | 11 | TRVNSTANAET | 75.16 |
| DP01426 | P06400 | Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) | Homo sapiens (Human) | 786 | 928 | 800 | 808 | 9 | PGGNIYISP | 82.87 |
| DP01426 | P06400 | Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) | Homo sapiens (Human) | 786 | 928 | 831 | 856 | 26 | ILVSIGESFGTSEKFQKINQMVCNSD | 84.17 |
| DP01426 | P06400 | Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) | Homo sapiens (Human) | 786 | 928 | 893 | 907 | 15 | GESKFQQKLAEMTST | 81.36 |
| DP01426 | P06400 | Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) | Homo sapiens (Human) | 829 | 873 | 831 | 856 | 26 | ILVSIGESFGTSEKFQKINQMVCNSD | 84.17 |
| DP01427 | Q01094 | Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) | Homo sapiens (Human) | 200 | 301 | 212 | 218 | 7 | QLQESEQ | 73.91 |
| DP01427 | Q01094 | Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) | Homo sapiens (Human) | 200 | 301 | 222 | 236 | 15 | HLMNICTTQLRLLSE | 79.67 |
| DP01427 | Q01094 | Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) | Homo sapiens (Human) | 200 | 301 | 241 | 255 | 15 | QRLAYVTCQDLRSIA | 79.55 |
| DP01427 | Q01094 | Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) | Homo sapiens (Human) | 200 | 301 | 261 | 267 | 7 | MVMVIKA | 76.21 |
| DP01427 | Q01094 | Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) | Homo sapiens (Human) | 200 | 301 | 278 | 288 | 11 | SSENFQISLKS | 87.75 |
| DP01428 | P03120 | Regulatory protein E2 | Human papillomavirus type 16 | 286 | 365 | 293 | 304 | 12 | GDANTLKCLRYR | 77.26 |
| DP01428 | P03120 | Regulatory protein E2 | Human papillomavirus type 16 | 286 | 365 | 308 | 323 | 16 | HCTLYTAVSSTWHWTG | 80.35 |
| DP01428 | P03120 | Regulatory protein E2 | Human papillomavirus type 16 | 286 | 365 | 328 | 360 | 33 | HKSAIVTLTYDSEWQRDQFLSQVKIPKTITVST | 85.6 |
| DP01429 | Q09427 | ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) | Cricetus cricetus (Black-bellied hamster) | 928 | 1000 | 935 | 941 | 7 | QDQELEK | 74.58 |
| DP01429 | Q09427 | ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) | Cricetus cricetus (Black-bellied hamster) | 928 | 1000 | 963 | 973 | 11 | RDGLLLDEEEE | 73.94 |
| DP01429 | Q09427 | ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) | Cricetus cricetus (Black-bellied hamster) | 928 | 1000 | 983 | 995 | 13 | DDNLSSVLHQRAK | 77.26 |
| DP01429 | Q09427 | ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) | Cricetus cricetus (Black-bellied hamster) | 1319 | 1343 | 1322 | 1336 | 15 | EAESYEGLLAPSLIP | 79.4 |
| DP01430 | Q03071 | Elongin-C | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 77 | 99 | 78 | 84 | 7 | PEFEIPT | 77.26 |
| DP01430 | Q03071 | Elongin-C | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 77 | 99 | 87 | 94 | 8 | SLELLLAA | 81.15 |
| DP01431 | C6ZFX3 | Intrinsically disordered protein 1 | Lotus japonicus (Lotus corniculatus var. japonicus) | 1 | 94 | 1 | 24 | 24 | MARSFTNIKAISALVAEEFSNSLA | 82.64 |
| DP01431 | C6ZFX3 | Intrinsically disordered protein 1 | Lotus japonicus (Lotus corniculatus var. japonicus) | 1 | 94 | 69 | 89 | 21 | VTGYYKPENIKEIDVAELRSA | 81.45 |
| DP01432 | E1UJ20 | Parvalbumin beta-1 | Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) | 2 | 109 | 13 | 19 | 7 | KAALEAC | 76.25 |
| DP01432 | E1UJ20 | Parvalbumin beta-1 | Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) | 2 | 109 | 21 | 41 | 21 | AADTFNFKTFFHTIGFASKSA | 81.14 |
| DP01432 | E1UJ20 | Parvalbumin beta-1 | Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) | 2 | 109 | 55 | 73 | 19 | ASGFIEVEELKLFLQNFCP | 85.87 |
| DP01432 | E1UJ20 | Parvalbumin beta-1 | Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) | 2 | 109 | 75 | 90 | 16 | ARVLTDAETKAFLKAG | 77.65 |
| DP01432 | E1UJ20 | Parvalbumin beta-1 | Oncorhynchus kisutch (Coho salmon) (Salmo kisutch) | 2 | 109 | 94 | 104 | 11 | GDGMIGIDEFA | 78.47 |
| DP01433 | P04052 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) | Drosophila melanogaster (Fruit fly) | 1657 | 1739 | 1660 | 1680 | 21 | SGSNIYSPGNAYSPSSSNYSP | 87.21 |
| DP01435 | O60829 | P antigen family member 4 (PAGE-4) (G antigen family C member 1) (PAGE-1) | Homo sapiens (Human) | 1 | 102 | 20 | 28 | 9 | DVVAFVAPG | 81.61 |
| DP01436 | P54936 | Protein lin-2 (Abnormal cell lineage protein 2) | Caenorhabditis elegans | 423 | 487 | 435 | 444 | 10 | TLNQIDGLLG | 77.26 |
| DP01436 | P54936 | Protein lin-2 (Abnormal cell lineage protein 2) | Caenorhabditis elegans | 423 | 487 | 449 | 459 | 11 | ALELRQLLNSP | 75.62 |
| DP01436 | P54936 | Protein lin-2 (Abnormal cell lineage protein 2) | Caenorhabditis elegans | 423 | 487 | 465 | 477 | 13 | VQALDVVVCEIRD | 78.9 |
| DP01437 | P90976 | LIN-7 (Fragment) | Caenorhabditis elegans | 115 | 180 | 120 | 129 | 10 | DVQRILELME | 76.59 |
| DP01437 | P90976 | LIN-7 (Fragment) | Caenorhabditis elegans | 115 | 180 | 135 | 170 | 36 | GEVNNAKLASLQQVLQSEFFGAVREVYETVYESIDA | 81.28 |
| DP01438 | O14936 | Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) | Homo sapiens (Human) | 335 | 401 | 348 | 362 | 15 | SQVLDSLEEIHALTD | 75.3 |
| DP01438 | O14936 | Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) | Homo sapiens (Human) | 335 | 401 | 366 | 391 | 26 | KDLDFLHSVFQDQHLHTLLDLYDKIN | 81.55 |
| DP01438 | O14936 | Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) | Homo sapiens (Human) | 394 | 460 | 410 | 420 | 11 | KEVLEEISCYP | 78.99 |
| DP01438 | O14936 | Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) | Homo sapiens (Human) | 394 | 460 | 433 | 455 | 23 | TQPHFMALLQTHDVVAHEVYSDE | 80.05 |
| DP01441 | P14921 | Protein C-ets-1 (p54) | Homo sapiens (Human) | 276 | 318 | 282 | 288 | 7 | SYDSFDS | 73.91 |
| DP01442 | Q2Q4X9 | Seed maturation protein | Medicago truncatula (Barrel medic) (Medicago tribuloides) | 1 | 260 | 55 | 74 | 20 | GGVASVMQSAATRNEQAGIV | 80.17 |
| DP01442 | Q2Q4X9 | Seed maturation protein | Medicago truncatula (Barrel medic) (Medicago tribuloides) | 1 | 260 | 97 | 105 | 9 | GRRIITETV | 79.93 |
| DP01442 | Q2Q4X9 | Seed maturation protein | Medicago truncatula (Barrel medic) (Medicago tribuloides) | 1 | 260 | 119 | 145 | 27 | VQVGLTGAVRESALTIGEALEATAHTV | 78.24 |
| DP01442 | Q2Q4X9 | Seed maturation protein | Medicago truncatula (Barrel medic) (Medicago tribuloides) | 1 | 260 | 154 | 165 | 12 | DASAIQAAEVRA | 80.71 |
| DP01442 | Q2Q4X9 | Seed maturation protein | Medicago truncatula (Barrel medic) (Medicago tribuloides) | 1 | 260 | 167 | 190 | 24 | GSNVITPGGLASMAQSAAAFNAEC | 78.48 |
| DP01442 | Q2Q4X9 | Seed maturation protein | Medicago truncatula (Barrel medic) (Medicago tribuloides) | 1 | 260 | 200 | 208 | 9 | GNVLTGATA | 81.27 |
| DP01442 | Q2Q4X9 | Seed maturation protein | Medicago truncatula (Barrel medic) (Medicago tribuloides) | 1 | 260 | 222 | 229 | 8 | AGVASAEM | 77.84 |
| DP01442 | Q2Q4X9 | Seed maturation protein | Medicago truncatula (Barrel medic) (Medicago tribuloides) | 1 | 260 | 241 | 255 | 15 | GVAASVAAAARLNEN | 77.66 |
| DP01443 | Q9UJX4 | Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) | Homo sapiens (Human) | 1 | 26 | 2 | 13 | 12 | ASVHESLYFNPM | 80.85 |
| DP01443 | Q9UJX4 | Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) | Homo sapiens (Human) | 1 | 24 | 2 | 13 | 12 | ASVHESLYFNPM | 80.85 |
| DP01443 | Q9UJX4 | Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) | Homo sapiens (Human) | 168 | 205 | 174 | 180 | 7 | DMELTSR | 75.25 |
| DP01443 | Q9UJX4 | Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) | Homo sapiens (Human) | 170 | 205 | 174 | 180 | 7 | DMELTSR | 75.25 |
| DP01443 | Q9UJX4 | Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) | Homo sapiens (Human) | 353 | 413 | 357 | 365 | 9 | SYVLLEHSV | 79.82 |
| DP01443 | Q9UJX4 | Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5) | Homo sapiens (Human) | 353 | 413 | 367 | 399 | 33 | KAVHFGLPYLASLGIQSLVQQRAFAGKTANKLM | 80.86 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 171 | 450 | 172 | 180 | 9 | SLQNFSNCL | 82.72 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 171 | 450 | 199 | 205 | 7 | ETVLTET | 75.35 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 171 | 450 | 214 | 242 | 29 | RLNLESSNSKYSLNTDSSVSYIDSAVISP | 80.94 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 171 | 450 | 249 | 256 | 8 | TGTSILSK | 79.56 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 171 | 450 | 293 | 305 | 13 | GDGSYLQNYTNTP | 87.96 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 171 | 450 | 329 | 337 | 9 | TKSVFSQSG | 77.26 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 171 | 450 | 378 | 389 | 12 | SSRLFTSDSSTT | 77.59 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 171 | 450 | 419 | 445 | 27 | TQPNINDSLEITKLDSSIISEGKISTI | 84.45 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 180 | 447 | 199 | 205 | 7 | ETVLTET | 75.35 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 180 | 447 | 214 | 242 | 29 | RLNLESSNSKYSLNTDSSVSYIDSAVISP | 80.94 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 180 | 447 | 249 | 256 | 8 | TGTSILSK | 79.56 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 180 | 447 | 293 | 305 | 13 | GDGSYLQNYTNTP | 87.96 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 180 | 447 | 329 | 337 | 9 | TKSVFSQSG | 77.26 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 180 | 447 | 378 | 389 | 12 | SSRLFTSDSSTT | 77.59 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 180 | 447 | 419 | 442 | 24 | TQPNINDSLEITKLDSSIISEGKI | 83.51 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 767 | 824 | 771 | 784 | 14 | ANNQIKEAIDKRYL | 78.74 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 767 | 824 | 793 | 799 | 7 | QEEQIMG | 80.6 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 769 | 824 | 771 | 784 | 14 | ANNQIKEAIDKRYL | 78.74 |
| DP01445 | P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | Homo sapiens (Human) | 769 | 824 | 793 | 799 | 7 | QEEQIMG | 80.6 |
| DP01448 | P10923 | Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) | Mus musculus (Mouse) | 17 | 294 | 38 | 45 | 8 | PIATWLVP | 79.56 |
| DP01448 | P10923 | Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) | Mus musculus (Mouse) | 17 | 294 | 58 | 64 | 7 | NAVSSEE | 75.92 |
| DP01448 | P10923 | Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) | Mus musculus (Mouse) | 17 | 294 | 127 | 135 | 9 | QADTFTPIV | 77.26 |
| DP01448 | P10923 | Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) | Mus musculus (Mouse) | 17 | 294 | 145 | 154 | 10 | GDSLAYGLRS | 81.44 |
| DP01448 | P10923 | Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) | Mus musculus (Mouse) | 17 | 294 | 158 | 167 | 10 | SFQVSDEQYP | 75.12 |
| DP01448 | P10923 | Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) | Mus musculus (Mouse) | 17 | 294 | 187 | 198 | 12 | LDVIPVAQLLSM | 84.75 |
| DP01448 | P10923 | Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) | Mus musculus (Mouse) | 17 | 294 | 238 | 247 | 10 | SDVIDSQASS | 75.25 |
| DP01448 | P10923 | Osteopontin (2AR) (Bone sialoprotein 1) (Calcium oxalate crystal growth inhibitor protein) (Early T-lymphocyte activation 1 protein) (Minopontin) (Secreted phosphoprotein 1) (SPP-1) | Mus musculus (Mouse) | 17 | 294 | 276 | 289 | 14 | RYLKFRISHELESS | 79.93 |
| DP01449 | Q15637 | Splicing factor 1 (Mammalian branch point-binding protein) (BBP) (mBBP) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Zinc finger protein 162) | Homo sapiens (Human) | 69 | 95 | 83 | 90 | 8 | PEPIYNSE | 77.26 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 49 | 62 | 14 | CDFNCNHVHSGLKL | 75.25 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 70 | 82 | 13 | RLVSYTPAYLEGS | 78.36 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 92 | 101 | 10 | RLSCIGSPIV | 77.26 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 105 | 112 | 8 | IVQLETES | 75.17 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 123 | 158 | 36 | VQQTLNSTNEIEALETSRLYEDSGYSSFSLQSGLSE | 77.08 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 163 | 182 | 20 | SLLEENFGDSLQSCLLQIQS | 79.1 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 193 | 206 | 14 | PVLHFEKVVCSTLK | 76.92 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 219 | 236 | 18 | MLKEIIARGNFRLQNIIG | 87.25 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 242 | 252 | 11 | ECVDILSELFR | 80.24 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 257 | 285 | 29 | HVLATILAQLSDMDLINVSKVSTTWKKIL | 77.65 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 1 | 318 | 290 | 310 | 21 | GAFQLYSKAIQRVTENNNKFS | 79.25 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 305 | 374 | 314 | 322 | 9 | STREYVMFR | 81.72 |
| DP01450 | Q9UKT4 | F-box only protein 5 (Early mitotic inhibitor 1) | Homo sapiens (Human) | 305 | 374 | 352 | 369 | 18 | KGSTYSRHNEFSEVAKTL | 80.79 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 94 | 126 | 95 | 108 | 14 | MEEPINKRLFEKYL | 83.42 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 96 | 126 | 100 | 108 | 9 | NKRLFEKYL | 86.85 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 96 | 123 | 100 | 108 | 9 | NKRLFEKYL | 86.85 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 528 | 620 | 529 | 536 | 8 | DSEAYIGA | 88.25 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 528 | 620 | 541 | 552 | 12 | KLKCYDFDVHTM | 78.26 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 528 | 620 | 554 | 561 | 8 | TLKNIISP | 87.5 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 528 | 620 | 564 | 570 | 7 | DFREFEV | 79.93 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 528 | 620 | 595 | 607 | 13 | SLEETFEIEMNES | 85.41 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 534 | 620 | 541 | 552 | 12 | KLKCYDFDVHTM | 78.26 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 534 | 620 | 554 | 561 | 8 | TLKNIISP | 87.5 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 534 | 620 | 564 | 570 | 7 | DFREFEV | 79.93 |
| DP01452 | Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | Homo sapiens (Human) | 534 | 620 | 595 | 607 | 13 | SLEETFEIEMNES | 85.41 |
| DP01453 | Q8NHZ8 | Anaphase-promoting complex subunit CDC26 (Anaphase-promoting complex subunit 12) (APC12) (Cell division cycle protein 26 homolog) | Homo sapiens (Human) | 26 | 85 | 44 | 52 | 9 | GEGAIGLSS | 82.16 |
| DP01455 | Q96DE5 | Anaphase-promoting complex subunit 16 (APC16) (Cyclosome subunit 16) | Homo sapiens (Human) | 1 | 51 | 32 | 39 | 8 | RKALFTYP | 92.1 |
| DP01456 | Q01081 | Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) | Homo sapiens (Human) | 38 | 152 | 42 | 59 | 18 | FSQTIALLNIYRNPQNSS | 79.56 |
| DP01456 | Q01081 | Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) | Homo sapiens (Human) | 38 | 152 | 74 | 100 | 27 | MQEHYDEFFEEVFTEMEEKYGEVEEMN | 82.03 |
| DP01456 | Q01081 | Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) | Homo sapiens (Human) | 38 | 152 | 110 | 118 | 9 | VGNVYVKFR | 88.29 |
| DP01456 | Q01081 | Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) | Homo sapiens (Human) | 38 | 152 | 125 | 137 | 13 | KAVIDLNNRWFNG | 84.02 |
| DP01457 | Q92973 | Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP) | Homo sapiens (Human) | 319 | 371 | 319 | 337 | 19 | SDIDIILLKGDVEEDETIP | 79.35 |
| DP01458 | Q9Y3B4 | Splicing factor 3B subunit 6 (Pre-mRNA branch site protein p14) (SF3b 14 kDa subunit) (SF3B14a) (Spliceosome-associated protein; 14-kDa) (Splicing factor 3b; subunit 6; 14kDa) | Homo sapiens (Human) | 100 | 125 | 108 | 118 | 11 | EQLKLLKEKYG | 75.07 |
| DP01461 | Q13188 | Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C) | Homo sapiens (Human) | 314 | 427 | 321 | 334 | 14 | LDSHTMVKTSVESV | 76.54 |
| DP01461 | Q13188 | Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C) | Homo sapiens (Human) | 314 | 427 | 347 | 371 | 25 | AQTMIEHNSTMLESDLGTMVINSED | 79.69 |
| DP01461 | Q13188 | Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C) | Homo sapiens (Human) | 314 | 427 | 392 | 398 | 7 | SFMDYFD | 80.17 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 1 | 300 | 17 | 23 | 7 | RNQEIQQ | 76.83 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 1 | 300 | 31 | 44 | 14 | SSPLFAEPYKVTSK | 74.58 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 1 | 300 | 48 | 60 | 13 | LSSRIQSMLGNYD | 82.97 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 1 | 300 | 63 | 77 | 15 | KDFIGDRSIPKLVAI | 80.82 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 1 | 300 | 86 | 98 | 13 | ADEKSNPNFFEQR | 78.93 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 1 | 300 | 152 | 160 | 9 | DRESYNNSG | 76.59 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 1 | 300 | 185 | 193 | 9 | QAVSSLNSS | 79.04 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 1 | 300 | 216 | 222 | 7 | PDANWDS | 75.92 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 1 | 300 | 271 | 284 | 14 | SSEHYSSQSHGNSM | 80.6 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 2 | 33 | 17 | 23 | 7 | RNQEIQQ | 76.83 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 300 | 600 | 311 | 323 | 13 | GDVSCVDEILKEM | 75.97 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 300 | 600 | 473 | 482 | 10 | QLDNWLNKVN | 89.26 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 300 | 600 | 510 | 517 | 8 | GTGNSYTD | 79.39 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 300 | 600 | 580 | 588 | 9 | GGLKIESET | 80.94 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 600 | 900 | 640 | 647 | 8 | SREIIETD | 75.59 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 600 | 900 | 684 | 694 | 11 | EDSFFRQRMFS | 79.05 |
| DP01463 | Q9UHB7 | AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein) | Homo sapiens (Human) | 600 | 900 | 711 | 724 | 14 | RYPLIVKIDLNLLT | 84.97 |
| DP01464 | P28229 | Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein) | Mus musculus (Mouse) | 265 | 332 | 271 | 283 | 13 | DPGAYNYPFTWNT | 80.86 |
| DP01464 | P28229 | Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein) | Mus musculus (Mouse) | 265 | 332 | 288 | 294 | 7 | PGYNIAV | 80.27 |
| DP01464 | P28229 | Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein) | Mus musculus (Mouse) | 265 | 332 | 297 | 326 | 30 | DQIQYTELSNAKIAYKQNKANIAQEQQYGS | 81.84 |
| DP01464 | P28229 | Gap junction gamma-1 protein (Connexin-45) (Cx45) (Gap junction alpha-7 protein) | Mus musculus (Mouse) | 362 | 396 | 379 | 385 | 7 | NKSSISS | 74.39 |
| DP01465 | Q8IW19 | Aprataxin and PNK-like factor (EC 3.1.-.-) (Apurinic-apyrimidinic endonuclease APLF) (PNK and APTX-like FHA domain-containing protein) (XRCC1-interacting protein 1) | Homo sapiens (Human) | 399 | 420 | 400 | 413 | 14 | GDSDYGGVQIVGQD | 83.92 |
| DP01465 | Q8IW19 | Aprataxin and PNK-like factor (EC 3.1.-.-) (Apurinic-apyrimidinic endonuclease APLF) (PNK and APTX-like FHA domain-containing protein) (XRCC1-interacting protein 1) | Homo sapiens (Human) | 450 | 511 | 458 | 470 | 13 | QPNEYDLNDSFLD | 79.73 |
| DP01465 | Q8IW19 | Aprataxin and PNK-like factor (EC 3.1.-.-) (Apurinic-apyrimidinic endonuclease APLF) (PNK and APTX-like FHA domain-containing protein) (XRCC1-interacting protein 1) | Homo sapiens (Human) | 450 | 511 | 495 | 506 | 12 | EDVEELLKEAKR | 74.69 |
| DP01466 | A4L7I2 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1664 | 1687 | 24 | VQEVSTTTSLTHSQFDLSADGETL | 75.38 |
| DP01466 | A4L7I2 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1707 | 1730 | 24 | GAVHTLPTIIGNLAAVSDWVMSTV | 78.02 |
| DP01466 | A4L7I2 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1740 | 1748 | 9 | GRNLTVTCD | 75.92 |
| DP01466 | A4L7I2 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1750 | 1756 | 7 | REGNITP | 85.28 |
| DP01466 | A4L7I2 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1758 | 1767 | 10 | ASVRFFRAEL | 78.23 |
| DP01466 | A4L7I2 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1770 | 1776 | 7 | AVQETAE | 80.27 |
| DP01466 | A4L7I2 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1778 | 1786 | 9 | RDTAISLQA | 78.6 |
| DP01466 | A4L7I2 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1806 | 1836 | 31 | ETFPITFGDFDEGEIESLSSELLTFGDFLPG | 77.79 |
| DP01467 | Q9SP32 | Endoribonuclease Dicer homolog 1 (EC 3.1.26.-) (Dicer-like protein 1) (AtDCL1) (Protein ABNORMAL SUSPENSOR 1) (Protein CARPEL FACTORY) (Protein SHORT INTEGUMENTS 1) (Protein SUSPENSOR 1) | Arabidopsis thaliana (Mouse-ear cress) | 1732 | 1811 | 1743 | 1753 | 11 | QQQAEGLEYKA | 75.19 |
| DP01467 | Q9SP32 | Endoribonuclease Dicer homolog 1 (EC 3.1.26.-) (Dicer-like protein 1) (AtDCL1) (Protein ABNORMAL SUSPENSOR 1) (Protein CARPEL FACTORY) (Protein SHORT INTEGUMENTS 1) (Protein SUSPENSOR 1) | Arabidopsis thaliana (Mouse-ear cress) | 1732 | 1811 | 1761 | 1778 | 18 | TVEVFIDGVQVGVAQNPQ | 86.81 |
| DP01467 | Q9SP32 | Endoribonuclease Dicer homolog 1 (EC 3.1.26.-) (Dicer-like protein 1) (AtDCL1) (Protein ABNORMAL SUSPENSOR 1) (Protein CARPEL FACTORY) (Protein SHORT INTEGUMENTS 1) (Protein SUSPENSOR 1) | Arabidopsis thaliana (Mouse-ear cress) | 1732 | 1811 | 1781 | 1806 | 26 | MAQKLAARNALAALKEKEIAESKEKH | 76.65 |
| DP01468 | A3RMR8 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1664 | 1687 | 24 | VQEVSTTTSLTHSQFDLSADGETL | 75.38 |
| DP01468 | A3RMR8 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1707 | 1730 | 24 | GAVHTLPTIIGNLAAVSDWVMSTV | 78.02 |
| DP01468 | A3RMR8 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1740 | 1748 | 9 | GRNLTVTCD | 75.92 |
| DP01468 | A3RMR8 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1750 | 1756 | 7 | REGNITP | 85.28 |
| DP01468 | A3RMR8 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1758 | 1767 | 10 | ASVRFFRAEL | 78.23 |
| DP01468 | A3RMR8 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1770 | 1776 | 7 | AVQETAE | 80.27 |
| DP01468 | A3RMR8 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1778 | 1786 | 9 | RDTAISLQA | 78.6 |
| DP01468 | A3RMR8 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1806 | 1836 | 31 | ETFPITFGDFDEGEIESLSSELLTFGDFLPG | 77.79 |
| DP01469 | A4L7I4 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1664 | 1687 | 24 | VQEVSTTTSLTHSQFDLSADGETL | 75.38 |
| DP01469 | A4L7I4 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1707 | 1730 | 24 | GAVHTLPTIIGNLAAVSDWVMSTV | 78.02 |
| DP01469 | A4L7I4 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1740 | 1748 | 9 | GRNLTVTCD | 75.92 |
| DP01469 | A4L7I4 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1750 | 1756 | 7 | REGNITP | 85.28 |
| DP01469 | A4L7I4 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1758 | 1767 | 10 | ASVRFFRAEL | 78.23 |
| DP01469 | A4L7I4 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1770 | 1776 | 7 | AVQETAE | 80.27 |
| DP01469 | A4L7I4 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1778 | 1786 | 9 | RDTAISLQA | 78.6 |
| DP01469 | A4L7I4 | Non-structural polyprotein (EC 2.7.7.19) (EC 3.1.3.33) (EC 3.1.3.84) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 1) (Non-structural protein 2) (Non-structural protein 4) (Polyprotein P123) (Polyprotein P1234) (Protease nsP2) (RNA-directed RNA polymerase nsP4) (mRNA-capping enzyme nsP1) | Chikungunya virus (CHIKV) | 1658 | 1856 | 1806 | 1836 | 31 | ETFPITFGDFDEGEIESLSSELLTFGDFLPG | 77.79 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 46 | 56 | 11 | DICVLQPIKFK | 74.79 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 61 | 84 | 24 | RDITFDGEQAIKEDNSHYEDLYHS | 83.74 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 96 | 105 | 10 | DDLLILNMED | 79.83 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 111 | 120 | 10 | HHLLSDSSEA | 74.58 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 125 | 139 | 15 | EGEHISSIPTRGEIA | 78.06 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 155 | 168 | 14 | SDVTTERDYVKLLD | 79.93 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 189 | 198 | 10 | NEKEITNFSD | 76.82 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 208 | 261 | 54 | MLALTDNQIAIQKDSKRKIIEKAINEVPYRTNEEWETQLLSKGNINKSNEKIIT | 82.74 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 273 | 291 | 19 | SGNSIERINEMVSKICLQR | 84.74 |
| DP01471 | P36118 | Pre-mRNA-splicing factor NTR2 (Nineteen complex-related protein 2) (NTC-related protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 322 | 297 | 305 | 9 | RLQALEKTK | 75.1 |
| DP01472 | Q6GX35 | Translocated actin-recruiting phosphoprotein (Tarp protein) | Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) | 726 | 825 | 760 | 766 | 7 | LDVVYPG | 91.97 |
| DP01472 | Q6GX35 | Translocated actin-recruiting phosphoprotein (Tarp protein) | Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) | 726 | 825 | 776 | 786 | 11 | LQANQTLGDIV | 75.92 |
| DP01472 | Q6GX35 | Translocated actin-recruiting phosphoprotein (Tarp protein) | Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) | 726 | 825 | 794 | 800 | 7 | TSQETVV | 73.91 |
| DP01473 | Q96GU1 | P antigen family member 5 (PAGE-5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate-associated gene 5 protein) | Homo sapiens (Human) | 20 | 130 | 35 | 41 | 7 | NDQESSQ | 76.25 |
| DP01473 | Q96GU1 | P antigen family member 5 (PAGE-5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate-associated gene 5 protein) | Homo sapiens (Human) | 20 | 130 | 43 | 49 | 7 | VGPVIVQ | 73.91 |
| DP01473 | Q96GU1 | P antigen family member 5 (PAGE-5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate-associated gene 5 protein) | Homo sapiens (Human) | 20 | 130 | 86 | 101 | 16 | DVEAFQQELALLKIED | 84.74 |
| DP01474 | P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | Homo sapiens (Human) | 1 | 130 | 13 | 25 | 13 | RPQNYLFGCELKA | 87.27 |
| DP01474 | P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | Homo sapiens (Human) | 1 | 130 | 39 | 51 | 13 | EHQLSLRTVSLGA | 73.91 |
| DP01474 | P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | Homo sapiens (Human) | 1 | 130 | 55 | 69 | 15 | DELHIVEAEAMNYEG | 79.62 |
| DP01474 | P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | Homo sapiens (Human) | 1 | 130 | 72 | 82 | 11 | IKVTLATLKMS | 76.71 |
| DP01474 | P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | Homo sapiens (Human) | 1 | 130 | 90 | 96 | 7 | GGFEITP | 81.94 |
| DP01474 | P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | Homo sapiens (Human) | 1 | 130 | 107 | 122 | 16 | GPVHISGQHLVAVEED | 83.11 |
| DP01474 | P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | Homo sapiens (Human) | 159 | 294 | 251 | 257 | 7 | MQASIEK | 75.68 |
| DP01474 | P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | Homo sapiens (Human) | 159 | 294 | 264 | 275 | 12 | VEAKFINYVKNC | 93.87 |
| DP01474 | P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | Homo sapiens (Human) | 159 | 294 | 280 | 289 | 10 | DQEAIQDLWQ | 81.84 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 1 | 23 | 2 | 11 | 10 | TNETIDQTRT | 85.62 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 222 | 302 | 227 | 234 | 8 | SDVKEAIN | 83.36 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 222 | 302 | 244 | 251 | 8 | DIATTTTD | 75.25 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 222 | 302 | 265 | 275 | 11 | ERGNFSKFTLG | 87.72 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 222 | 302 | 284 | 297 | 14 | GVADIDPNYKFNQL | 78.33 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 510 | 536 | 510 | 518 | 9 | NFKYTNASK | 82.61 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 824 | 876 | 838 | 853 | 16 | NSELYQSVKNSVNKTL | 91.97 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 824 | 876 | 857 | 871 | 15 | GLSGIEATALAKNFS | 80.94 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 877 | 1186 | 877 | 889 | 13 | LNEKFKNFNNNNN | 80.52 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 877 | 1186 | 908 | 938 | 31 | GQVASPEEPIYTQVAKKVNAKIDRLNQIASG | 79.63 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 877 | 1186 | 961 | 976 | 16 | KVGLSASPEPIYATID | 81.19 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 877 | 1186 | 1001 | 1031 | 31 | NQELAQKIDNLNQAVSEAKAGFFGNLEQTID | 80.82 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 877 | 1186 | 1040 | 1049 | 10 | NVMNLYVESA | 85.45 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 877 | 1186 | 1059 | 1084 | 26 | KLDNYAINSHTRINSNIQNGAINEKA | 78.81 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 877 | 1186 | 1099 | 1107 | 9 | VNDKIVAHN | 78.82 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 877 | 1186 | 1109 | 1124 | 16 | GSVSLSEYDKIGFNQK | 85.58 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 877 | 1186 | 1131 | 1167 | 37 | DSFKFSTKLNNAVKDIKSGFTHFLANAFSTGYYCLAR | 81.2 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 893 | 1001 | 908 | 938 | 31 | GQVASPEEPIYTQVAKKVNAKIDRLNQIASG | 79.63 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 893 | 1001 | 961 | 976 | 16 | KVGLSASPEPIYATID | 81.19 |
| DP01475 | P55980 | Cytotoxicity-associated immunodominant antigen (120 kDa protein) (CAG pathogenicity island protein 26) | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 998 | 1038 | 1001 | 1031 | 31 | NQELAQKIDNLNQAVSEAKAGFFGNLEQTID | 80.82 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 802 | 815 | 14 | HFGTTTVISESTYP | 79.19 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 832 | 844 | 13 | YGNVTVTESYTTS | 78.54 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 861 | 873 | 13 | NVVVTERVVGPIS | 74.86 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 889 | 900 | 12 | GSNVIVTERVIA | 80.04 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 919 | 939 | 21 | NVVVTERVIQPTSGMIGSLSM | 77.61 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 943 | 954 | 12 | LANAHNVIVTER | 78.09 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 978 | 984 | 7 | GLVGTSM | 74.15 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 1000 | 1013 | 14 | GIGLSSLGGTASIG | 80.12 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 1019 | 1029 | 11 | SDHHFNQTIGS | 84.65 |
| DP01476 | Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | Homo sapiens (Human) | 774 | 1049 | 1038 | 1044 | 7 | RITKYST | 80.7 |
| DP01478 | Q9UJX5 | Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4) | Homo sapiens (Human) | 480 | 521 | 494 | 505 | 12 | GNQWYDFLQNSS | 84.39 |
| DP01478 | Q9UJX5 | Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4) | Homo sapiens (Human) | 480 | 521 | 510 | 516 | 7 | SPLLFPY | 82.32 |
| DP01478 | Q9UJX5 | Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4) | Homo sapiens (Human) | 758 | 808 | 767 | 803 | 37 | KPVKIKEEVLSESEAENQQAGAAALAPEIVIKVEKLD | 79.28 |
| DP01479 | Q9UJX3 | Anaphase-promoting complex subunit 7 (APC7) (Cyclosome subunit 7) | Homo sapiens (Human) | 1 | 35 | 4 | 23 | 20 | GDAAILESSLRILYRLFESV | 80.17 |
| DP01479 | Q9UJX3 | Anaphase-promoting complex subunit 7 (APC7) (Cyclosome subunit 7) | Homo sapiens (Human) | 541 | 599 | 586 | 594 | 9 | AAQWADQEQ | 80.9 |
| DP01481 | Q5UPT2 | Probable uracil-DNA glycosylase (UDG) (EC 3.2.2.-) | Acanthamoeba polyphaga mimivirus (APMV) | 1 | 94 | 18 | 44 | 27 | PPSIFSSDNEENSDVDNSVIINDKNTK | 85.22 |
| DP01482 | O13828 | mRNA decapping complex subunit 2 (EC 3.-.-.-) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 553 | 741 | 556 | 566 | 11 | SAQLLQALLHP | 77.74 |
| DP01482 | O13828 | mRNA decapping complex subunit 2 (EC 3.-.-.-) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 553 | 741 | 580 | 592 | 13 | SDSLSLLTLLKSG | 79.73 |
| DP01482 | O13828 | mRNA decapping complex subunit 2 (EC 3.-.-.-) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 553 | 741 | 600 | 609 | 10 | LQNKSQNNER | 74.58 |
| DP01482 | O13828 | mRNA decapping complex subunit 2 (EC 3.-.-.-) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 553 | 741 | 613 | 627 | 15 | SQVKELEVKNYSKST | 77.39 |
| DP01482 | O13828 | mRNA decapping complex subunit 2 (EC 3.-.-.-) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 553 | 741 | 645 | 654 | 10 | AANQFDLLKV | 75.72 |
| DP01482 | O13828 | mRNA decapping complex subunit 2 (EC 3.-.-.-) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 553 | 741 | 695 | 701 | 7 | GFVKILK | 97.99 |
| DP01482 | O13828 | mRNA decapping complex subunit 2 (EC 3.-.-.-) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 553 | 741 | 721 | 736 | 16 | SDDHFLSYLQSVVSSN | 80.27 |
| DP01484 | P04626 | Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) | Homo sapiens (Human) | 988 | 1255 | 1000 | 1011 | 12 | LDSTFYRSLLED | 75.95 |
| DP01484 | P04626 | Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) | Homo sapiens (Human) | 988 | 1255 | 1019 | 1031 | 13 | DAEEYLVPQQGFF | 87.96 |
| DP01484 | P04626 | Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) | Homo sapiens (Human) | 988 | 1255 | 1057 | 1065 | 9 | GDLTLGLEP | 77.26 |
| DP01484 | P04626 | Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) | Homo sapiens (Human) | 988 | 1255 | 1108 | 1114 | 7 | PLQRYSE | 75.35 |
| DP01484 | P04626 | Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) | Homo sapiens (Human) | 988 | 1255 | 1126 | 1132 | 7 | GYVAPLT | 73.91 |
| DP01484 | P04626 | Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) | Homo sapiens (Human) | 988 | 1255 | 1182 | 1198 | 17 | KDVFAFGGAVENPEYLT | 91.11 |
| DP01484 | P04626 | Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) | Homo sapiens (Human) | 988 | 1255 | 1216 | 1225 | 10 | AFDNLYYWDQ | 81.67 |
| DP01485 | P40161 | Histone chaperone RTT106 (Regulator of Ty1 transposition protein 106) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 43 | 67 | 55 | 62 | 8 | IDVSSDLL | 75.25 |
| DP01486 | P11912 | B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a) | Homo sapiens (Human) | 166 | 226 | 178 | 203 | 26 | AGDEYEDENLYEGLNLDDCSMYEDIS | 84.41 |
| DP01486 | P11912 | B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a) | Homo sapiens (Human) | 166 | 226 | 206 | 221 | 16 | LQGTYQDVGSLNIGDV | 87.44 |
| DP01487 | P40259 | B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b) | Homo sapiens (Human) | 181 | 229 | 192 | 214 | 23 | EDHTYEGLDIDQTATYEDIVTLR | 80.11 |
| DP01487 | P40259 | B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b) | Homo sapiens (Human) | 181 | 229 | 216 | 222 | 7 | GEVKWSV | 87.29 |
| DP01488 | P69346 | Antitoxin YefM | Escherichia coli (strain K12) | 1 | 83 | 2 | 17 | 16 | RTISYSEARQNLSATM | 80.25 |
| DP01488 | P69346 | Antitoxin YefM | Escherichia coli (strain K12) | 1 | 83 | 25 | 32 | 8 | APILITRQ | 87.63 |
| DP01488 | P69346 | Antitoxin YefM | Escherichia coli (strain K12) | 1 | 83 | 36 | 57 | 22 | ACVLMSLEEYNSLEETAYLLRS | 79.89 |
| DP01488 | P69346 | Antitoxin YefM | Escherichia coli (strain K12) | 1 | 55 | 2 | 17 | 16 | RTISYSEARQNLSATM | 80.25 |
| DP01488 | P69346 | Antitoxin YefM | Escherichia coli (strain K12) | 1 | 55 | 25 | 32 | 8 | APILITRQ | 87.63 |
| DP01488 | P69346 | Antitoxin YefM | Escherichia coli (strain K12) | 1 | 55 | 36 | 50 | 15 | ACVLMSLEEYNSLEE | 80.78 |
| DP01489 | Q9UBK2 | Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) | Homo sapiens (Human) | 2 | 220 | 8 | 26 | 19 | QDSESVWSDIECAALVGED | 76.62 |
| DP01489 | Q9UBK2 | Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) | Homo sapiens (Human) | 2 | 220 | 48 | 101 | 54 | TDSFLGGLKWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPV | 79.44 |
| DP01489 | Q9UBK2 | Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) | Homo sapiens (Human) | 2 | 220 | 109 | 120 | 12 | FDALTDGDVTTD | 82.27 |
| DP01489 | Q9UBK2 | Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) | Homo sapiens (Human) | 2 | 220 | 153 | 161 | 9 | NTQLSYNEC | 93.94 |
| DP01489 | Q9UBK2 | Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) | Homo sapiens (Human) | 2 | 220 | 163 | 173 | 11 | GLSTQNHANHN | 73.91 |
| DP01489 | Q9UBK2 | Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) | Homo sapiens (Human) | 2 | 220 | 178 | 197 | 20 | TNPAIVKTENSWSNKAKSIC | 78.08 |
| DP01489 | Q9UBK2 | Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6) | Homo sapiens (Human) | 2 | 220 | 209 | 215 | 7 | ELLKYLT | 80.32 |
| DP01490 | Q9NR61 | Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4) | Homo sapiens (Human) | 553 | 685 | 567 | 589 | 23 | AMNNLSDFQKDNLIPAAQLKNTN | 79.69 |
| DP01490 | Q9NR61 | Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4) | Homo sapiens (Human) | 553 | 685 | 607 | 618 | 12 | KQQNHTLDYNLA | 82.22 |
| DP01490 | Q9NR61 | Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4) | Homo sapiens (Human) | 553 | 685 | 662 | 680 | 19 | RDSMYQSVCLISEERNECV | 82.27 |
| DP01491 | P22059 | Oxysterol-binding protein 1 | Homo sapiens (Human) | 346 | 379 | 354 | 368 | 15 | DDENEFFDAPEIITM | 76.95 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1259 | 1265 | 7 | SLQELDQ | 75.25 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1270 | 1282 | 13 | VAVSSNASTTKYP | 80.27 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1300 | 1318 | 19 | RQHSYDTFVDLQKEEAALA | 75.66 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1336 | 1342 | 7 | YAHMFEM | 75.92 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1345 | 1358 | 14 | GESSFANKSSVTTA | 82.61 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1381 | 1390 | 10 | TQNPFIPTFG | 76.66 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1392 | 1406 | 15 | DQCLLHGSKSYFFRQ | 76.25 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1420 | 1433 | 14 | RALVTNKPVVSALH | 75.25 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1442 | 1453 | 12 | KDICIGNQSNPC | 74.72 |
| DP01492 | Q01097 | Glutamate receptor ionotropic; NMDA 2B (GluN2B) (Glutamate NMDA receptor subunit epsilon-2) (N-methyl D-aspartate receptor subtype 2B) (NMDAR2B) (NR2B) | Mus musculus (Mouse) | 1259 | 1482 | 1459 | 1477 | 19 | NPRAFNGSSNGHVYEKLSS | 76.13 |
| DP01494 | Q9VMA3 | Protein cup (Oskar ribonucleoprotein complex 147 kDa subunit) | Drosophila melanogaster (Fruit fly) | 340 | 361 | 347 | 353 | 7 | SKESFVM | 74.58 |
| DP01495 | P08510 | Potassium voltage-gated channel protein Shaker (Protein minisleep) | Drosophila melanogaster (Fruit fly) | 513 | 655 | 550 | 557 | 8 | AVAPFLGA | 77.26 |
| DP01495 | P08510 | Potassium voltage-gated channel protein Shaker (Protein minisleep) | Drosophila melanogaster (Fruit fly) | 513 | 655 | 566 | 574 | 9 | ASSLSMSID | 76.37 |
| DP01495 | P08510 | Potassium voltage-gated channel protein Shaker (Protein minisleep) | Drosophila melanogaster (Fruit fly) | 513 | 655 | 581 | 592 | 12 | LQQLTQTQLYQQ | 83.19 |
| DP01495 | P08510 | Potassium voltage-gated channel protein Shaker (Protein minisleep) | Drosophila melanogaster (Fruit fly) | 513 | 655 | 599 | 605 | 7 | QQQNGFK | 75.35 |
| DP01495 | P08510 | Potassium voltage-gated channel protein Shaker (Protein minisleep) | Drosophila melanogaster (Fruit fly) | 513 | 655 | 612 | 633 | 22 | QQQLQQQQSHTINASAAAATSG | 77.38 |
| DP01495 | P08510 | Potassium voltage-gated channel protein Shaker (Protein minisleep) | Drosophila melanogaster (Fruit fly) | 513 | 655 | 643 | 650 | 8 | HNNALAVS | 79.01 |
| DP01496 | P0AFG0 | Transcription termination/antitermination protein NusG | Escherichia coli (strain K12) | 45 | 65 | 48 | 54 | 7 | EVVEIRG | 86.96 |
| DP01497 | Q9NK80 | Gliotactin | Drosophila melanogaster (Fruit fly) | 750 | 956 | 756 | 773 | 18 | SDRFYDEDVFINGEGLEP | 79.28 |
| DP01497 | Q9NK80 | Gliotactin | Drosophila melanogaster (Fruit fly) | 750 | 956 | 794 | 803 | 10 | SRDNIYEYRD | 87.16 |
| DP01497 | Q9NK80 | Gliotactin | Drosophila melanogaster (Fruit fly) | 750 | 956 | 866 | 876 | 11 | QNGSIAKVASP | 79.93 |
| DP01498 | O70480 | Vesicle-associated membrane protein 4 (VAMP-4) | Mus musculus (Mouse) | 47 | 117 | 55 | 77 | 23 | HVQNQVDEVIDVMQENITKVIER | 76.92 |
| DP01498 | O70480 | Vesicle-associated membrane protein 4 (VAMP-4) | Mus musculus (Mouse) | 47 | 117 | 88 | 102 | 15 | SESLSDNATAFSNRS | 78.17 |
| DP01499 | Q9JI51 | Vesicle transport through interaction with t-SNAREs homolog 1A (Vesicle transport v-SNARE protein Vti1-like 2) (Vti1-rp2) | Rattus norvegicus (Rat) | 115 | 192 | 139 | 162 | 24 | LEAGYQIAVETEQIGQEMLENLSH | 77.76 |
| DP01499 | Q9JI51 | Vesicle transport through interaction with t-SNAREs homolog 1A (Vesicle transport v-SNARE protein Vti1-like 2) (Vti1-rp2) | Rattus norvegicus (Rat) | 115 | 192 | 177 | 187 | 11 | TDANLGKSSRI | 75.19 |
| DP01500 | Q5R6Q2 | Syntaxin-6 | Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) | 169 | 232 | 170 | 216 | 47 | DEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLD | 75.61 |
| DP01501 | G3V7P1 | Syntaxin-12 (Syntaxin-13) | Rattus norvegicus (Rat) | 182 | 250 | 184 | 210 | 27 | RETAIQQLEADILDVNQIFKDLAMMIH | 83.1 |
| DP01501 | G3V7P1 | Syntaxin-12 (Syntaxin-13) | Rattus norvegicus (Rat) | 182 | 250 | 212 | 233 | 22 | QGDLIDSIEANVESSEVHVERA | 79.81 |
| DP01501 | G3V7P1 | Syntaxin-12 (Syntaxin-13) | Rattus norvegicus (Rat) | 182 | 250 | 238 | 245 | 8 | QRAAYYQK | 90.84 |
| DP01502 | P33328 | Synaptobrevin homolog 2 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 91 | 24 | 50 | 27 | SQNKTAALRQEIDDTVGIMRDNINKVA | 78.74 |
| DP01502 | P33328 | Synaptobrevin homolog 2 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 91 | 64 | 74 | 11 | DNLAISAQGFK | 83.31 |
| DP01503 | P32867 | Protein SSO1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 192 | 265 | 197 | 233 | 37 | HQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDK | 80.73 |
| DP01504 | P39926 | Protein SSO2 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 196 | 269 | 201 | 237 | 37 | HQELLKLEKTMAELTQLFNDMEELVIEQQENVDVIDK | 79.92 |
| DP01504 | P39926 | Protein SSO2 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 196 | 269 | 249 | 260 | 12 | GVGHTNKAVKSA | 76.42 |
| DP01505 | P0AGB6 | ECF RNA polymerase sigma-E factor (RNA polymerase sigma-E factor) (Sigma-24) | Escherichia coli (strain K12) | 67 | 90 | 67 | 85 | 19 | DSAFYTWLYRIAVNTAKNY | 86.36 |
| DP01508 | Q15418 | Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) | Homo sapiens (Human) | 683 | 735 | 697 | 709 | 13 | AMAATYSALNSSK | 80.96 |
| DP01508 | Q15418 | Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) | Homo sapiens (Human) | 683 | 735 | 717 | 723 | 7 | IESSILA | 76.11 |
| DP01508 | Q15418 | Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) | Homo sapiens (Human) | 696 | 735 | 697 | 709 | 13 | AMAATYSALNSSK | 80.96 |
| DP01508 | Q15418 | Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) | Homo sapiens (Human) | 696 | 735 | 717 | 723 | 7 | IESSILA | 76.11 |
| DP01509 | P9WIP5 | Protein MbtH | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 71 | 9 | 33 | 25 | DNGAFFVLVNDEDQHSLWPVFADIP | 78.1 |
| DP01509 | P9WIP5 | Protein MbtH | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 71 | 46 | 59 | 14 | AACLDYVEKNWTDL | 79.62 |
| DP01511 | P32917 | Protein STE5 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 147 | 238 | 171 | 185 | 15 | SFLNASCTLCDEPIS | 75.83 |
| DP01511 | P32917 | Protein STE5 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 147 | 238 | 189 | 202 | 14 | KGEKIIELACGHLS | 79.38 |
| DP01511 | P32917 | Protein STE5 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 147 | 238 | 204 | 215 | 12 | QECLIISFGTTS | 81.58 |
| DP01511 | P32917 | Protein STE5 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 147 | 238 | 219 | 226 | 8 | VRALFPFC | 83.28 |
| DP01512 | P03050 | Transcriptional repressor arc | Salmonella phage P22 (Bacteriophage P22) | 1 | 53 | 8 | 14 | 7 | PQFNLRW | 74.58 |
| DP01512 | P03050 | Transcriptional repressor arc | Salmonella phage P22 (Bacteriophage P22) | 1 | 53 | 33 | 39 | 7 | VNSEIYQ | 91.3 |
| DP01513 | P53378 | Tubulin gamma chain (Gamma-tubulin) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 439 | 473 | 441 | 463 | 23 | EQDSYLDDVLVDDENMVGELEED | 76.79 |
| DP01516 | Q06810 | Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 194 | 333 | 195 | 206 | 12 | RASNILPIAYIP | 83.97 |
| DP01516 | Q06810 | Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 194 | 333 | 234 | 246 | 13 | IRSHITLGSSILD | 77.08 |
| DP01516 | Q06810 | Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 194 | 333 | 255 | 262 | 8 | HNQVLNKD | 77.05 |
| DP01516 | Q06810 | Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 194 | 333 | 264 | 273 | 10 | DDNLITAIRA | 81.47 |
| DP01516 | Q06810 | Protein OPY2 (Overproduction-induced pheromone-resistant protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 194 | 333 | 276 | 301 | 26 | KLVQIAEEESDKEIQDLDVIEEQTEA | 80.89 |
| DP01517 | Q06710 | Paired box protein Pax-8 | Homo sapiens (Human) | 1 | 27 | 16 | 22 | 7 | LGGAFVN | 80.41 |
| DP01517 | Q06710 | Paired box protein Pax-8 | Homo sapiens (Human) | 62 | 86 | 62 | 70 | 9 | LGRYYETGS | 84.62 |
| DP01518 | P26367 | Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) | Homo sapiens (Human) | 1 | 130 | 11 | 19 | 9 | LGGVFVNGR | 75.55 |
| DP01518 | P26367 | Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) | Homo sapiens (Human) | 1 | 130 | 25 | 35 | 11 | TRQKIVELAHS | 83.76 |
| DP01518 | P26367 | Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) | Homo sapiens (Human) | 1 | 130 | 41 | 67 | 27 | DISRILQVSNGCVSKILGRYYETGSIR | 81.95 |
| DP01518 | P26367 | Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) | Homo sapiens (Human) | 1 | 130 | 83 | 125 | 43 | VVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINR | 84.68 |
| DP01519 | A0A060ZAA1 | HTH_Tnp_Tc3_2 domain-containing protein | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) | 50 | 106 | 83 | 96 | 14 | TKVSISTVKRVLYR | 83.11 |
| DP01520 | Q02297 | Pro-neuregulin-1; membrane-bound isoform (Pro-NRG1) Cleaved into: Neuregulin-1 (Acetylcholine receptor-inducing activity) (ARIA) (Breast cancer cell differentiation factor p45) (Glial growth factor) (Heregulin) (HRG) (Neu differentiation factor) (Sensory and motor neuron-derived factor) | Homo sapiens (Human) | 1 | 75 | 50 | 56 | 7 | GLVGLAV | 74.58 |
| DP01521 | Q5RJL0 | Ermin (Juxtanodin) (JN) | Rattus norvegicus (Rat) | 1 | 282 | 37 | 44 | 8 | ETQTYYGV | 91.56 |
| DP01521 | Q5RJL0 | Ermin (Juxtanodin) (JN) | Rattus norvegicus (Rat) | 1 | 282 | 73 | 111 | 39 | EDEKILNENTEENLFVVHQAIQDLSLQETSAEDTVFQEG | 78.52 |
| DP01521 | Q5RJL0 | Ermin (Juxtanodin) (JN) | Rattus norvegicus (Rat) | 1 | 282 | 147 | 170 | 24 | AHQATEIEWLGFQKSSQVDILHSK | 78.11 |
| DP01521 | Q5RJL0 | Ermin (Juxtanodin) (JN) | Rattus norvegicus (Rat) | 1 | 282 | 174 | 186 | 13 | EEEVWNEEINEED | 84.82 |
| DP01521 | Q5RJL0 | Ermin (Juxtanodin) (JN) | Rattus norvegicus (Rat) | 1 | 282 | 198 | 205 | 8 | EVRVIEFK | 79.35 |
| DP01521 | Q5RJL0 | Ermin (Juxtanodin) (JN) | Rattus norvegicus (Rat) | 1 | 282 | 249 | 265 | 17 | ARNSYSRYNTISYRKIR | 82.33 |
| DP01524 | Q9UM11 | Fizzy-related protein homolog (Fzr) (CDC20-like protein 1) (Cdh1/Hct1 homolog) (hCDH1) | Homo sapiens (Human) | 1 | 41 | 9 | 21 | 13 | LLRQIVIQNENTM | 81.53 |
| DP01526 | Q9UJX6 | Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2) | Homo sapiens (Human) | 731 | 822 | 748 | 784 | 37 | EEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTG | 81.34 |
| DP01526 | Q9UJX6 | Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2) | Homo sapiens (Human) | 731 | 822 | 786 | 803 | 18 | ALAEIDLQELQGYLQKKV | 82.55 |
| DP01526 | Q9UJX6 | Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2) | Homo sapiens (Human) | 731 | 822 | 805 | 817 | 13 | DQQLVYSAGVYRL | 83.66 |
| DP01527 | Q57904 | Uncharacterized protein MJ0480 | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) | 46 | 101 | 60 | 69 | 10 | EIQEFQVKFK | 86.19 |
| DP01527 | Q57904 | Uncharacterized protein MJ0480 | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) | 46 | 101 | 84 | 96 | 13 | EQQRIMQLNAELM | 80.24 |
| DP01528 | P15273 | Tyrosine-protein phosphatase YopH (EC 3.1.3.48) (Virulence protein) | Yersinia enterocolitica | 20 | 50 | 29 | 45 | 17 | GNVAANKETTFQGLTIA | 80.88 |
| DP01531 | O75554 | WW domain-binding protein 4 (WBP-4) (Formin-binding protein 21) (WW domain-containing-binding protein 4) | Homo sapiens (Human) | 276 | 376 | 296 | 309 | 14 | EWQEIKQEVESHEE | 76.92 |
| DP01531 | O75554 | WW domain-binding protein 4 (WBP-4) (Formin-binding protein 21) (WW domain-containing-binding protein 4) | Homo sapiens (Human) | 276 | 376 | 317 | 326 | 10 | TENEYVSTSE | 79.67 |
| DP01531 | O75554 | WW domain-binding protein 4 (WBP-4) (Formin-binding protein 21) (WW domain-containing-binding protein 4) | Homo sapiens (Human) | 276 | 376 | 340 | 347 | 8 | KTVTSLGV | 77.26 |
| DP01533 | Q9NS23 | Ras association domain-containing protein 1 | Homo sapiens (Human) | 1 | 50 | 9 | 22 | 14 | FEMTWSSTTSSGYC | 74.39 |
| DP01533 | Q9NS23 | Ras association domain-containing protein 1 | Homo sapiens (Human) | 1 | 50 | 30 | 41 | 12 | ELEQYFTARTSL | 83.47 |
| DP01534 | Q07889 | Son of sevenless homolog 1 (SOS-1) | Homo sapiens (Human) | 1141 | 1300 | 1223 | 1230 | 8 | PDVFSSSP | 74.46 |
| DP01534 | Q07889 | Son of sevenless homolog 1 (SOS-1) | Homo sapiens (Human) | 1141 | 1300 | 1244 | 1251 | 8 | HGNAFFPN | 79.01 |
| DP01535 | B6KJB6 | Putative transmembrane protein | Toxoplasma gondii (strain ATCC 50861 / VEG) | 337 | 542 | 360 | 368 | 9 | GSTAFSTRP | 79.93 |
| DP01535 | B6KJB6 | Putative transmembrane protein | Toxoplasma gondii (strain ATCC 50861 / VEG) | 337 | 542 | 375 | 388 | 14 | LEGLTQETVEMLLD | 75.18 |
| DP01535 | B6KJB6 | Putative transmembrane protein | Toxoplasma gondii (strain ATCC 50861 / VEG) | 337 | 542 | 412 | 420 | 9 | SQHLEARLS | 73.91 |
| DP01535 | B6KJB6 | Putative transmembrane protein | Toxoplasma gondii (strain ATCC 50861 / VEG) | 337 | 542 | 459 | 465 | 7 | LASGYRN | 73.91 |
| DP01535 | B6KJB6 | Putative transmembrane protein | Toxoplasma gondii (strain ATCC 50861 / VEG) | 337 | 542 | 491 | 499 | 9 | SQHLEARLS | 73.91 |
| DP01537 | O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | Homo sapiens (Human) | 514 | 613 | 559 | 570 | 12 | TTGNWRGMLKTS | 74.58 |
| DP01537 | O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | Homo sapiens (Human) | 514 | 613 | 572 | 579 | 8 | AEELLAEE | 82.61 |
| DP01537 | O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | Homo sapiens (Human) | 514 | 613 | 595 | 602 | 8 | HAVNLLDV | 83.53 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 9 | 19 | 11 | AEQLENLNIQD | 80.15 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 22 | 43 | 22 | KQAATGSESQSVENSSASLYVG | 82.56 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 51 | 69 | 19 | EAHLYDIFSPIGSVSSIRV | 78.65 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 77 | 88 | 12 | TSLGYAYVNFND | 91.14 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 95 | 103 | 9 | AIEQLNYTP | 79.82 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 107 | 115 | 9 | RLCRIMWSQ | 77.26 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 124 | 133 | 10 | GSGNIFIKNL | 86.76 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 139 | 158 | 20 | NKALYDTFSVFGDILSSKIA | 82.66 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 166 | 199 | 34 | KGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA | 87.98 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 214 | 252 | 39 | TKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEK | 84.93 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 259 | 268 | 10 | KGFGFVNYEK | 78.09 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 275 | 291 | 17 | AVEALNDSELNGEKLYV | 84.38 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 307 | 330 | 24 | QYEAYRLEKMAKYQGVNLFVKNLD | 82.68 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 338 | 351 | 14 | LEEEFAPYGTITSA | 78.36 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 362 | 372 | 11 | KGFGFVCFSTP | 80.18 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 375 | 397 | 23 | ATKAITEKNQQIVAGKPLYVAIA | 84.5 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 407 | 438 | 32 | LAQQIQARNQMRYQQATAAAAAAAAGMPGQFM | 83.42 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 495 | 503 | 9 | NDNNQFYQQ | 84.17 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 526 | 537 | 12 | AAGKITGMILDL | 81.05 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 548 | 557 | 10 | SDELFEQHYK | 87.56 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 577 | 559 | 567 | 9 | ASAAYESFK | 82.76 |
| DP01538 | P04147 | Polyadenylate-binding protein; cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 419 | 502 | 419 | 438 | 20 | YQQATAAAAAAAAGMPGQFM | 85.95 |
| DP01539 | O57173 | Protein F1 | Vaccinia virus (strain Ankara) (VACV) | 1 | 50 | 1 | 37 | 37 | MLSMFMCNNIVDYVDGIVQDIEDEASNNVDHDYVYPL | 82.63 |
| DP01540 | O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | Homo sapiens (Human) | 503 | 610 | 504 | 515 | 12 | ACGLMNNNIEEQ | 76.25 |
| DP01540 | O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | Homo sapiens (Human) | 503 | 610 | 550 | 561 | 12 | AASAEADGKLIQ | 78.26 |
| DP01540 | O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | Homo sapiens (Human) | 503 | 610 | 585 | 596 | 12 | TTGNWRGMLKTS | 74.58 |
| DP01540 | O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | Homo sapiens (Human) | 503 | 610 | 598 | 605 | 8 | AEELLAEE | 82.61 |
| DP01541 | Q9DBZ9 | Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1) | Mus musculus (Mouse) | 1 | 267 | 68 | 78 | 11 | TRGAYLQSLEP | 76.04 |
| DP01541 | Q9DBZ9 | Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1) | Mus musculus (Mouse) | 1 | 267 | 107 | 115 | 9 | AGEIWYNPI | 78.26 |
| DP01541 | Q9DBZ9 | Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1) | Mus musculus (Mouse) | 1 | 267 | 130 | 136 | 7 | SQLASSE | 79.93 |
| DP01541 | Q9DBZ9 | Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1) | Mus musculus (Mouse) | 1 | 267 | 197 | 205 | 9 | AGSVISRYR | 79.93 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 47 | 60 | 14 | EVSAIPISLDGLLF | 77.64 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 76 | 88 | 13 | DQQSLSDVEGAYS | 83.35 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 111 | 120 | 10 | LDSVLDTLLA | 75.32 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 133 | 144 | 12 | ACEVTSSWCLFG | 80.27 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 192 | 199 | 8 | ARQLLLPA | 75.5 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 216 | 224 | 9 | AAAVEVEEE | 75.25 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 300 | 309 | 10 | VMDFIHVPIL | 78.7 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 312 | 330 | 19 | NHALLAARTRQLLEDESYD | 77.01 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 370 | 381 | 12 | KDDAYPLYSDFQ | 80.52 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 446 | 453 | 8 | ASVSSASS | 75.25 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 457 | 465 | 9 | TLECILYKA | 86.55 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 521 | 546 | 26 | PQLGYQAAVLKEGLPQVYPPYLNYLR | 77.08 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 1 | 566 | 555 | 561 | 7 | PQYSFES | 76.45 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 545 | 192 | 199 | 8 | ARQLLLPA | 75.5 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 545 | 216 | 224 | 9 | AAAVEVEEE | 75.25 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 545 | 300 | 309 | 10 | VMDFIHVPIL | 78.7 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 545 | 312 | 330 | 19 | NHALLAARTRQLLEDESYD | 77.01 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 545 | 370 | 381 | 12 | KDDAYPLYSDFQ | 80.52 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 545 | 446 | 453 | 8 | ASVSSASS | 75.25 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 545 | 457 | 465 | 9 | TLECILYKA | 86.55 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 545 | 521 | 540 | 20 | PQLGYQAAVLKEGLPQVYPP | 76.22 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 535 | 192 | 199 | 8 | ARQLLLPA | 75.5 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 535 | 216 | 224 | 9 | AAAVEVEEE | 75.25 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 535 | 300 | 309 | 10 | VMDFIHVPIL | 78.7 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 535 | 312 | 330 | 19 | NHALLAARTRQLLEDESYD | 77.01 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 535 | 370 | 381 | 12 | KDDAYPLYSDFQ | 80.52 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 535 | 446 | 453 | 8 | ASVSSASS | 75.25 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 535 | 457 | 465 | 9 | TLECILYKA | 86.55 |
| DP01542 | P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | Homo sapiens (Human) | 165 | 535 | 521 | 530 | 10 | PQLGYQAAVL | 75.25 |
| DP01544 | Q8WV28 | B-cell linker protein (B-cell adapter containing a SH2 domain protein) (B-cell adapter containing a Src homology 2 domain protein) (Cytoplasmic adapter protein) (Src homology 2 domain-containing leukocyte protein of 65 kDa) (SLP-65) | Homo sapiens (Human) | 5 | 50 | 28 | 37 | 10 | NEGGIMNKIK | 77.93 |
| DP01546 | P84051 | Histone H2A | Drosophila melanogaster (Fruit fly) | 94 | 124 | 105 | 117 | 13 | GGVLPNIQAVLLP | 79.52 |
| DP01547 | P29274 | Adenosine receptor A2a | Homo sapiens (Human) | 291 | 311 | 295 | 304 | 10 | FRQTFRKIIR | 79.43 |
| DP01547 | P29274 | Adenosine receptor A2a | Homo sapiens (Human) | 293 | 412 | 295 | 304 | 10 | FRQTFRKIIR | 79.43 |
| DP01547 | P29274 | Adenosine receptor A2a | Homo sapiens (Human) | 293 | 412 | 316 | 326 | 11 | AAGTSARVLAA | 75.59 |
| DP01547 | P29274 | Adenosine receptor A2a | Homo sapiens (Human) | 293 | 412 | 331 | 338 | 8 | GEQVSLRL | 75.25 |
| DP01547 | P29274 | Adenosine receptor A2a | Homo sapiens (Human) | 293 | 412 | 382 | 390 | 9 | DVELLSHEL | 75.03 |
| DP01547 | P29274 | Adenosine receptor A2a | Homo sapiens (Human) | 293 | 320 | 295 | 304 | 10 | FRQTFRKIIR | 79.43 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1020 | 1029 | 10 | HLSTSSVFHE | 77.63 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1046 | 1069 | 24 | GTVLTRSTFISNVLSKIGEVWASH | 81.74 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1073 | 1081 | 9 | NGVSLFNSP | 83.65 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1098 | 1116 | 19 | LPEAFVGTPISNTSQRISR | 78.1 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1129 | 1137 | 9 | SQCLEFIQQ | 81.57 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1144 | 1151 | 8 | LCLLSSSL | 80.27 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1168 | 1182 | 15 | SELLLLETPLIVKKA | 78.82 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1184 | 1199 | 16 | SLALSATSSGFAEFTP | 85.2 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1232 | 1238 | 7 | TRISFME | 77.93 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1242 | 1251 | 10 | NTHWTDRATD | 74.58 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1254 | 1263 | 10 | NTKAFVSTSF | 78.83 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1279 | 1287 | 9 | DKNTYFPLD | 76.44 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1295 | 1303 | 9 | KVVAESLAT | 79.93 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1324 | 1333 | 10 | SDQTSLEYHD | 78.26 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1354 | 1367 | 14 | STELTTNSTLQTER | 79.91 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1392 | 1401 | 10 | AAVEAFSELS | 79.93 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1409 | 1418 | 10 | AEASFAVSSV | 81.47 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1442 | 1449 | 8 | RTSILTAD | 76.88 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1453 | 1469 | 17 | SVANTVADVESSGSTSS | 81.45 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1480 | 1496 | 17 | GQKLTLNLKEDEIEAHV | 75.72 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1519 | 1547 | 29 | EIHLIGCENLEVQNSEEEAKNLSFDELYP | 81.39 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1551 | 1566 | 16 | EKLEYNLSTIEQQFCD | 83.05 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1581 | 1598 | 18 | VDGELFVAQSNFTLILEG | 81.42 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1660 | 1674 | 15 | VKVAIAENLLDVIKD | 79.75 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1692 | 1710 | 19 | DGAVIVSKAAHSSRLTNST | 79.97 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1720 | 1726 | 7 | ETVNTSQ | 75.97 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1740 | 1750 | 11 | QHALSLNVTSE | 76.35 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1868 | 1875 | 8 | GQSTEILD | 75.5 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1887 | 1915 | 29 | GTVTELRNANLEDTQNMEYKQDEHSDQQL | 77.51 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 1927 | 1935 | 9 | VSVSSVTEE | 74.58 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 2000 | 2008 | 9 | NVSTLEKSV | 74.58 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 2013 | 2022 | 10 | KEAALVVTSK | 77.59 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 2057 | 2068 | 12 | RDGLLAAAALTP | 76.14 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 2080 | 2087 | 8 | TMLLTDIS | 79.93 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 2116 | 2133 | 18 | AQLKELVSDLSSQFVVSP | 77.7 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 2139 | 2153 | 15 | RQKSISNTSKLLGEL | 79.4 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 2158 | 2165 | 8 | KPLEIIEQ | 79.81 |
| DP01548 | Q8CJF7 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Mus musculus (Mouse) | 1018 | 2243 | 2214 | 2223 | 10 | KTAEIAGKTL | 82.94 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1020 | 1029 | 10 | HLSTSSVFRL | 75.22 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1041 | 1069 | 29 | KQVVTGTVLTRSVFINNVLSKIGEVWASK | 79.78 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1076 | 1084 | 9 | TPFNSSKIE | 78.37 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1087 | 1095 | 9 | SPIVYSLPA | 80.45 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1098 | 1106 | 9 | LPEAFFGTP | 77.63 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1110 | 1118 | 9 | ASQKISRLL | 86.96 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1130 | 1150 | 21 | QCSEFIQQSSMKSPLYLVSRS | 76.03 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1170 | 1176 | 7 | LHLLETP | 74.58 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1186 | 1204 | 19 | AMSVTTSGFSEFTPQSILR | 81.17 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1229 | 1237 | 9 | TRISFVEED | 79.93 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1251 | 1258 | 8 | KLEVFTTP | 77.17 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1265 | 1272 | 8 | VETEWLKS | 75.59 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1276 | 1284 | 9 | TTSFFLNSP | 81.42 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1295 | 1302 | 8 | SQSLEKLD | 73.91 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1308 | 1323 | 16 | SSVSITSDETTLEYQD | 82.73 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1329 | 1339 | 11 | DLEETVFTASK | 79.08 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1344 | 1355 | 12 | STALTTNVTEQT | 77.09 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1361 | 1368 | 8 | KDVFASEV | 75.5 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1389 | 1402 | 14 | LVAAEAFSELNHLS | 83.76 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1404 | 1425 | 22 | VQGTEASLCAPSVYEGKIFTQK | 77.29 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1436 | 1446 | 11 | TSVETYTPAIR | 88.2 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1448 | 1473 | 26 | NDNKSMADVLGDGGNSSLTISEGPIV | 80.94 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1480 | 1488 | 9 | QEVALNLKE | 79.41 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1516 | 1530 | 15 | DTQEIHVIEQEKLEA | 79.69 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1537 | 1548 | 12 | ARNLSFNELYPS | 83.53 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1551 | 1568 | 18 | LKLQYNFDTIDQQFCDLA | 84.26 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1574 | 1598 | 25 | AECDIAEVDGELFVAQSNFTLILEG | 81 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1606 | 1612 | 7 | GDFASSD | 84.62 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1616 | 1630 | 15 | KAANTATEEKLVCSG | 79.93 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1634 | 1652 | 19 | NHGQIANLPSAVTSDQKSQ | 77.82 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1664 | 1678 | 15 | IKVAIAENLLDVIKD | 79.4 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1689 | 1698 | 10 | MEQSIHETIP | 78.33 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1700 | 1706 | 7 | VSQNIMC | 79.22 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1709 | 1723 | 15 | KLVKSAFKTAQETST | 79.22 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1732 | 1738 | 7 | DDVVSSK | 76.92 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1743 | 1764 | 22 | GQRIQNVNVKSAQQEASADVAT | 77.06 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1778 | 1793 | 16 | KAKEISEASENIYSDV | 87.33 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1799 | 1807 | 9 | NQQIPQNSV | 73.91 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1816 | 1838 | 23 | KEVNQDILENTSSVEQELQITTG | 77.55 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1846 | 1859 | 14 | SSQLLEPAVEETTK | 75.2 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1883 | 1899 | 17 | ESVEIINDLKVSTVTSP | 96.38 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 1950 | 1970 | 21 | EDSNLESSQLTVQAEFDMSAI | 80.57 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 2035 | 2044 | 10 | NEELSMVMSS | 80.27 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 2083 | 2093 | 11 | RLLATASFTKS | 76.31 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 2101 | 2109 | 9 | SSKAILLPD | 74.47 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 2138 | 2155 | 18 | AQLKELVSDLSSQFVISP | 81.74 |
| DP01549 | Q8WYP5 | Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1) | Homo sapiens (Human) | 1018 | 2266 | 2179 | 2186 | 8 | AQSVETLG | 75.96 |
| DP01554 | P23443 | Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (p70 S6K-alpha) (p70 S6KA) | Homo sapiens (Human) | 422 | 525 | 422 | 430 | 9 | VKEKFSFEP | 75.85 |
| DP01554 | P23443 | Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (p70 S6K-alpha) (p70 S6KA) | Homo sapiens (Human) | 422 | 525 | 454 | 467 | 14 | GDFWGRGASASTAN | 75.82 |
| DP01554 | P23443 | Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (p70 S6K-alpha) (p70 S6KA) | Homo sapiens (Human) | 422 | 525 | 484 | 494 | 11 | MDVTMSGEASA | 77.26 |
| DP01554 | P23443 | Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (p70 S6K-alpha) (p70 S6KA) | Homo sapiens (Human) | 422 | 525 | 507 | 515 | 9 | KKQAFPMIS | 77.93 |
| DP01555 | Q9EPU7 | Zinc finger protein 354C (Protein AJ18) | Rattus norvegicus (Rat) | 4 | 91 | 12 | 31 | 20 | EPVTFRDVAVSFSQDEWLHL | 77.91 |
| DP01555 | Q9EPU7 | Zinc finger protein 354C (Protein AJ18) | Rattus norvegicus (Rat) | 4 | 91 | 34 | 60 | 27 | AQRTLYREVMLENYSNLASLGFQASIP | 79.76 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 246 | 12 | 32 | 21 | EPVTFEDVTLGFTPEEWGLLD | 76.56 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 246 | 35 | 57 | 23 | QKSLYREVMLENYRNLVSVEHQL | 80.17 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 246 | 64 | 75 | 12 | SQLEEAEDFWPV | 75.75 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 246 | 104 | 120 | 17 | PLMNIEVVEVLTLNQEV | 79.97 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 246 | 125 | 140 | 16 | NAQIQALYAEDGSLSA | 82 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 246 | 186 | 192 | 7 | CHQWLQP | 76.78 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 246 | 197 | 214 | 18 | KEQILELLVLEQFLGALP | 80.43 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 246 | 216 | 224 | 9 | KLRTWVESQ | 75.92 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 246 | 231 | 241 | 11 | EVVALVEGVTW | 82.24 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 77 | 12 | 32 | 21 | EPVTFEDVTLGFTPEEWGLLD | 76.56 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 77 | 35 | 57 | 23 | QKSLYREVMLENYRNLVSVEHQL | 80.17 |
| DP01556 | Q96GC6 | Neurotrophin receptor-interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2) | Homo sapiens (Human) | 4 | 77 | 64 | 72 | 9 | SQLEEAEDF | 75.59 |
| DP01557 | P27682 | Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide | Rattus norvegicus (Rat) | 25 | 210 | 60 | 74 | 15 | AHQAMNLVGPQSIEG | 76.54 |
| DP01557 | P27682 | Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide | Rattus norvegicus (Rat) | 25 | 210 | 79 | 102 | 24 | GLQHLGPFGNIPNIVAELTGDNIP | 80.49 |
| DP01557 | P27682 | Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide | Rattus norvegicus (Rat) | 25 | 210 | 134 | 150 | 17 | DTAEFSREFQLDQHLFD | 82.41 |
| DP01557 | P27682 | Neuroendocrine protein 7B2 (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) Cleaved into: N-terminal peptide; C-terminal peptide | Rattus norvegicus (Rat) | 25 | 210 | 157 | 170 | 14 | GLGKWNKKLLYEKM | 78.4 |
| DP01558 | Q9XTY3 | C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2) | Caenorhabditis elegans | 17 | 211 | 19 | 41 | 23 | GLDLENAGDFVLPSGDFIDLISR | 76.24 |
| DP01558 | Q9XTY3 | C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2) | Caenorhabditis elegans | 17 | 211 | 48 | 58 | 11 | DLSSFGVKHIS | 80.27 |
| DP01558 | Q9XTY3 | C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2) | Caenorhabditis elegans | 17 | 211 | 64 | 78 | 15 | GEQKLLEEDNFQERQ | 76.45 |
| DP01558 | Q9XTY3 | C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2) | Caenorhabditis elegans | 17 | 211 | 105 | 128 | 24 | GCLEEFENSAEFSRNYQADQHCIC | 78.92 |
| DP01558 | Q9XTY3 | C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2) | Caenorhabditis elegans | 17 | 211 | 130 | 137 | 8 | QEHMFNCA | 77.17 |
| DP01558 | Q9XTY3 | C-terminal peptide (N-terminal peptide) (Neuroendocrine protein 7B2) | Caenorhabditis elegans | 17 | 211 | 142 | 167 | 26 | QDVSESLQKILEENNMHANTIAKKFH | 82.75 |
| DP01559 | Q04964 | Ribonucleotide reductase inhibitor protein SML1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 104 | 3 | 14 | 12 | NSQDYFYAQNRC | 81.86 |
| DP01559 | Q04964 | Ribonucleotide reductase inhibitor protein SML1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 104 | 27 | 34 | 8 | TMAEFRRV | 76.25 |
| DP01559 | Q04964 | Ribonucleotide reductase inhibitor protein SML1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 104 | 54 | 67 | 14 | SASASASSLEMWEK | 75.32 |
| DP01559 | Q04964 | Ribonucleotide reductase inhibitor protein SML1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 104 | 88 | 99 | 12 | GELKSMFNQGKV | 78.37 |
| DP01560 | Q9UMR2 | ATP-dependent RNA helicase DDX19B (EC 3.6.4.13) (DEAD box RNA helicase DEAD5) (DEAD box protein 19B) | Homo sapiens (Human) | 55 | 91 | 57 | 82 | 26 | AAQSLLNKLIRSNLVDNTNQVEVLQR | 77.49 |
| DP01561 | P08235 | Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) | Homo sapiens (Human) | 1 | 169 | 20 | 30 | 11 | GQVSQAVERSS | 75.25 |
| DP01561 | P08235 | Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) | Homo sapiens (Human) | 1 | 169 | 38 | 60 | 23 | DENNYMEIVNVSCVSGAIPNNST | 80.06 |
| DP01561 | P08235 | Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) | Homo sapiens (Human) | 1 | 169 | 82 | 110 | 29 | GILTSDIKTELESKELSATVAESMGLYMD | 81.59 |
| DP01561 | P08235 | Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) | Homo sapiens (Human) | 1 | 169 | 115 | 147 | 33 | ADYSYEQQNQQGSMSPAKIYQNVEQLVKFYKGN | 79.18 |
| DP01561 | P08235 | Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) | Homo sapiens (Human) | 1 | 169 | 155 | 164 | 10 | SCVNTPLRSF | 77.26 |
| DP01561 | P08235 | Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) | Homo sapiens (Human) | 247 | 385 | 268 | 274 | 7 | MKSSISS | 74.2 |
| DP01561 | P08235 | Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) | Homo sapiens (Human) | 247 | 385 | 299 | 307 | 9 | SPANINNSR | 79.82 |
| DP01561 | P08235 | Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) | Homo sapiens (Human) | 247 | 385 | 329 | 335 | 7 | TVGSICS | 80.27 |
| DP01561 | P08235 | Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2) | Homo sapiens (Human) | 247 | 385 | 337 | 355 | 19 | VNNAFSYTASGTSAGSSTL | 91.04 |
| DP01562 | Q9Z1X4 | Interleukin enhancer-binding factor 3 | Mus musculus (Mouse) | 468 | 518 | 499 | 506 | 8 | VEAVSNPS | 73.91 |
| DP01565 | Q9GSG7 | AAEL000395-PB (Ultraspiracle isoform-B) | Aedes aegypti (Yellowfever mosquito) (Culex aegypti) | 1 | 112 | 8 | 16 | 9 | FDAALVGHM | 79.93 |
| DP01565 | Q9GSG7 | AAEL000395-PB (Ultraspiracle isoform-B) | Aedes aegypti (Yellowfever mosquito) (Culex aegypti) | 1 | 112 | 31 | 43 | 13 | DISLLNGSVGPFS | 86.29 |
| DP01565 | Q9GSG7 | AAEL000395-PB (Ultraspiracle isoform-B) | Aedes aegypti (Yellowfever mosquito) (Culex aegypti) | 1 | 112 | 52 | 77 | 26 | SPGAFNQQVAAALQQQQQNVNSLNSQ | 77.18 |
| DP01567 | B9UCQ5 | Ultraspiracle isoform 1 | Helicoverpa armigera (Cotton bollworm) (Heliothis armigera) | 1 | 58 | 9 | 17 | 9 | GLNLEGGFM | 75.7 |
| DP01569 | P34021 | Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1) | Drosophila melanogaster (Fruit fly) | 2 | 226 | 17 | 31 | 15 | LPSHILLQQQLAASA | 76.63 |
| DP01569 | P34021 | Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1) | Drosophila melanogaster (Fruit fly) | 2 | 226 | 44 | 54 | 11 | SAALTLHVASA | 77.74 |
| DP01569 | P34021 | Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1) | Drosophila melanogaster (Fruit fly) | 2 | 226 | 96 | 111 | 16 | SSVATVVAPAATTTSN | 79.93 |
| DP01569 | P34021 | Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1) | Drosophila melanogaster (Fruit fly) | 2 | 226 | 140 | 149 | 10 | LDVTEDWMST | 76.32 |
| DP01569 | P34021 | Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1) | Drosophila melanogaster (Fruit fly) | 2 | 226 | 168 | 180 | 13 | SQNHSYNMSNGYA | 76.07 |
| DP01569 | P34021 | Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1) | Drosophila melanogaster (Fruit fly) | 2 | 226 | 184 | 192 | 9 | SAGSYDPYS | 80.27 |
| DP01569 | P34021 | Ecdysone receptor (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) (Ecdysteroid receptor) (Nuclear receptor subfamily 1 group H member 1) | Drosophila melanogaster (Fruit fly) | 2 | 226 | 207 | 217 | 11 | SLNGYSANESC | 75.68 |
| DP01570 | P12931 | Proto-oncogene tyrosine-protein kinase Src (EC 2.7.10.2) (Proto-oncogene c-Src) (pp60c-src) (p60-Src) | Homo sapiens (Human) | 1 | 84 | 28 | 36 | 9 | GGGAFPASQ | 75.92 |
| DP01570 | P12931 | Proto-oncogene tyrosine-protein kinase Src (EC 2.7.10.2) (Proto-oncogene c-Src) (pp60c-src) (p60-Src) | Homo sapiens (Human) | 1 | 84 | 50 | 57 | 8 | PSAAFAPA | 74.16 |
| DP01570 | P12931 | Proto-oncogene tyrosine-protein kinase Src (EC 2.7.10.2) (Proto-oncogene c-Src) (pp60c-src) (p60-Src) | Homo sapiens (Human) | 1 | 84 | 63 | 76 | 14 | LFGGFNSSDTVTSP | 76.42 |
| DP01571 | Q88QP8 | Elongation factor Tu-A (EF-Tu-A) | Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) | 40 | 62 | 40 | 51 | 12 | FGSAIVEFDKID | 84.7 |
| DP01574 | C6KSX0 | Merozoite surface protein P12 Cleaved into: Merozoite surface protein P12; processed form | Plasmodium falciparum (isolate 3D7) | 84 | 116 | 96 | 108 | 13 | KIKEFVIGSSMFM | 80.91 |
| DP01576 | O14777 | Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC) | Homo sapiens (Human) | 1 | 79 | 16 | 32 | 17 | MQELRSQDVNKQGLYTP | 82.47 |
| DP01576 | O14777 | Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC) | Homo sapiens (Human) | 1 | 79 | 39 | 46 | 8 | TFGKLSIN | 79.1 |
| DP01578 | P41969 | ETS domain-containing protein Elk-1 | Mus musculus (Mouse) | 320 | 429 | 376 | 387 | 12 | SIHFWSTLSPIA | 82.41 |
| DP01578 | P41969 | ETS domain-containing protein Elk-1 | Mus musculus (Mouse) | 320 | 429 | 392 | 401 | 10 | AKLSFQFPSS | 76.59 |
| DP01578 | P41969 | ETS domain-containing protein Elk-1 | Mus musculus (Mouse) | 320 | 429 | 404 | 421 | 18 | AQVHIPSISVDGLSTPVV | 79.04 |
| DP01578 | P41969 | ETS domain-containing protein Elk-1 | Mus musculus (Mouse) | 320 | 428 | 376 | 387 | 12 | SIHFWSTLSPIA | 82.41 |
| DP01578 | P41969 | ETS domain-containing protein Elk-1 | Mus musculus (Mouse) | 320 | 428 | 392 | 401 | 10 | AKLSFQFPSS | 76.59 |
| DP01578 | P41969 | ETS domain-containing protein Elk-1 | Mus musculus (Mouse) | 320 | 428 | 404 | 421 | 18 | AQVHIPSISVDGLSTPVV | 79.04 |
| DP01579 | P34233 | Transcriptional regulatory protein ASH1 (Daughter cells HO repressor protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 420 | 500 | 457 | 465 | 9 | NYHRFALDS | 77.26 |
| DP01579 | P34233 | Transcriptional regulatory protein ASH1 (Daughter cells HO repressor protein) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 420 | 500 | 474 | 480 | 7 | SNSSITK | 79.93 |
| DP01581 | Q8NQJ3 | Oxoglutarate dehydrogenase inhibitor | Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) | 1 | 40 | 10 | 31 | 22 | PQVETTSVFRADLLKEMESSTG | 76.95 |
| DP01582 | Q868N5 | Vitellogenin | Apis mellifera (Honeybee) | 336 | 385 | 340 | 357 | 18 | TAMNSNQIVSDNSLSSSE | 76.87 |
| DP01582 | Q868N5 | Vitellogenin | Apis mellifera (Honeybee) | 336 | 385 | 361 | 380 | 20 | KQDILNLRTDISSSSSSISS | 77.46 |
| DP01582 | Q868N5 | Vitellogenin | Apis mellifera (Honeybee) | 358 | 392 | 361 | 387 | 27 | KQDILNLRTDISSSSSSISSSEENDFW | 77.7 |
| DP01584 | P19880 | AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 565 | 650 | 571 | 579 | 9 | NADKINNGN | 76.37 |
| DP01584 | P19880 | AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 565 | 650 | 597 | 615 | 19 | RCSEIWDRITTHPKYSDID | 75.81 |
| DP01584 | P19880 | AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 565 | 650 | 632 | 645 | 14 | RGVVINAEDVQLAL | 82.11 |
| DP01588 | P52799 | Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L) | Homo sapiens (Human) | 253 | 300 | 266 | 273 | 8 | TLSLSTLA | 78.01 |
| DP01588 | P52799 | Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L) | Homo sapiens (Human) | 253 | 300 | 287 | 293 | 7 | SDIIIPL | 88.29 |
| DP01590 | Q92945 | Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75) | Homo sapiens (Human) | 130 | 218 | 145 | 151 | 7 | MTEEYRV | 79.93 |
| DP01590 | Q92945 | Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75) | Homo sapiens (Human) | 130 | 218 | 155 | 171 | 17 | MVGLIIGRGGEQINKIQ | 88.94 |
| DP01592 | Q8VHC5 | Calcium-binding protein 4 (CaBP4) | Mus musculus (Mouse) | 100 | 120 | 104 | 115 | 12 | AQRTYGPLLNRM | 87.29 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 96 | 235 | 113 | 144 | 32 | SHVLMNSGKLINGKRYFGRALELPEVKEWLKQ | 77.86 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 96 | 235 | 150 | 157 | 8 | DGGSINTK | 77.93 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 96 | 235 | 163 | 170 | 8 | RNDFYYHG | 78.14 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 96 | 235 | 173 | 192 | 20 | TAALTEFEANWTSILKAHYN | 78.58 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 96 | 235 | 205 | 211 | 7 | QTQEIHV | 79.93 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 96 | 235 | 216 | 223 | 8 | DMEHWLVQ | 79.35 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 97 | 235 | 113 | 144 | 32 | SHVLMNSGKLINGKRYFGRALELPEVKEWLKQ | 77.86 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 97 | 235 | 150 | 157 | 8 | DGGSINTK | 77.93 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 97 | 235 | 163 | 170 | 8 | RNDFYYHG | 78.14 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 97 | 235 | 173 | 192 | 20 | TAALTEFEANWTSILKAHYN | 78.58 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 97 | 235 | 205 | 211 | 7 | QTQEIHV | 79.93 |
| DP01593 | P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 97 | 235 | 216 | 223 | 8 | DMEHWLVQ | 79.35 |
| DP01594 | Q80ZV0 | Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B) | Mus musculus (Mouse) | 103 | 145 | 118 | 132 | 15 | VDDTFPDCTLLLRFP | 75.01 |
| DP01594 | Q80ZV0 | Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B) | Mus musculus (Mouse) | 182 | 266 | 187 | 218 | 32 | QSSAYFSGGQVSRDKEEDYVRYAHGLISDYIP | 79.08 |
| DP01594 | Q80ZV0 | Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B) | Mus musculus (Mouse) | 182 | 266 | 224 | 231 | 8 | DLSKFLKL | 85.28 |
| DP01594 | Q80ZV0 | Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B) | Mus musculus (Mouse) | 182 | 202 | 187 | 197 | 11 | QSSAYFSGGQV | 77.87 |
| DP01594 | Q80ZV0 | Ribonuclease H2 subunit B (RNase H2 subunit B) (Deleted in lymphocytic leukemia 8 homolog) (Ribonuclease HI subunit B) | Mus musculus (Mouse) | 283 | 308 | 293 | 302 | 10 | SIDAFFGAKN | 76.32 |
| DP01600 | Q93KQ4 | Regulatory protein YscM2 (YscM2) | Yersinia enterocolitica | 51 | 81 | 51 | 71 | 21 | YAVLEHAKNTILNRQDVAKLL | 77.69 |
| DP01601 | P26599 | Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) | Homo sapiens (Human) | 143 | 184 | 147 | 157 | 11 | AQAALQAVNSV | 83.67 |
| DP01601 | P26599 | Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) | Homo sapiens (Human) | 143 | 184 | 160 | 170 | 11 | GNLALAASAAA | 79.2 |
| DP01601 | P26599 | Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) | Homo sapiens (Human) | 411 | 458 | 442 | 451 | 10 | GSKNFQNIFP | 89.03 |
| DP01601 | P26599 | Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) | Homo sapiens (Human) | 431 | 454 | 442 | 449 | 8 | GSKNFQNI | 88.29 |
| DP01602 | Q86WV6 | Stimulator of interferon genes protein (hSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (hMITA) (Transmembrane protein 173) | Homo sapiens (Human) | 344 | 379 | 361 | 367 | 7 | PELLISG | 78.64 |
| DP01602 | Q86WV6 | Stimulator of interferon genes protein (hSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (hMITA) (Transmembrane protein 173) | Homo sapiens (Human) | 359 | 379 | 361 | 367 | 7 | PELLISG | 78.64 |
| DP01604 | Q12483 | Vacuolar-sorting protein SNF8 (ESCRT-II complex subunit VPS22) (Vacuolar protein-sorting-associated protein 22) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 22 | 5 | 17 | 13 | GLAAFDELKDGKY | 89.55 |
| DP01606 | Q06208 | Protein RIF2 (RAP1-interacting factor 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 152 | 186 | 160 | 180 | 21 | KECIESMGQASYSGQLDFEAS | 77.69 |
| DP01607 | P29539 | Telomere length regulator protein RIF1 (RAP1-interacting factor 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1773 | 1856 | 1799 | 1812 | 14 | MTENTNINAQNGLD | 78.21 |
| DP01607 | P29539 | Telomere length regulator protein RIF1 (RAP1-interacting factor 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1773 | 1856 | 1823 | 1836 | 14 | KHHEIQLGQAHTEA | 74.75 |
| DP01607 | P29539 | Telomere length regulator protein RIF1 (RAP1-interacting factor 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1773 | 1856 | 1844 | 1851 | 8 | GDGNEDAT | 73.58 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 1 | 11 | 11 | MEYWHYVETTS | 83.31 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 22 | 40 | 19 | KDIFIDQSVGLYHGKSKIL | 80.88 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 44 | 59 | 16 | RGRIFLTSQRIIYIDD | 87.96 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 66 | 96 | 31 | SLGLELDDLAYVNYSSGFLTRSPRLILFFKD | 79.72 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 112 | 136 | 25 | ADVVSTWVCPICMVSNETQGEFTKD | 81.61 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 140 | 147 | 8 | TPICINCG | 76.25 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 150 | 166 | 17 | ADYELTKSSINCSNAID | 77.89 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 175 | 192 | 18 | FGVNSENICPACTFANHP | 82 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 195 | 201 | 7 | GNCEICG | 84.95 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 215 | 236 | 22 | NRLNFHDSRVHIELEKNSLARN | 77.42 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 251 | 261 | 11 | SSTEFVQLSFR | 81.12 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 264 | 298 | 35 | DGVLFSQATERALENILTEKNKHIFNQNVVSVNGV | 80.11 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 305 | 329 | 25 | SSHEYNNEVPFIETKLSRIGISSLE | 76.55 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 333 | 371 | 39 | ENQLLNNDILFNNALTDLNKLMSLATSIERLYKNSNITM | 78.47 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 395 | 374 | 386 | 13 | KTLNLQDESTVNE | 74.68 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 177 | 205 | 178 | 192 | 15 | NSENICPACTFANHP | 83.21 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 203 | 395 | 215 | 236 | 22 | NRLNFHDSRVHIELEKNSLARN | 77.42 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 203 | 395 | 251 | 261 | 11 | SSTEFVQLSFR | 81.12 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 203 | 395 | 264 | 298 | 35 | DGVLFSQATERALENILTEKNKHIFNQNVVSVNGV | 80.11 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 203 | 395 | 305 | 329 | 25 | SSHEYNNEVPFIETKLSRIGISSLE | 76.55 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 203 | 395 | 333 | 371 | 39 | ENQLLNNDILFNNALTDLNKLMSLATSIERLYKNSNITM | 78.47 |
| DP01611 | Q06696 | Vacuolar protein-sorting-associated protein 36 (ESCRT-II complex subunit VPS36) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 203 | 395 | 374 | 386 | 13 | KTLNLQDESTVNE | 74.68 |
| DP01613 | Q96AC1 | Fermitin family homolog 2 (Kindlin-2) (Mitogen-inducible gene 2 protein) (MIG-2) (Pleckstrin homology domain-containing family C member 1) (PH domain-containing family C member 1) | Homo sapiens (Human) | 328 | 367 | 332 | 340 | 9 | SENHLNNSD | 78.15 |
| DP01613 | Q96AC1 | Fermitin family homolog 2 (Kindlin-2) (Mitogen-inducible gene 2 protein) (MIG-2) (Pleckstrin homology domain-containing family C member 1) (PH domain-containing family C member 1) | Homo sapiens (Human) | 328 | 367 | 346 | 359 | 14 | VDAALSDLEITLEG | 76.02 |
| DP01616 | P10104 | Fibritin (Collar protein) (Whisker antigen control protein) | Enterobacteria phage T4 (Bacteriophage T4) | 372 | 484 | 374 | 391 | 18 | GLNNAVQNLQVEIGNNSA | 77.37 |
| DP01616 | P10104 | Fibritin (Collar protein) (Whisker antigen control protein) | Enterobacteria phage T4 (Bacteriophage T4) | 372 | 484 | 395 | 408 | 14 | GQVVALNTLVNGTN | 80.22 |
| DP01616 | P10104 | Fibritin (Collar protein) (Whisker antigen control protein) | Enterobacteria phage T4 (Bacteriophage T4) | 372 | 484 | 419 | 448 | 30 | LTNSIKANETNIASVTQEVNTAKGNISSLQ | 79.02 |
| DP01616 | P10104 | Fibritin (Collar protein) (Whisker antigen control protein) | Enterobacteria phage T4 (Bacteriophage T4) | 372 | 484 | 450 | 461 | 12 | DVQALQEAGYIP | 79.38 |
| DP01616 | P10104 | Fibritin (Collar protein) (Whisker antigen control protein) | Enterobacteria phage T4 (Bacteriophage T4) | 372 | 484 | 466 | 479 | 14 | DGQAYVRKDGEWVF | 87.48 |
| DP01618 | P03070 | Large T antigen (LT) (LT-AG) (EC 3.6.4.-) | Simian virus 40 (SV40) | 82 | 130 | 82 | 109 | 28 | EIPTYGTDEWEQWWNAFNEENLFCSEEM | 79.61 |
| DP01621 | E5LC01 | LANA | "Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)" | 1065 | 1117 | 1073 | 1080 | 8 | ARLAWEAS | 79.31 |
| DP01621 | E5LC01 | LANA | "Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)" | 1065 | 1117 | 1083 | 1095 | 13 | LAGNLQSSIVKFK | 85.34 |
| DP01622 | Q06609 | DNA repair protein RAD51 homolog 1 (HsRAD51) (hRAD51) (RAD51 homolog A) | Homo sapiens (Human) | 86 | 114 | 95 | 105 | 11 | RRSEIIQITTG | 79.75 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 10 | 21 | 12 | KTAHFENGSTSS | 74.41 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 26 | 38 | 13 | KQSSLLSFFSKQV | 77.72 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 54 | 65 | 12 | TLENTATDKITK | 77.76 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 72 | 79 | 8 | TGKLFVDV | 80.94 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 83 | 100 | 18 | NDLTIAEETVSTVRSDIM | 79.34 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 109 | 117 | 9 | TMLNSNTTE | 77.15 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 150 | 156 | 7 | SDTTFTA | 80.27 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 169 | 175 | 7 | DEDEYLP | 75.92 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 204 | 215 | 12 | DDDLISLAETTS | 78.79 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 217 | 227 | 11 | KKFSYNTSHSS | 77.14 |
| DP01623 | Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 304 | 265 | 282 | 18 | KSSKFNKQNEERYQWLVD | 80.92 |
| DP01624 | Q06433 | Galactose/lactose metabolism regulatory protein GAL80 | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) | 328 | 362 | 339 | 345 | 7 | GAAAIKD | 86.96 |
| DP01626 | Q01831 | DNA repair protein complementing XP-C cells (Xeroderma pigmentosum group C-complementing protein) (p125) | Homo sapiens (Human) | 815 | 940 | 818 | 834 | 17 | KDVLLTAWENEQAVIER | 80.68 |
| DP01626 | Q01831 | DNA repair protein complementing XP-C cells (Xeroderma pigmentosum group C-complementing protein) (p125) | Homo sapiens (Human) | 815 | 940 | 844 | 859 | 16 | ALGNWKLLAKGLLIRE | 78.43 |
| DP01626 | Q01831 | DNA repair protein complementing XP-C cells (Xeroderma pigmentosum group C-complementing protein) (p125) | Homo sapiens (Human) | 815 | 940 | 895 | 906 | 12 | EAARILAASWPQ | 79.65 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 100 | 7 | 20 | 14 | KEYFELIRKALNEK | 91.38 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 100 | 49 | 55 | 7 | TGLNELP | 74.58 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 100 | 57 | 66 | 10 | ESVVTVNLDS | 80.5 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 100 | 69 | 75 | 7 | DGVVTVP | 75.92 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 100 | 79 | 95 | 17 | SVEEIQSSEEDYDSEEF | 82.77 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 633 | 754 | 645 | 657 | 13 | ALESWNTLLLKLR | 78.21 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 633 | 754 | 661 | 673 | 13 | KLNSTYGKIAEEE | 85.95 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 633 | 754 | 678 | 706 | 29 | KEQNIADNHDNTETFMGGGFLPGIANHEA | 90.37 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 633 | 754 | 717 | 724 | 8 | DSLDYVSV | 76.42 |
| DP01628 | P14736 | DNA repair protein RAD4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 633 | 754 | 736 | 749 | 14 | VGEDYSDFMKELEM | 76.54 |
| DP01629 | P32628 | UV excision repair protein RAD23 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 265 | 219 | 234 | 16 | EDDLFAQAAQGGNASS | 75.96 |
| DP01629 | P32628 | UV excision repair protein RAD23 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 265 | 236 | 245 | 10 | ALGTTGGATD | 74.58 |
| DP01629 | P32628 | UV excision repair protein RAD23 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 185 | 265 | 254 | 260 | 7 | SIGLTVE | 80.51 |
| DP01629 | P32628 | UV excision repair protein RAD23 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 230 | 254 | 236 | 245 | 10 | ALGTTGGATD | 74.58 |
| DP01631 | P07276 | DNA repair protein RAD2 (EC 3.1.-.-) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 642 | 760 | 662 | 673 | 12 | LEVLSEELFEDV | 84.56 |
| DP01631 | P07276 | DNA repair protein RAD2 (EC 3.1.-.-) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 642 | 760 | 700 | 739 | 40 | KPLIFDYDFSEDEEDNIVENMIKEQEEFDTFKNTTLSTSA | 78.78 |
| DP01631 | P07276 | DNA repair protein RAD2 (EC 3.1.-.-) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 642 | 760 | 741 | 755 | 15 | RNVAENAFVEDELFE | 83.03 |
| DP01631 | P07276 | DNA repair protein RAD2 (EC 3.1.-.-) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 642 | 690 | 662 | 673 | 12 | LEVLSEELFEDV | 84.56 |
| DP01637 | Q8NI22 | Multiple coagulation factor deficiency protein 2 (Neural stem cell-derived neuronal survival protein) | Homo sapiens (Human) | 27 | 66 | 29 | 35 | 7 | PAASFSQ | 79.41 |
| DP01637 | Q8NI22 | Multiple coagulation factor deficiency protein 2 (Neural stem cell-derived neuronal survival protein) | Homo sapiens (Human) | 27 | 66 | 48 | 61 | 14 | DQEHIMEHLEGVIN | 88.82 |
| DP01639 | P17778 | Outer membrane protein YopM | Yersinia pestis | 1 | 33 | 7 | 15 | 9 | NVSNTFLQE | 78.97 |
| DP01639 | P17778 | Outer membrane protein YopM | Yersinia pestis | 1 | 33 | 19 | 26 | 8 | HSSNLTEM | 73.91 |
| DP01640 | Q13351 | Krueppel-like factor 1 (Erythroid krueppel-like transcription factor) (EKLF) | Homo sapiens (Human) | 51 | 90 | 69 | 84 | 16 | ADATWDLDLLLTNFSG | 81.02 |
| DP01642 | P06492 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) | 350 | 394 | 369 | 382 | 14 | TKNNYGSTIEGLLD | 80.27 |
| DP01642 | P06492 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) | 403 | 490 | 416 | 427 | 12 | TDVSLGDELHLD | 74.94 |
| DP01642 | P06492 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) | 403 | 490 | 471 | 485 | 15 | ADFEFEQMFTDALGI | 77.86 |
| DP01642 | P06492 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) | 412 | 490 | 416 | 427 | 12 | TDVSLGDELHLD | 74.94 |
| DP01642 | P06492 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) | 412 | 490 | 471 | 485 | 15 | ADFEFEQMFTDALGI | 77.86 |
| DP01642 | P06492 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) | 452 | 490 | 471 | 485 | 15 | ADFEFEQMFTDALGI | 77.86 |
| DP01642 | P06492 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) | 456 | 490 | 471 | 485 | 15 | ADFEFEQMFTDALGI | 77.86 |
| DP01645 | P20239 | Zona pellucida sperm-binding protein 2 (Zona pellucida glycoprotein 2) (Zp-2) (Zona pellucida protein A) Cleaved into: Processed zona pellucida sperm-binding protein 2 | Mus musculus (Mouse) | 563 | 584 | 563 | 570 | 8 | LDNYRTTF | 74.41 |
| DP01647 | P51449 | Nuclear receptor ROR-gamma (Nuclear receptor RZR-gamma) (Nuclear receptor subfamily 1 group F member 3) (RAR-related orphan receptor C) (Retinoid-related orphan receptor-gamma) | Homo sapiens (Human) | 479 | 518 | 482 | 512 | 31 | RLQIFQHLHPIVVQAAFPPLYKELFSTETES | 86.63 |
| DP01654 | P36578 | 60S ribosomal protein L4 (60S ribosomal protein L1) (Large ribosomal subunit protein uL4) | Homo sapiens (Human) | 80 | 114 | 88 | 96 | 9 | GQGAFGNMC | 80.16 |
| DP01657 | Q5XJY5 | Coatomer subunit delta (Archain) (Delta-coat protein) (Delta-COP) | Mus musculus (Mouse) | 166 | 232 | 182 | 190 | 9 | GFGGFGSSA | 75.92 |
| DP01657 | Q5XJY5 | Coatomer subunit delta (Archain) (Delta-coat protein) (Delta-COP) | Mus musculus (Mouse) | 166 | 232 | 196 | 208 | 13 | TAAMITETIIETD | 80.29 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 99 | 1 | 13 | 13 | MALLSEELSSILP | 81.22 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 99 | 20 | 28 | 9 | EEEDYVERE | 75.25 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 99 | 37 | 43 | 7 | IGVKFHI | 79.93 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 99 | 65 | 77 | 13 | AFPEIHVAQYPLD | 75.25 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 99 | 86 | 94 | 9 | SAGNTLALQ | 78.78 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 100 | 315 | 102 | 109 | 8 | DYNAIARQ | 91.97 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 100 | 315 | 116 | 126 | 11 | LVQASFRDLIP | 80.27 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 100 | 315 | 132 | 138 | 7 | GVGEISL | 77.78 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 100 | 315 | 156 | 168 | 13 | ALQKILSKQIAQS | 78.47 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 100 | 315 | 180 | 188 | 9 | DPVYIRYTP | 85.95 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 100 | 315 | 192 | 205 | 14 | MGQALSKQRIIKMV | 82.04 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 100 | 315 | 254 | 260 | 7 | SISNWKN | 84.62 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 100 | 315 | 280 | 301 | 22 | NDVEINDGFAKFSEALYTVERQ | 90.57 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 100 | 315 | 304 | 310 | 7 | EEVRYRA | 80.32 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 316 | 557 | 325 | 333 | 9 | EQRLFMLAQ | 78.52 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 316 | 557 | 368 | 376 | 9 | RAGSFSHHS | 77.26 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 316 | 557 | 443 | 457 | 15 | SDTMIDSRLFNQASG | 76.45 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 316 | 557 | 464 | 473 | 10 | DEDSYNVYDK | 85.52 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 316 | 557 | 499 | 514 | 16 | ELERITSESRYDVLGN | 77.34 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 316 | 557 | 531 | 540 | 10 | GPVTFEKDIA | 85.62 |
| DP01658 | Q09882 | Pre-mRNA-processing protein 45 (Complexed with cdc5 protein 13) (Transcriptional coregulator snw1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 316 | 557 | 544 | 552 | 9 | GVDTFLNNV | 79.19 |
| DP01661 | P70444 | BH3-interacting domain death agonist (p22 BID) (BID) Cleaved into: BH3-interacting domain death agonist p15 (p15 BID); BH3-interacting domain death agonist p13 (p13 BID); BH3-interacting domain death agonist p11 (p11 BID) | Mus musculus (Mouse) | 41 | 81 | 43 | 51 | 9 | PVQAYWEAD | 79.26 |
| DP01661 | P70444 | BH3-interacting domain death agonist (p22 BID) (BID) Cleaved into: BH3-interacting domain death agonist p15 (p15 BID); BH3-interacting domain death agonist p13 (p13 BID); BH3-interacting domain death agonist p11 (p11 BID) | Mus musculus (Mouse) | 41 | 81 | 63 | 73 | 11 | ASRSFNQGRIE | 78.72 |
| DP01664 | Q9I9C0 | Prion protein | Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta) | 25 | 142 | 112 | 118 | 7 | GGTNFKN | 77.26 |
| DP01665 | Q5S1W7 | Prion protein (Fragment) | Xenopus laevis (African clawed frog) | 1 | 69 | 11 | 24 | 14 | GGWNTGSNRNPNYP | 80.94 |
| DP01665 | Q5S1W7 | Prion protein (Fragment) | Xenopus laevis (African clawed frog) | 1 | 69 | 36 | 46 | 11 | GQQPYNPSGYN | 87.29 |
| DP01667 | Q548Y4 | Nuclear transcription factor RelA (V-rel reticuloendotheliosis viral oncogene homolog A (Avian)) | Mus musculus (Mouse) | 426 | 490 | 437 | 445 | 9 | ALLHLQFDA | 77.07 |
| DP01667 | Q548Y4 | Nuclear transcription factor RelA (V-rel reticuloendotheliosis viral oncogene homolog A (Avian)) | Mus musculus (Mouse) | 426 | 490 | 450 | 457 | 8 | GALLGNST | 76.17 |
| DP01667 | Q548Y4 | Nuclear transcription factor RelA (V-rel reticuloendotheliosis viral oncogene homolog A (Avian)) | Mus musculus (Mouse) | 426 | 490 | 463 | 484 | 22 | TDLASVDNSEFQQLLNQGVSMS | 78.09 |
| DP01671 | P71590 | FHA domain-containing protein FhaA | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 32 | 19 | 27 | 9 | VGDAFARIF | 82.65 |
| DP01675 | O75928 | E3 SUMO-protein ligase PIAS2 (EC 2.3.2.-) (Androgen receptor-interacting protein 3) (ARIP3) (DAB2-interacting protein) (DIP) (E3 SUMO-protein transferase PIAS2) (Msx-interacting zinc finger protein) (Miz1) (PIAS-NY protein) (Protein inhibitor of activated STAT x) (Protein inhibitor of activated STAT2) | Homo sapiens (Human) | 427 | 488 | 456 | 462 | 7 | VTVASEA | 77.26 |
| DP01675 | O75928 | E3 SUMO-protein ligase PIAS2 (EC 2.3.2.-) (Androgen receptor-interacting protein 3) (ARIP3) (DAB2-interacting protein) (DIP) (E3 SUMO-protein transferase PIAS2) (Msx-interacting zinc finger protein) (Miz1) (PIAS-NY protein) (Protein inhibitor of activated STAT x) (Protein inhibitor of activated STAT2) | Homo sapiens (Human) | 427 | 488 | 466 | 481 | 16 | KVDVIDLTIESSSDEE | 87.1 |
| DP01677 | P06454 | Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1 | Homo sapiens (Human) | 1 | 111 | 8 | 15 | 8 | TSSEITTK | 74.79 |
| DP01677 | P06454 | Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1 | Homo sapiens (Human) | 1 | 111 | 22 | 29 | 8 | EVVEEAEN | 75.92 |
| DP01677 | P06454 | Prothymosin alpha Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha-1 | Homo sapiens (Human) | 1 | 111 | 36 | 44 | 9 | NGNAENEEN | 75.51 |
| DP01705 | Q07666 | KH domain-containing; RNA-binding; signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68) | Homo sapiens (Human) | 135 | 156 | 141 | 151 | 11 | DEENYLDLFSH | 84.98 |
| DP01705 | Q07666 | KH domain-containing; RNA-binding; signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68) | Homo sapiens (Human) | 390 | 419 | 392 | 400 | 9 | GDSEYYDYG | 80.3 |
| DP01705 | Q07666 | KH domain-containing; RNA-binding; signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68) | Homo sapiens (Human) | 390 | 419 | 404 | 414 | 11 | VQDSYEAYGQD | 85.8 |
| DP01716 | P0AD49 | Ribosome-associated inhibitor A | Escherichia coli (strain K12) | 91 | 113 | 102 | 108 | 7 | KDANFVE | 86.77 |
| DP01724 | O95644 | Nuclear factor of activated T-cells; cytoplasmic 1 (NF-ATc1) (NFATc1) (NFAT transcription complex cytosolic component) (NF-ATc) (NFATc) | Homo sapiens (Human) | 435 | 458 | 438 | 446 | 9 | HRAHYETEG | 75.92 |
| DP01731 | O75143 | Autophagy-related protein 13 | Homo sapiens (Human) | 384 | 517 | 384 | 398 | 15 | QVTLTSLDIPFAMFA | 77.39 |
| DP01731 | O75143 | Autophagy-related protein 13 | Homo sapiens (Human) | 384 | 517 | 443 | 450 | 8 | DFVMIDFK | 91.97 |
| DP01731 | O75143 | Autophagy-related protein 13 | Homo sapiens (Human) | 384 | 517 | 462 | 471 | 10 | DLGTFYREFQ | 79.77 |
| DP01731 | O75143 | Autophagy-related protein 13 | Homo sapiens (Human) | 384 | 517 | 476 | 489 | 14 | LSSLSIDIGAQSMA | 79.5 |
| DP01731 | O75143 | Autophagy-related protein 13 | Homo sapiens (Human) | 384 | 517 | 505 | 512 | 8 | NVREFDAF | 81.1 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 270 | 276 | 7 | NDELFSA | 78.93 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 329 | 340 | 12 | HQVQTQQQRQIP | 77.26 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 352 | 358 | 7 | RANSFEP | 79.93 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 390 | 398 | 9 | SNSSFFNQP | 79.08 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 405 | 420 | 16 | MSSNYGPQMNIEGTSV | 79.14 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 422 | 434 | 13 | STSKYSSSFGNIR | 83.53 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 467 | 474 | 8 | DFVKLLEE | 80.6 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 487 | 504 | 18 | NPPNINISDSLIRYQNLK | 80.01 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 507 | 518 | 12 | NDLLSEDLSVSL | 79.63 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 545 | 552 | 8 | HYGSLNSR | 73.91 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 558 | 564 | 7 | NASHLIA | 85.52 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 571 | 578 | 8 | STSALNSR | 75.59 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 607 | 622 | 16 | HDNKIQKYNQLGVEED | 93.48 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 627 | 646 | 20 | NDRLLNQMGNSATKFKSSIS | 78.73 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 649 | 661 | 13 | SIDSISSSFIKSR | 79.29 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 696 | 706 | 11 | NRSNSNNNNHN | 74.25 |
| DP01732 | Q06628 | Autophagy-related protein 13 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 268 | 738 | 723 | 733 | 11 | DDLVFFMSDMN | 80.3 |
| DP01737 | P9WKX3 | Bacterial proteasome activator | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 35 | 2 | 9 | 8 | VIGLSTGS | 79.93 |
| DP01737 | P9WKX3 | Bacterial proteasome activator | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 35 | 13 | 19 | 7 | DVEVIGG | 74.87 |
| DP01737 | P9WKX3 | Bacterial proteasome activator | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 35 | 21 | 30 | 10 | DPRLIAVQEN | 74.85 |
| DP01737 | P9WKX3 | Bacterial proteasome activator | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 14 | 35 | 21 | 30 | 10 | DPRLIAVQEN | 74.85 |
| DP01742 | Q8NM20 | Uncharacterized protein | Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) | 52 | 89 | 60 | 70 | 11 | AAVSEAEQIRQ | 77.38 |
| DP01744 | Q07528 | Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 5 | 17 | 13 | NDVQENAKLNSET | 76.25 |
| DP01744 | Q07528 | Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 28 | 40 | 13 | GTTEYVAEAEISK | 85.21 |
| DP01744 | Q07528 | Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 66 | 80 | 15 | ELVHTALLEKDNPFM | 76.23 |
| DP01744 | Q07528 | Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 90 | 96 | 7 | SALLEIP | 86.1 |
| DP01744 | Q07528 | Autophagy-related protein 20 (Cytoplasm to vacuole targeting protein 20) (Sorting nexin-42) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 133 | 146 | 14 | LSGSINSMNGETSA | 77.69 |
| DP01748 | P05556 | Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29) | Homo sapiens (Human) | 752 | 798 | 752 | 767 | 16 | KLLMIIHDRREFAKFE | 85.31 |
| DP01748 | P05556 | Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29) | Homo sapiens (Human) | 752 | 798 | 778 | 793 | 16 | GENPIYKSAVTTVVNP | 82.15 |
| DP01748 | P05556 | Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29) | Homo sapiens (Human) | 752 | 795 | 752 | 767 | 16 | KLLMIIHDRREFAKFE | 85.31 |
| DP01748 | P05556 | Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29) | Homo sapiens (Human) | 752 | 795 | 778 | 790 | 13 | GENPIYKSAVTTV | 81.27 |
| DP01750 | P62877 | E3 ubiquitin-protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin-protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING-box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) Cleaved into: E3 ubiquitin-protein ligase RBX1; N-terminally processed (E3 ubiquitin-protein transferase RBX1; N-terminally processed) | Homo sapiens (Human) | 12 | 39 | 28 | 34 | 7 | NAVALWA | 88.01 |
| DP01751 | O43172 | U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4) | Homo sapiens (Human) | 1 | 169 | 27 | 37 | 11 | KPHIYYGSLEE | 76.47 |
| DP01751 | O43172 | U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4) | Homo sapiens (Human) | 1 | 169 | 57 | 80 | 24 | KAGIEAGNINITSGEVFEIEEHIS | 84.28 |
| DP01751 | O43172 | U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4) | Homo sapiens (Human) | 1 | 169 | 83 | 91 | 9 | QAEVLAEFE | 83.09 |
| DP01751 | O43172 | U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4) | Homo sapiens (Human) | 1 | 169 | 95 | 104 | 10 | RARQINVSTD | 74.98 |
| DP01751 | O43172 | U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4) | Homo sapiens (Human) | 1 | 169 | 132 | 143 | 12 | RLRNILSVVGTD | 75.45 |
| DP01751 | O43172 | U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4) | Homo sapiens (Human) | 1 | 169 | 158 | 164 | 7 | SKEEYQQ | 80.22 |
| DP01752 | Q60598 | Src substrate cortactin | Mus musculus (Mouse) | 83 | 324 | 84 | 92 | 9 | YGGKFGVEQ | 75.25 |
| DP01752 | Q60598 | Src substrate cortactin | Mus musculus (Mouse) | 83 | 324 | 100 | 109 | 10 | VGHEYQSKLS | 78.19 |
| DP01752 | Q60598 | Src substrate cortactin | Mus musculus (Mouse) | 83 | 324 | 135 | 146 | 12 | SAVGFEYQGKTE | 77.7 |
| DP01752 | Q60598 | Src substrate cortactin | Mus musculus (Mouse) | 83 | 324 | 172 | 183 | 12 | SAVGFDYQGKTE | 80.27 |
| DP01752 | Q60598 | Src substrate cortactin | Mus musculus (Mouse) | 83 | 324 | 195 | 202 | 8 | FGGKYGID | 76.59 |
| DP01752 | Q60598 | Src substrate cortactin | Mus musculus (Mouse) | 83 | 324 | 209 | 220 | 12 | SAVGFEYQGKTE | 77.7 |
| DP01752 | Q60598 | Src substrate cortactin | Mus musculus (Mouse) | 83 | 324 | 232 | 241 | 10 | FGGKFGVQTD | 74.25 |
| DP01752 | Q60598 | Src substrate cortactin | Mus musculus (Mouse) | 83 | 324 | 252 | 261 | 10 | HQEKLQLHES | 75.12 |
| DP01752 | Q60598 | Src substrate cortactin | Mus musculus (Mouse) | 83 | 324 | 283 | 290 | 8 | SAVGFDYK | 77.01 |
| DP01754 | Q8BHZ5 | Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog) | Mus musculus (Mouse) | 1 | 157 | 36 | 43 | 8 | QTAAWAQR | 80.27 |
| DP01754 | Q8BHZ5 | Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog) | Mus musculus (Mouse) | 1 | 157 | 53 | 75 | 23 | TETVYCMNEAEMVDVALGILIEG | 78.86 |
| DP01754 | Q8BHZ5 | Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog) | Mus musculus (Mouse) | 1 | 157 | 86 | 97 | 12 | SLEATDKLQLSP | 75.25 |
| DP01754 | Q8BHZ5 | Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog) | Mus musculus (Mouse) | 1 | 157 | 110 | 118 | 9 | EDSRISSLA | 77.26 |
| DP01754 | Q8BHZ5 | Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog) | Mus musculus (Mouse) | 1 | 157 | 146 | 152 | 7 | DALKYVR | 88.63 |
| DP01757 | Q13029 | PR domain zinc finger protein 2 (EC 2.1.1.355) (GATA-3-binding protein G3B) (Lysine N-methyltransferase 8) (MTB-ZF) (MTE-binding protein) (PR domain-containing protein 2) (Retinoblastoma protein-interacting zinc finger protein) (Zinc finger protein RIZ) | Homo sapiens (Human) | 197 | 341 | 228 | 235 | 8 | QEVASQEV | 79.93 |
| DP01757 | Q13029 | PR domain zinc finger protein 2 (EC 2.1.1.355) (GATA-3-binding protein G3B) (Lysine N-methyltransferase 8) (MTB-ZF) (MTE-binding protein) (PR domain-containing protein 2) (Retinoblastoma protein-interacting zinc finger protein) (Zinc finger protein RIZ) | Homo sapiens (Human) | 197 | 269 | 228 | 235 | 8 | QEVASQEV | 79.93 |
| DP01759 | Q0GBY3 | Phosphoprotein (Protein P) (Protein M1) | Rabies virus (strain China/MRV) (RABV) | 1 | 68 | 1 | 12 | 12 | MSKIFVNPSAIR | 77.17 |
| DP01759 | Q0GBY3 | Phosphoprotein (Protein P) (Protein M1) | Rabies virus (strain China/MRV) (RABV) | 1 | 68 | 16 | 46 | 31 | ADLEMAEETVDLINRNIEDNQAHLQGEPIEV | 78.47 |
| DP01762 | P03714 | Head-tail connector protein FII (Head-tail joining protein) (Minor capsid protein FII) | Escherichia phage lambda (Bacteriophage lambda) | 1 | 24 | 3 | 19 | 17 | DFDNLFDAAIARADETI | 88.59 |
| DP01763 | E6Y5X0 | Urease (EC 3.5.1.5) (Urea amidohydrolase) | Canavalia ensiformis (Jack bean) (Dolichos ensiformis) | 232 | 321 | 239 | 245 | 7 | AAMEIVC | 88.63 |
| DP01763 | E6Y5X0 | Urease (EC 3.5.1.5) (Urea amidohydrolase) | Canavalia ensiformis (Jack bean) (Dolichos ensiformis) | 232 | 321 | 279 | 288 | 10 | YANKYGPTIG | 87.29 |
| DP01763 | E6Y5X0 | Urease (EC 3.5.1.5) (Urea amidohydrolase) | Canavalia ensiformis (Jack bean) (Dolichos ensiformis) | 232 | 321 | 295 | 316 | 22 | DTDLIAEIEKDFALYGDESVFG | 86.42 |
| DP01765 | Q9NQA5 | Transient receptor potential cation channel subfamily V member 5 (TrpV5) (Calcium transport protein 2) (CaT2) (Epithelial calcium channel 1) (ECaC) (ECaC1) (Osm-9-like TRP channel 3) (OTRPC3) | Homo sapiens (Human) | 587 | 725 | 589 | 605 | 17 | RDELWRAQVVATTVMLE | 78.99 |
| DP01765 | Q9NQA5 | Transient receptor potential cation channel subfamily V member 5 (TrpV5) (Calcium transport protein 2) (CaT2) (Epithelial calcium channel 1) (ECaC) (ECaC1) (Osm-9-like TRP channel 3) (OTRPC3) | Homo sapiens (Human) | 587 | 725 | 626 | 655 | 30 | GDRWFLRVENHNDQNPLRVLRYVEVFKNSD | 86.16 |
| DP01765 | Q9NQA5 | Transient receptor potential cation channel subfamily V member 5 (TrpV5) (Calcium transport protein 2) (CaT2) (Epithelial calcium channel 1) (ECaC) (ECaC1) (Osm-9-like TRP channel 3) (OTRPC3) | Homo sapiens (Human) | 587 | 725 | 699 | 720 | 22 | RGWEILRQNTLGHLNLGLNLSE | 79.52 |
| DP01767 | Q9H1D0 | Transient receptor potential cation channel subfamily V member 6 (TrpV6) (CaT-like) (CaT-L) (Calcium transport protein 1) (CaT1) (Epithelial calcium channel 2) (ECaC2) | Homo sapiens (Human) | 655 | 725 | 666 | 673 | 8 | GDRWFLRV | 91.97 |
| DP01767 | Q9H1D0 | Transient receptor potential cation channel subfamily V member 6 (TrpV6) (CaT-like) (CaT-L) (Calcium transport protein 1) (CaT1) (Epithelial calcium channel 2) (ECaC2) | Homo sapiens (Human) | 655 | 725 | 680 | 694 | 15 | NRQRIQRYAQAFHTR | 78.48 |
| DP01768 | P58753 | Toll/interleukin-1 receptor domain-containing adapter protein (TIR domain-containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter-like protein) (MyD88-2) | Homo sapiens (Human) | 15 | 35 | 21 | 29 | 9 | MADWFRQTL | 80.27 |
| DP01769 | Q8WUG5 | Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR) | Homo sapiens (Human) | 1 | 105 | 3 | 10 | 8 | SDPIFTLA | 79.43 |
| DP01769 | Q8WUG5 | Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR) | Homo sapiens (Human) | 1 | 105 | 13 | 21 | 9 | LHCHYGAFP | 80.71 |
| DP01769 | Q8WUG5 | Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR) | Homo sapiens (Human) | 1 | 105 | 36 | 55 | 20 | VSVASAALAASAASRVATST | 79.08 |
| DP01769 | Q8WUG5 | Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR) | Homo sapiens (Human) | 1 | 105 | 72 | 93 | 22 | KDWDYNGLPVLTTNAIGQWDLV | 82.47 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 1 | 187 | 9 | 22 | 14 | DTELTTLLRRYNIP | 76.68 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 1 | 187 | 30 | 44 | 15 | TRRLYEKKIFEYETQ | 77.97 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 1 | 187 | 55 | 67 | 13 | AASSYSFSDLNST | 79.55 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 1 | 187 | 80 | 106 | 27 | EDALLYQSKGYNDDYYEESYFTTRTYG | 81.01 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 1 | 187 | 118 | 125 | 8 | RQSVTSFP | 78.55 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 1 | 187 | 137 | 144 | 8 | DDLLSSSE | 79.93 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 1 | 187 | 157 | 168 | 12 | RDSAYQSITHYR | 81.52 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 67 | 170 | 80 | 106 | 27 | EDALLYQSKGYNDDYYEESYFTTRTYG | 81.01 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 67 | 170 | 118 | 125 | 8 | RQSVTSFP | 78.55 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 67 | 170 | 137 | 144 | 8 | DDLLSSSE | 79.93 |
| DP01770 | P50402 | Emerin | Homo sapiens (Human) | 67 | 170 | 157 | 165 | 9 | RDSAYQSIT | 82.94 |
| DP01771 | P78560 | Death domain-containing protein CRADD (Caspase and RIP adapter with death domain) (RIP-associated protein with a death domain) | Homo sapiens (Human) | 95 | 136 | 106 | 114 | 9 | IPSHILNSS | 81.05 |
| DP01771 | P78560 | Death domain-containing protein CRADD (Caspase and RIP adapter with death domain) (RIP-associated protein with a death domain) | Homo sapiens (Human) | 95 | 136 | 116 | 126 | 11 | SDRQINQLAQR | 75.92 |
| DP01772 | Q07912 | Activated CDC42 kinase 1 (ACK-1) (EC 2.7.10.2) (EC 2.7.11.1) (Tyrosine kinase non-receptor protein 2) | Homo sapiens (Human) | 448 | 489 | 450 | 466 | 17 | SAQDISQPLQNSFIHTG | 76.73 |
| DP01774 | O54928 | Suppressor of cytokine signaling 5 (SOCS-5) (Cytokine-inducible SH2-containing protein 5) | Mus musculus (Mouse) | 175 | 244 | 209 | 215 | 7 | HLSELML | 77.26 |
| DP01774 | O54928 | Suppressor of cytokine signaling 5 (SOCS-5) (Cytokine-inducible SH2-containing protein 5) | Mus musculus (Mouse) | 175 | 244 | 226 | 234 | 9 | LAQKWHLIK | 75.92 |
| DP01775 | P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 41 | 50 | 10 | NDENEVEILP | 91.04 |
| DP01775 | P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 67 | 75 | 9 | ADGILVLEH | 79.78 |
| DP01775 | P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 82 | 91 | 10 | GFDVYDGHFD | 80.87 |
| DP01775 | P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 120 | 130 | 11 | NDDFISLSASS | 79.02 |
| DP01775 | P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 160 | 143 | 149 | 7 | KQELEIK | 81.84 |
| DP01775 | P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 128 | 160 | 143 | 149 | 7 | KQELEIK | 81.84 |
| DP01775 | P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 482 | 584 | 493 | 508 | 16 | GLVLNKAIIENENYHK | 79.47 |
| DP01775 | P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 482 | 584 | 515 | 539 | 25 | HDEDFAEDTVTSTATATTTDDDYEI | 77.42 |
| DP01775 | P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 482 | 584 | 562 | 573 | 12 | SGETYITVSSED | 80.96 |
| DP01776 | Q8GYN5 | RPM1-interacting protein 4 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 211 | 8 | 25 | 18 | KFGNWEAEENVPYTAYFD | 83.26 |
| DP01776 | Q8GYN5 | RPM1-interacting protein 4 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 211 | 41 | 48 | 8 | NDPEYNSD | 80.6 |
| DP01776 | Q8GYN5 | RPM1-interacting protein 4 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 211 | 107 | 114 | 8 | SQNNSYDN | 80.94 |
| DP01776 | Q8GYN5 | RPM1-interacting protein 4 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 211 | 162 | 172 | 11 | ADGYTHIFNKV | 81.76 |
| DP01777 | Q3LS93 | Uncharacterized protein | Strongylocentrotus purpuratus (Purple sea urchin) | 22 | 329 | 125 | 131 | 7 | AAQQIGD | 78.4 |
| DP01777 | Q3LS93 | Uncharacterized protein | Strongylocentrotus purpuratus (Purple sea urchin) | 22 | 329 | 264 | 272 | 9 | RPFRFNPFG | 75.25 |
| DP01779 | Q05917 | Homeobox protein engrailed-2 (Gg-En-2) (Homeobox protein en-2) | Gallus gallus (Chicken) | 146 | 199 | 170 | 179 | 10 | PAWVYCTRYS | 77.26 |
| DP01780 | P21736 | Protein E7 | Human papillomavirus 45 | 1 | 54 | 7 | 16 | 10 | TLQEIVLHLE | 80.43 |
| DP01780 | P21736 | Protein E7 | Human papillomavirus 45 | 1 | 54 | 24 | 36 | 13 | VDLLCYEQLSESE | 79.78 |
| DP01781 | O75112 | LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein) | Homo sapiens (Human) | 85 | 283 | 108 | 123 | 16 | VVVNSPANADYQERFN | 81.52 |
| DP01781 | O75112 | LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein) | Homo sapiens (Human) | 85 | 283 | 128 | 134 | 7 | KDSALST | 75.92 |
| DP01781 | O75112 | LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein) | Homo sapiens (Human) | 85 | 283 | 145 | 182 | 38 | GKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFS | 79.19 |
| DP01781 | O75112 | LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein) | Homo sapiens (Human) | 85 | 283 | 199 | 206 | 8 | YQAVIKSQ | 75.96 |
| DP01781 | O75112 | LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein) | Homo sapiens (Human) | 85 | 283 | 226 | 241 | 16 | RSFRILAQMTGTEFMQ | 78.7 |
| DP01781 | O75112 | LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein) | Homo sapiens (Human) | 229 | 283 | 235 | 241 | 7 | TGTEFMQ | 77.26 |
| DP01782 | Q53GG5 | PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein) | Homo sapiens (Human) | 107 | 273 | 110 | 122 | 13 | QDGNYFEHKHNIR | 87.52 |
| DP01782 | Q53GG5 | PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein) | Homo sapiens (Human) | 107 | 273 | 151 | 160 | 10 | SSVSTVSTIC | 83.55 |
| DP01782 | Q53GG5 | PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein) | Homo sapiens (Human) | 107 | 273 | 170 | 178 | 9 | LAPNIPLEM | 75.59 |
| DP01782 | Q53GG5 | PDZ and LIM domain protein 3 (Actinin-associated LIM protein) (Alpha-actinin-2-associated LIM protein) | Homo sapiens (Human) | 107 | 273 | 181 | 218 | 38 | PGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETP | 82.78 |
| DP01783 | Q2JIZ5 | Sensor histidine kinase | "Synechococcus sp. (strain JA-2-3Ba(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime)" | 1 | 30 | 2 | 9 | 8 | DTETWAAA | 79.26 |
| DP01783 | Q2JIZ5 | Sensor histidine kinase | "Synechococcus sp. (strain JA-2-3Ba(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime)" | 1 | 30 | 14 | 25 | 12 | RDALINRITHQI | 85.67 |
| DP01784 | Q86UX7 | Fermitin family homolog 3 (Kindlin-3) (MIG2-like protein) (Unc-112-related protein 2) | Homo sapiens (Human) | 142 | 224 | 158 | 178 | 21 | EEELYDLSKVVLAGGVAPALF | 81.59 |
| DP01784 | Q86UX7 | Fermitin family homolog 3 (Kindlin-3) (MIG2-like protein) (Unc-112-related protein 2) | Homo sapiens (Human) | 142 | 224 | 180 | 186 | 7 | GMPAHFS | 75.92 |
| DP01784 | Q86UX7 | Fermitin family homolog 3 (Kindlin-3) (MIG2-like protein) (Unc-112-related protein 2) | Homo sapiens (Human) | 142 | 224 | 188 | 198 | 11 | SAQTEACYHML | 74.28 |
| DP01785 | Q87P35 | Uncharacterized protein | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) | 1 | 125 | 2 | 25 | 24 | VNINTSHMQSLSQLTSHLATQNQA | 78.4 |
| DP01785 | Q87P35 | Uncharacterized protein | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) | 1 | 125 | 35 | 43 | 9 | GKDIFVKEG | 78.15 |
| DP01785 | Q87P35 | Uncharacterized protein | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) | 1 | 125 | 50 | 58 | 9 | VSARISHQN | 74.58 |
| DP01785 | Q87P35 | Uncharacterized protein | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) | 1 | 125 | 63 | 71 | 9 | IVVNLLTKQ | 76.7 |
| DP01785 | Q87P35 | Uncharacterized protein | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) | 1 | 125 | 82 | 105 | 24 | LQNVLNGENKLTLGNLKNLERLSS | 80.94 |
| DP01786 | D2JX42 | Abscisic stress ripening | Musa AAB Group | 1 | 143 | 20 | 57 | 38 | AEEVIYSETAYSGGGDYASGYTETVVAESASDEYEKYK | 78.37 |
| DP01786 | D2JX42 | Abscisic stress ripening | Musa AAB Group | 1 | 143 | 76 | 85 | 10 | AAGAFALYEK | 82.41 |
| DP01786 | D2JX42 | Abscisic stress ripening | Musa AAB Group | 1 | 143 | 100 | 120 | 21 | IEEEIAAAVAVGSGGYAFHEH | 84.62 |
| DP01787 | A0A1Z3GD05 | Abcissic acid stress ripening | Hordeum vulgare (Barley) | 1 | 138 | 7 | 14 | 8 | HHHLFHHK | 74.58 |
| DP01787 | A0A1Z3GD05 | Abcissic acid stress ripening | Hordeum vulgare (Barley) | 1 | 138 | 27 | 53 | 27 | GADVYGYSTETVVTGTGNEGEYERITK | 78.43 |
| DP01787 | A0A1Z3GD05 | Abcissic acid stress ripening | Hordeum vulgare (Barley) | 1 | 138 | 71 | 80 | 10 | AAGAFALYEK | 82.41 |
| DP01787 | A0A1Z3GD05 | Abcissic acid stress ripening | Hordeum vulgare (Barley) | 1 | 138 | 106 | 115 | 10 | GAGGFVFHEH | 80.1 |
| DP01789 | A0A1Z3GD08 | Abcissic acid stress ripening | Triticum turgidum subsp. durum (Durum wheat) (Triticum durum) | 1 | 136 | 6 | 13 | 8 | HHHLFHHK | 74.58 |
| DP01789 | A0A1Z3GD08 | Abcissic acid stress ripening | Triticum turgidum subsp. durum (Durum wheat) (Triticum durum) | 1 | 136 | 25 | 51 | 27 | GVDTYGYSTETVVTATGNDGEYERITK | 78.55 |
| DP01789 | A0A1Z3GD08 | Abcissic acid stress ripening | Triticum turgidum subsp. durum (Durum wheat) (Triticum durum) | 1 | 136 | 69 | 78 | 10 | AAGAFALYEK | 82.41 |
| DP01789 | A0A1Z3GD08 | Abcissic acid stress ripening | Triticum turgidum subsp. durum (Durum wheat) (Triticum durum) | 1 | 136 | 92 | 113 | 22 | KIEEEVAAAAAVGAGGFVFHEH | 77.09 |
| DP01791 | A0ZWU1 | Ell1-associated factor 1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 158 | 251 | 165 | 171 | 7 | RYPAISS | 75.92 |
| DP01791 | A0ZWU1 | Ell1-associated factor 1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 158 | 251 | 197 | 209 | 13 | LELGFDQEFNSID | 84.08 |
| DP01791 | A0ZWU1 | Ell1-associated factor 1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 158 | 251 | 239 | 245 | 7 | QAEGISS | 79.26 |
| DP01794 | Q99ML1 | Bcl-2-binding component 3 (p53 up-regulated modulator of apoptosis) | Mus musculus (Mouse) | 128 | 161 | 129 | 143 | 15 | EEEEWAREIGAQLRR | 79.22 |
| DP01794 | Q99ML1 | Bcl-2-binding component 3 (p53 up-regulated modulator of apoptosis) | Mus musculus (Mouse) | 128 | 161 | 148 | 154 | 7 | LNAQYER | 76.25 |
| DP01796 | Q9NS91 | E3 ubiquitin-protein ligase RAD18 (EC 2.3.2.27) (Postreplication repair protein RAD18) (hHR18) (hRAD18) (RING finger protein 73) (RING-type E3 ubiquitin transferase RAD18) | Homo sapiens (Human) | 339 | 366 | 346 | 355 | 10 | HKSEFQLLVD | 75.95 |
| DP01797 | O96017 | Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2) | Homo sapiens (Human) | 1 | 70 | 34 | 42 | 9 | QSQGISSSS | 75.73 |
| DP01797 | O96017 | Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2) | Homo sapiens (Human) | 64 | 90 | 68 | 76 | 9 | TQELYSIPE | 81.94 |
| DP01797 | O96017 | Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2) | Homo sapiens (Human) | 70 | 91 | 70 | 76 | 7 | ELYSIPE | 79.93 |
| DP01799 | P49790 | Nuclear pore complex protein Nup153 (153 kDa nucleoporin) (Nucleoporin Nup153) | Homo sapiens (Human) | 1313 | 1390 | 1340 | 1354 | 15 | GFGSISSSTALFPTG | 79.04 |
| DP01799 | P49790 | Nuclear pore complex protein Nup153 (153 kDa nucleoporin) (Nucleoporin Nup153) | Homo sapiens (Human) | 1313 | 1390 | 1363 | 1369 | 7 | GTVSSSS | 75.25 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 11 | 22 | 12 | PEVLLLLLCILQ | 82.66 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 39 | 45 | 7 | GGVFFPG | 89.97 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 100 | 107 | 8 | AAAAYKAA | 75.54 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 193 | 201 | 9 | GAGAFAGIP | 81.16 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 412 | 423 | 12 | GAVGIGGIPTFG | 80.43 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 493 | 500 | 8 | KAAQFGLG | 74.12 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 532 | 539 | 8 | GGVIGAGV | 75.25 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 649 | 657 | 9 | KAAQFGLGG | 74.1 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 695 | 707 | 13 | GGVLGAGQPFPIG | 73.91 |
| DP01801 | P04985 | Elastin (Tropoelastin) | Bos taurus (Bovine) | 1 | 747 | 726 | 733 | 8 | ALGALGFP | 75.25 |
| DP01804 | P53999 | Activated RNA polymerase II transcriptional coactivator p15 (Positive cofactor 4) (PC4) (SUB1 homolog) (p14) | Homo sapiens (Human) | 1 | 60 | 6 | 12 | 7 | ELVSSSS | 75.25 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 1 | 165 | 18 | 30 | 13 | LEELLESALDDFD | 75.1 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 1 | 165 | 60 | 90 | 31 | KDALFASQEKFFQELFDSELASQATAEFEKA | 83.66 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 1 | 165 | 100 | 110 | 11 | HLVEQFQKLSE | 79.66 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 1 | 165 | 121 | 128 | 8 | SQQEFTSC | 81.61 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 1 | 165 | 142 | 148 | 7 | DLQNSSM | 76.78 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 4 | 182 | 18 | 30 | 13 | LEELLESALDDFD | 75.1 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 4 | 182 | 60 | 90 | 31 | KDALFASQEKFFQELFDSELASQATAEFEKA | 83.66 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 4 | 182 | 100 | 110 | 11 | HLVEQFQKLSE | 79.66 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 4 | 182 | 121 | 128 | 8 | SQQEFTSC | 81.61 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 4 | 182 | 142 | 148 | 7 | DLQNSSM | 76.78 |
| DP01805 | P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | Homo sapiens (Human) | 4 | 182 | 167 | 177 | 11 | GEGNILPIMQS | 85.56 |
| DP01806 | Q67953 | Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen) | Hepatitis B virus (HBV) | 1 | 108 | 1 | 25 | 25 | MQLIITSKLGIIYILCGRLAFYIRE | 84.55 |
| DP01806 | Q67953 | Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen) | Hepatitis B virus (HBV) | 1 | 108 | 29 | 50 | 22 | AVPHFVGHHILGNKSYSMGGWS | 76.56 |
| DP01806 | Q67953 | Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen) | Hepatitis B virus (HBV) | 1 | 108 | 66 | 72 | 7 | PLGFFPD | 74.58 |
| DP01806 | Q67953 | Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen) | Hepatitis B virus (HBV) | 1 | 108 | 75 | 91 | 17 | LDPAFGANSNNPDWDFN | 76.47 |
| DP01807 | P49005 | DNA polymerase delta subunit 2 (DNA polymerase delta subunit p50) | Homo sapiens (Human) | 102 | 122 | 103 | 111 | 9 | LQPSILREV | 77.26 |
| DP01817 | Q15910 | Histone-lysine N-methyltransferase EZH2 (EC 2.1.1.356) (ENX-1) (Enhancer of zeste homolog 2) (Lysine N-methyltransferase 6) | Homo sapiens (Human) | 346 | 424 | 366 | 376 | 11 | STPTINVLESK | 78.44 |
| DP01817 | Q15910 | Histone-lysine N-methyltransferase EZH2 (EC 2.1.1.356) (ENX-1) (Enhancer of zeste homolog 2) (Lysine N-methyltransferase 6) | Homo sapiens (Human) | 480 | 514 | 495 | 509 | 15 | KHRLWAAHCRKIQLK | 75.61 |
| DP01825 | P25644 | DNA topoisomerase 2-associated protein PAT1 (Decapping activator and translational repressor PAT1) (Topoisomerase II-associated protein PAT1) (mRNA turnover protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 422 | 469 | 425 | 436 | 12 | TDSLTNVDLASS | 82.94 |
| DP01825 | P25644 | DNA topoisomerase 2-associated protein PAT1 (Decapping activator and translational repressor PAT1) (Topoisomerase II-associated protein PAT1) (mRNA turnover protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 422 | 469 | 454 | 464 | 11 | RRSSYAFNNGN | 79.08 |
| DP01832 | Q7Q3R9 | AGAP008004-PA | Anopheles gambiae (African malaria mosquito) | 22 | 103 | 29 | 43 | 15 | DVPTYDEEDFDEESL | 75.25 |
| DP01832 | Q7Q3R9 | AGAP008004-PA | Anopheles gambiae (African malaria mosquito) | 22 | 103 | 81 | 93 | 13 | FLRNSNTDEQASA | 75.15 |
| DP01833 | P85800 | Variegin | Amblyomma variegatum (Tropical bont tick) | 1 | 32 | 19 | 27 | 9 | DFEAIPEEY | 82.91 |
| DP01833 | P85800 | Variegin | Amblyomma variegatum (Tropical bont tick) | 8 | 32 | 19 | 27 | 9 | DFEAIPEEY | 82.91 |
| DP01833 | P85800 | Variegin | Amblyomma variegatum (Tropical bont tick) | 11 | 32 | 19 | 27 | 9 | DFEAIPEEY | 82.91 |
| DP01835 | O43715 | TP53-regulated inhibitor of apoptosis 1 (Protein 15E1.1) (WF-1) (p53-inducible cell-survival factor) (p53CSV) | Homo sapiens (Human) | 54 | 76 | 59 | 66 | 8 | IEGLEFMG | 80.43 |
| DP01840 | P38968 | Protein transport protein SEC31 (Protein WEB1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 770 | 1100 | 789 | 796 | 8 | MQAPFYGM | 79.77 |
| DP01840 | P38968 | Protein transport protein SEC31 (Protein WEB1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 770 | 1100 | 834 | 843 | 10 | MASPFVNKTN | 77.26 |
| DP01840 | P38968 | Protein transport protein SEC31 (Protein WEB1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 770 | 1100 | 858 | 882 | 25 | YATATVPATNVSTTSIPQNTFAPIQ | 78.35 |
| DP01840 | P38968 | Protein transport protein SEC31 (Protein WEB1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 770 | 1100 | 887 | 899 | 13 | IMGDYNAQSSSIP | 75.15 |
| DP01840 | P38968 | Protein transport protein SEC31 (Protein WEB1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 770 | 1100 | 942 | 950 | 9 | APPNILSTP | 73.91 |
| DP01840 | P38968 | Protein transport protein SEC31 (Protein WEB1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 770 | 1100 | 992 | 998 | 7 | SLVATSE | 84.62 |
| DP01840 | P38968 | Protein transport protein SEC31 (Protein WEB1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 770 | 1100 | 1001 | 1009 | 9 | RASISNPYA | 80.27 |
| DP01840 | P38968 | Protein transport protein SEC31 (Protein WEB1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 770 | 1100 | 1015 | 1041 | 27 | QQFPIGTISTANQTSNTAQVASSNPYA | 83.41 |
| DP01841 | P08514 | Integrin alpha-IIb (GPalpha IIb) (GPIIb) (Platelet membrane glycoprotein IIb) (CD antigen CD41) Cleaved into: Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; form 1; Integrin alpha-IIb light chain; form 2 | Homo sapiens (Human) | 989 | 1039 | 994 | 1027 | 34 | AIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRN | 79.85 |
| DP01842 | P05106 | Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) | Homo sapiens (Human) | 741 | 788 | 741 | 749 | 9 | WKLLITIHD | 86.47 |
| DP01842 | P05106 | Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) | Homo sapiens (Human) | 741 | 788 | 752 | 759 | 8 | EFAKFEEE | 82.61 |
| DP01842 | P05106 | Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) | Homo sapiens (Human) | 741 | 788 | 769 | 783 | 15 | NNPLYKEATSTFTNI | 80.6 |
| DP01842 | P05106 | Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) | Homo sapiens (Human) | 742 | 788 | 742 | 749 | 8 | KLLITIHD | 86.37 |
| DP01842 | P05106 | Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) | Homo sapiens (Human) | 742 | 788 | 752 | 759 | 8 | EFAKFEEE | 82.61 |
| DP01842 | P05106 | Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) | Homo sapiens (Human) | 742 | 788 | 769 | 783 | 15 | NNPLYKEATSTFTNI | 80.6 |
| DP01842 | P05106 | Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) | Homo sapiens (Human) | 762 | 788 | 769 | 783 | 15 | NNPLYKEATSTFTNI | 80.6 |
| DP01842 | P05106 | Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61) | Homo sapiens (Human) | 763 | 788 | 769 | 783 | 15 | NNPLYKEATSTFTNI | 80.6 |
| DP01843 | P03404 | "Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein" | Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1) | 1 | 25 | 7 | 15 | 9 | KSSVIGWPA | 79.6 |
| DP01844 | Q92540 | Protein SMG7 (EST1-like protein C) (SMG-7 homolog) (hSMG-7) | Homo sapiens (Human) | 111 | 143 | 111 | 117 | 7 | TVFNVDL | 75.25 |
| DP01844 | Q92540 | Protein SMG7 (EST1-like protein C) (SMG-7 homolog) (hSMG-7) | Homo sapiens (Human) | 111 | 143 | 124 | 138 | 15 | SQLGIISNKQTHTSA | 84.04 |
| DP01848 | P05107 | Integrin beta-2 (Cell surface adhesion glycoproteins LFA-1/CR3/p150;95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18) | Homo sapiens (Human) | 735 | 769 | 745 | 761 | 17 | SQWNNDNPLFKSATTTV | 79.93 |
| DP01849 | O60260 | E3 ubiquitin-protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2) | Homo sapiens (Human) | 109 | 142 | 118 | 126 | 9 | GLAVILHTD | 80.9 |
| DP01850 | Q9JK66 | E3 ubiquitin-protein ligase parkin (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) | Rattus norvegicus (Rat) | 76 | 141 | 93 | 99 | 7 | EGSIWEP | 79.93 |
| DP01850 | Q9JK66 | E3 ubiquitin-protein ligase parkin (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) | Rattus norvegicus (Rat) | 76 | 141 | 118 | 130 | 13 | GLAVILDTDSKSD | 88.5 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 1 | 172 | 2 | 8 | 7 | PGFNYGG | 76.3 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 1 | 172 | 12 | 18 | 7 | GTGWSSE | 77.26 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 1 | 172 | 43 | 51 | 9 | NVGNESVTV | 76.14 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 1 | 172 | 62 | 70 | 9 | WGKVIINAA | 80.45 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 1 | 172 | 77 | 91 | 15 | GTVMTADNSSMVPYG | 76.32 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 1 | 172 | 96 | 106 | 11 | RVLNSLVNNPV | 77.17 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 1 | 172 | 121 | 131 | 11 | AVENYLMVQSG | 86.38 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 21 | 107 | 43 | 51 | 9 | NVGNESVTV | 76.14 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 21 | 107 | 62 | 70 | 9 | WGKVIINAA | 80.45 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 21 | 107 | 77 | 91 | 15 | GTVMTADNSSMVPYG | 76.32 |
| DP01852 | P04480 | Colicin-A | Citrobacter freundii | 21 | 107 | 96 | 102 | 7 | RVLNSLV | 77.11 |
| DP01854 | Q9M605 | Dehydrin 1 (Dehydrin-like protein) | Vitis riparia (Frost grape) (Vitis vulpina) | 83 | 130 | 102 | 108 | 7 | QTSATST | 73.91 |
| DP01854 | Q9M605 | Dehydrin 1 (Dehydrin-like protein) | Vitis riparia (Frost grape) (Vitis vulpina) | 93 | 113 | 102 | 108 | 7 | QTSATST | 73.91 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 1 | 200 | 21 | 31 | 11 | PAFKYQFVREP | 76.1 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 1 | 200 | 49 | 55 | 7 | LEELEVL | 78.4 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 1 | 200 | 185 | 194 | 10 | VDETLFALPA | 80.74 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 32 | 200 | 49 | 55 | 7 | LEELEVL | 78.4 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 32 | 200 | 185 | 194 | 10 | VDETLFALPA | 80.74 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 408 | 213 | 237 | 25 | PGNTISAGQEDFPSVLLETAASLPS | 78.43 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 408 | 242 | 276 | 35 | SAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEV | 76.1 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 408 | 288 | 308 | 21 | DLTEFSELEYSEMGSSFSVSP | 76.95 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 408 | 311 | 325 | 15 | ESAVIVANPREEIIV | 83.88 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 408 | 335 | 348 | 14 | VSNNILHNQQELPT | 76.9 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 408 | 352 | 363 | 12 | KLVKEDEVVSSE | 74.97 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 408 | 380 | 396 | 17 | MREEYADFKPFERVWEV | 79.44 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 358 | 213 | 237 | 25 | PGNTISAGQEDFPSVLLETAASLPS | 78.43 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 358 | 242 | 276 | 35 | SAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEV | 76.1 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 358 | 288 | 308 | 21 | DLTEFSELEYSEMGSSFSVSP | 76.95 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 358 | 311 | 325 | 15 | ESAVIVANPREEIIV | 83.88 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 210 | 358 | 335 | 348 | 14 | VSNNILHNQQELPT | 76.9 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 359 | 566 | 380 | 396 | 17 | MREEYADFKPFERVWEV | 79.44 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 359 | 566 | 408 | 418 | 11 | AGGKIESNLES | 77.38 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 359 | 566 | 426 | 433 | 8 | ADSLEQTN | 80.27 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 359 | 566 | 457 | 468 | 12 | RSGAYITCAPFN | 77.56 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 359 | 566 | 471 | 484 | 14 | ATESIATNIFPLLG | 80.82 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 359 | 566 | 502 | 511 | 10 | AQIVTEKNTS | 78.13 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 359 | 566 | 518 | 547 | 30 | FLVAAQDSETDYVTTDNLTKVTEEVVANMP | 76.72 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 409 | 616 | 412 | 418 | 7 | IESNLES | 75.92 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 409 | 616 | 426 | 433 | 8 | ADSLEQTN | 80.27 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 409 | 616 | 457 | 468 | 12 | RSGAYITCAPFN | 77.56 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 409 | 616 | 471 | 484 | 14 | ATESIATNIFPLLG | 80.82 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 409 | 616 | 502 | 511 | 10 | AQIVTEKNTS | 78.13 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 409 | 616 | 518 | 547 | 30 | FLVAAQDSETDYVTTDNLTKVTEEVVANMP | 76.72 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 409 | 616 | 561 | 592 | 32 | SELNEVTGTKIAYETKMDLVQTSEVMQESLYP | 79.47 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 774 | 567 | 592 | 26 | TGTKIAYETKMDLVQTSEVMQESLYP | 79.98 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 774 | 613 | 623 | 11 | DIVMEAPLNSA | 74.64 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 774 | 628 | 634 | 7 | GASVIQP | 89.3 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 774 | 642 | 650 | 9 | SSVNYESIK | 83.24 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 774 | 679 | 705 | 27 | EPENINAALQETEAPYISIACDLIKET | 79.64 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 774 | 714 | 722 | 9 | DFSDYSEMA | 80.27 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 774 | 744 | 754 | 11 | PVDLFSDDSIP | 79.51 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 774 | 762 | 769 | 8 | ETVMLVKE | 75.67 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 748 | 567 | 592 | 26 | TGTKIAYETKMDLVQTSEVMQESLYP | 79.98 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 748 | 613 | 623 | 11 | DIVMEAPLNSA | 74.64 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 748 | 628 | 634 | 7 | GASVIQP | 89.3 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 748 | 642 | 650 | 9 | SSVNYESIK | 83.24 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 748 | 679 | 705 | 27 | EPENINAALQETEAPYISIACDLIKET | 79.64 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 567 | 748 | 714 | 722 | 9 | DFSDYSEMA | 80.27 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 617 | 824 | 628 | 634 | 7 | GASVIQP | 89.3 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 617 | 824 | 642 | 650 | 9 | SSVNYESIK | 83.24 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 617 | 824 | 679 | 705 | 27 | EPENINAALQETEAPYISIACDLIKET | 79.64 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 617 | 824 | 714 | 722 | 9 | DFSDYSEMA | 80.27 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 617 | 824 | 744 | 754 | 11 | PVDLFSDDSIP | 79.51 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 617 | 824 | 762 | 784 | 23 | ETVMLVKESLTETSFESMIEYEN | 78.99 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 617 | 824 | 799 | 809 | 11 | YLESFKLSLDN | 75.4 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 776 | 784 | 9 | FESMIEYEN | 84.65 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 799 | 809 | 11 | YLESFKLSLDN | 75.4 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 817 | 823 | 7 | DEVSTLS | 74.1 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 832 | 861 | 30 | MEELSTAVYSNDDLFISKEAQIRETETFSD | 80.52 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 863 | 877 | 15 | SPIEIIDEFPTLISS | 81.98 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 879 | 894 | 16 | TDSFSKLAREYTDLEV | 75.1 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 896 | 902 | 7 | HKSEIAN | 79.93 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 928 | 950 | 23 | VEEKISFSDDFSKNGSATSKVLL | 78.57 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 954 | 968 | 15 | DVSALATQAEIESIV | 81.36 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 775 | 1016 | 991 | 1011 | 21 | SPSAIFSAELSKTSVVDLLYW | 80.12 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 825 | 1016 | 832 | 861 | 30 | MEELSTAVYSNDDLFISKEAQIRETETFSD | 80.52 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 825 | 1016 | 863 | 877 | 15 | SPIEIIDEFPTLISS | 81.98 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 825 | 1016 | 879 | 894 | 16 | TDSFSKLAREYTDLEV | 75.1 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 825 | 1016 | 896 | 902 | 7 | HKSEIAN | 79.93 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 825 | 1016 | 928 | 950 | 23 | VEEKISFSDDFSKNGSATSKVLL | 78.57 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 825 | 1016 | 954 | 968 | 15 | DVSALATQAEIESIV | 81.36 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 825 | 1016 | 991 | 1011 | 21 | SPSAIFSAELSKTSVVDLLYW | 80.12 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 1055 | 1094 | 1057 | 1068 | 12 | YKGVIQAIQKSD | 81.52 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 1055 | 1094 | 1072 | 1089 | 18 | PFRAYLESEVAISEELVQ | 79.21 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 1155 | 1187 | 1158 | 1172 | 15 | HQAQIDHYLGLANKN | 82.27 |
| DP01855 | Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | Homo sapiens (Human) | 1155 | 1187 | 1176 | 1182 | 7 | AMAKIQA | 83.13 |
| DP01858 | Q96270 | Late embryogenesis abundant protein 7 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 169 | 5 | 11 | 7 | QEQSYKA | 80.94 |
| DP01858 | Q96270 | Late embryogenesis abundant protein 7 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 169 | 79 | 93 | 15 | KTGSYMSETGEAIKN | 80.27 |
| DP01858 | Q96270 | Late embryogenesis abundant protein 7 | Arabidopsis thaliana (Mouse-ear cress) | 1 | 169 | 96 | 103 | 8 | HDAAEYTK | 80.06 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 1 | 18 | 18 | MAAMFTTRNAIFRFSKSF | 85.28 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 32 | 39 | 8 | VFVASASH | 88.29 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 55 | 63 | 9 | MDWAYNSTS | 82.35 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 68 | 74 | 7 | DADEIAD | 77.26 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 119 | 125 | 7 | RDYAYDA | 88.29 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 148 | 154 | 7 | KDYAYDA | 91.97 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 177 | 183 | 7 | RDYAYDA | 88.29 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 193 | 205 | 13 | NAGETAKDYAYGA | 83.1 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 221 | 229 | 9 | RDYAYDATD | 88.29 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 256 | 278 | 23 | GAEKTAETTGEVAGAATEALKSA | 74.73 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 286 | 293 | 8 | AQGAWETA | 84.99 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 296 | 304 | 9 | ATQKIKETV | 82.27 |
| DP01859 | Q5NJL5 | Late embryogenesis abundant protein | Pisum sativum (Garden pea) | 1 | 358 | 321 | 330 | 10 | VVDEYDVELK | 78.33 |
| DP01860 | P17639 | Protein EMB-1 (Carrot ABA-induced in somatic embryos 4) | Daucus carota (Wild carrot) | 1 | 92 | 32 | 39 | 8 | AQQHLAEG | 82.94 |
| DP01860 | P17639 | Protein EMB-1 (Carrot ABA-induced in somatic embryos 4) | Daucus carota (Wild carrot) | 1 | 92 | 77 | 87 | 11 | EQEGIDIDESK | 75.22 |
| DP01861 | P01042 | Kininogen-1 (Alpha-2-thiol proteinase inhibitor) (Fitzgerald factor) (High molecular weight kininogen) (HMWK) (Williams-Fitzgerald-Flaujeac factor) Cleaved into: Kininogen-1 heavy chain; T-kinin (Ile-Ser-Bradykinin); Bradykinin (Kallidin I); Lysyl-bradykinin (Kallidin II); Kininogen-1 light chain; Low molecular weight growth-promoting factor | Homo sapiens (Human) | 438 | 531 | 517 | 526 | 10 | NGWKTEHLAS | 75.25 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 1 | 462 | 35 | 65 | 31 | STGYYDQEIYGGSDSRFAGYVTSIAATELED | 83.31 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 1 | 462 | 86 | 95 | 10 | APVALLNDIP | 74.45 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 1 | 462 | 97 | 105 | 9 | STEQYDPFA | 75.92 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 1 | 462 | 124 | 130 | 7 | RTMIISP | 83.95 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 1 | 462 | 182 | 190 | 9 | KVVNGAAAS | 75.25 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 1 | 462 | 214 | 223 | 10 | KLSSWDQAET | 76.45 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 1 | 462 | 371 | 378 | 8 | TPGHIMSM | 75.59 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 1 | 462 | 382 | 393 | 12 | QLQAWRWEREID | 79.38 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 190 | 340 | 214 | 223 | 10 | KLSSWDQAET | 76.45 |
| DP01863 | O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | Homo sapiens (Human) | 378 | 424 | 382 | 393 | 12 | QLQAWRWEREID | 79.38 |
| DP01864 | Q9XTN4 | Brinker (Brk) (Putative transcription factor) (RE18244p) | Drosophila melanogaster (Fruit fly) | 1 | 101 | 23 | 37 | 15 | SENATNSHTNNGNSS | 74.98 |
| DP01864 | Q9XTN4 | Brinker (Brk) (Putative transcription factor) (RE18244p) | Drosophila melanogaster (Fruit fly) | 1 | 101 | 53 | 62 | 10 | KLQVLESYRN | 77.26 |
| DP01864 | Q9XTN4 | Brinker (Brk) (Putative transcription factor) (RE18244p) | Drosophila melanogaster (Fruit fly) | 1 | 101 | 69 | 81 | 13 | NQRATARKYNIHR | 76.15 |
| DP01864 | Q9XTN4 | Brinker (Brk) (Putative transcription factor) (RE18244p) | Drosophila melanogaster (Fruit fly) | 1 | 101 | 83 | 96 | 14 | QIQKWLQCESNLRS | 79.65 |
| DP01864 | Q9XTN4 | Brinker (Brk) (Putative transcription factor) (RE18244p) | Drosophila melanogaster (Fruit fly) | 43 | 101 | 53 | 62 | 10 | KLQVLESYRN | 77.26 |
| DP01864 | Q9XTN4 | Brinker (Brk) (Putative transcription factor) (RE18244p) | Drosophila melanogaster (Fruit fly) | 43 | 101 | 69 | 81 | 13 | NQRATARKYNIHR | 76.15 |
| DP01864 | Q9XTN4 | Brinker (Brk) (Putative transcription factor) (RE18244p) | Drosophila melanogaster (Fruit fly) | 43 | 101 | 83 | 96 | 14 | QIQKWLQCESNLRS | 79.65 |
| DP01867 | P47047 | ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 85 | 3 | 14 | 12 | STDLFDVFEETP | 76.23 |
| DP01867 | P47047 | ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 78 | 3 | 14 | 12 | STDLFDVFEETP | 76.23 |
| DP01867 | P47047 | ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 672 | 809 | 678 | 684 | 7 | RLVEISV | 84.52 |
| DP01867 | P47047 | ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 672 | 809 | 686 | 703 | 18 | GKDNYGWGAVVDFAKRIN | 77.44 |
| DP01867 | P47047 | ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 672 | 809 | 708 | 739 | 32 | SAVYTDHESYIVNVVVNTMYIDSPVNLLKPFN | 82.98 |
| DP01867 | P47047 | ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 672 | 809 | 752 | 777 | 26 | GEKSICAVIPITLDSIKSIGNLRLYM | 79.42 |
| DP01869 | P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | Homo sapiens (Human) | 48 | 284 | 53 | 61 | 9 | KNNNYEPNL | 82.57 |
| DP01869 | P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | Homo sapiens (Human) | 48 | 284 | 72 | 92 | 21 | NQLASTPIIFKEQGLTLPLYQ | 80.9 |
| DP01869 | P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | Homo sapiens (Human) | 48 | 284 | 161 | 171 | 11 | CGSLFHTPKFV | 74.03 |
| DP01869 | P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | Homo sapiens (Human) | 48 | 284 | 179 | 188 | 10 | HISESLGAEV | 75.92 |
| DP01869 | P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | Homo sapiens (Human) | 48 | 284 | 191 | 199 | 9 | DMSWSSSLA | 77.26 |
| DP01869 | P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | Homo sapiens (Human) | 48 | 284 | 203 | 222 | 20 | TLSSTVLIVRNEEASETVFP | 85.18 |
| DP01869 | P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | Homo sapiens (Human) | 48 | 284 | 227 | 237 | 11 | ANVKSYFSNHD | 77.53 |
| DP01869 | P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | Homo sapiens (Human) | 48 | 284 | 243 | 257 | 15 | NDRFIASVTDSENTN | 79.22 |
| DP01869 | P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | Homo sapiens (Human) | 48 | 284 | 265 | 279 | 15 | GFGKTSGNSFKVNSC | 74.85 |
| DP01870 | P84040 | Histone H4 | Drosophila melanogaster (Fruit fly) | 22 | 102 | 23 | 32 | 10 | LRDNIQGITK | 76.49 |
| DP01870 | P84040 | Histone H4 | Drosophila melanogaster (Fruit fly) | 22 | 102 | 47 | 75 | 29 | ISGLIYEETRGVLKVFLENVIRDAVTYTE | 79.1 |
| DP01870 | P84040 | Histone H4 | Drosophila melanogaster (Fruit fly) | 22 | 102 | 85 | 92 | 8 | MDVVYALK | 77.76 |
| DP01874 | O95149 | Snurportin-1 (RNA U transporter 1) | Homo sapiens (Human) | 288 | 348 | 305 | 311 | 7 | QLQQIME | 80.98 |
| DP01874 | O95149 | Snurportin-1 (RNA U transporter 1) | Homo sapiens (Human) | 288 | 348 | 330 | 341 | 12 | ENGHYELEHLST | 75.92 |
| DP01875 | Q2GI62 | 120 kDa immunodominant surface protein | Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) | 142 | 221 | 142 | 149 | 8 | PFVAESEV | 75.92 |
| DP01875 | Q2GI62 | 120 kDa immunodominant surface protein | Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) | 142 | 221 | 153 | 165 | 13 | EQEETNPEVLIKD | 82.48 |
| DP01875 | Q2GI62 | 120 kDa immunodominant surface protein | Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) | 142 | 221 | 167 | 174 | 8 | QDVASHES | 75.25 |
| DP01875 | Q2GI62 | 120 kDa immunodominant surface protein | Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) | 142 | 221 | 181 | 193 | 13 | AQVVTERESEIES | 78.29 |
| DP01875 | Q2GI62 | 120 kDa immunodominant surface protein | Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) | 142 | 221 | 200 | 207 | 8 | KESGITES | 73.91 |
| DP01875 | Q2GI62 | 120 kDa immunodominant surface protein | Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) | 142 | 221 | 210 | 216 | 7 | KEDEIVS | 77.93 |
| DP01876 | P52926 | High mobility group protein HMGI-C (High mobility group AT-hook protein 2) | Homo sapiens (Human) | 1 | 109 | 93 | 104 | 12 | AQEETEETSSQE | 77.26 |
| DP01879 | Q9JIH2 | Nuclear pore complex protein Nup50 (50 kDa nucleoporin) (Nuclear pore-associated protein 60 kDa-like) (Nucleoporin Nup50) | Mus musculus (Mouse) | 47 | 109 | 47 | 62 | 16 | NVGFESDSGGAFKGFK | 74.48 |
| DP01879 | Q9JIH2 | Nuclear pore complex protein Nup50 (50 kDa nucleoporin) (Nuclear pore-associated protein 60 kDa-like) (Nucleoporin Nup50) | Mus musculus (Mouse) | 47 | 109 | 84 | 104 | 21 | LEGLTNGNSTDNATPFSNVKT | 79.07 |
| DP01880 | Q15596 | Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2) | Homo sapiens (Human) | 624 | 829 | 641 | 648 | 8 | LLQLLTTK | 77.55 |
| DP01880 | Q15596 | Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2) | Homo sapiens (Human) | 624 | 829 | 703 | 712 | 10 | LAKLTAEATG | 74.38 |
| DP01880 | Q15596 | Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2) | Homo sapiens (Human) | 624 | 829 | 740 | 750 | 11 | KENALLRYLLD | 77.74 |
| DP01880 | Q15596 | Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2) | Homo sapiens (Human) | 624 | 829 | 803 | 823 | 21 | LDNLEEILDDLQNSQLPQLFP | 80.25 |
| DP01883 | P02655 | Apolipoprotein C-II (Apo-CII) (ApoC-II) (Apolipoprotein C2) Cleaved into: Proapolipoprotein C-II (ProapoC-II) | Homo sapiens (Human) | 40 | 65 | 41 | 51 | 11 | KESLSSYWESA | 80.05 |
| DP01883 | P02655 | Apolipoprotein C-II (Apo-CII) (ApoC-II) (Apolipoprotein C2) Cleaved into: Proapolipoprotein C-II (ProapoC-II) | Homo sapiens (Human) | 40 | 65 | 54 | 60 | 7 | AAQNLYE | 88.87 |
| DP01884 | Q9UKT5 | F-box only protein 4 | Homo sapiens (Human) | 242 | 271 | 253 | 260 | 8 | SAVNKMFS | 75.25 |
| DP01890 | Q07930 | Pre-mRNA leakage protein 1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 61 | 22 | 29 | 8 | KSQYIDIM | 83.19 |
| DP01890 | Q07930 | Pre-mRNA leakage protein 1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 61 | 36 | 43 | 8 | GLLELESN | 77.47 |
| DP01890 | Q07930 | Pre-mRNA leakage protein 1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 51 | 22 | 29 | 8 | KSQYIDIM | 83.19 |
| DP01890 | Q07930 | Pre-mRNA leakage protein 1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 51 | 36 | 43 | 8 | GLLELESN | 77.47 |
| DP01890 | Q07930 | Pre-mRNA leakage protein 1 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 22 | 42 | 22 | 29 | 8 | KSQYIDIM | 83.19 |
| DP01919 | Q9V0U0 | Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-) | Pyrococcus abyssi (strain GE5 / Orsay) | 513 | 633 | 515 | 554 | 40 | KEVPIENVTDEHIREAFQLYLEGKIAKEAFEEIFKELARN | 80.06 |
| DP01919 | Q9V0U0 | Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-) | Pyrococcus abyssi (strain GE5 / Orsay) | 513 | 633 | 567 | 593 | 27 | GLTLLSEEEVTRIIEEVIQQNIEVVKA | 81.67 |
| DP01919 | Q9V0U0 | Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-) | Pyrococcus abyssi (strain GE5 / Orsay) | 513 | 633 | 598 | 604 | 7 | AMGLIMG | 92.98 |
| DP01919 | Q9V0U0 | Glutamyl-tRNA(Gln) amidotransferase subunit E (Glu-ADT subunit E) (EC 6.3.5.-) | Pyrococcus abyssi (strain GE5 / Orsay) | 513 | 633 | 614 | 623 | 10 | ADGKLVSQIV | 81.81 |
| DP01920 | P77522 | FeS cluster assembly protein SufB | Escherichia coli (strain K12) | 1 | 33 | 9 | 15 | 7 | DDVKTWT | 73.91 |
| DP01920 | P77522 | FeS cluster assembly protein SufB | Escherichia coli (strain K12) | 1 | 33 | 17 | 28 | 12 | GPLNYKEGFFTQ | 81.41 |
| DP01920 | P77522 | FeS cluster assembly protein SufB | Escherichia coli (strain K12) | 80 | 156 | 81 | 93 | 13 | DKLNYQDYSYYSA | 83.3 |
| DP01920 | P77522 | FeS cluster assembly protein SufB | Escherichia coli (strain K12) | 80 | 156 | 114 | 132 | 19 | GANAFLSKEVEAAFEQLGV | 80.34 |
| DP01920 | P77522 | FeS cluster assembly protein SufB | Escherichia coli (strain K12) | 80 | 156 | 141 | 151 | 11 | AVDAIFDSVSV | 80.75 |
| DP01926 | C4M7X2 | Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase) | Entamoeba histolytica | 583 | 769 | 610 | 624 | 15 | GFQLEIRVGKIVEAG | 79.87 |
| DP01926 | C4M7X2 | Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase) | Entamoeba histolytica | 583 | 769 | 631 | 637 | 7 | HLLALKV | 74.58 |
| DP01926 | C4M7X2 | Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase) | Entamoeba histolytica | 583 | 769 | 662 | 672 | 11 | NQKATFVCNLK | 76.13 |
| DP01926 | C4M7X2 | Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase) | Entamoeba histolytica | 583 | 769 | 681 | 691 | 11 | SEAMILAATSL | 75.89 |
| DP01926 | C4M7X2 | Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase) | Entamoeba histolytica | 583 | 769 | 703 | 714 | 12 | ADAAIGAQVIPK | 82.92 |
| DP01926 | C4M7X2 | Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase) | Entamoeba histolytica | 583 | 769 | 716 | 761 | 46 | GKVTISAKKISIDVVGKMNLALKGGLVRTNDVPLIVKDTELTVTVD | 78.25 |
| DP01928 | P03254 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) | 1 | 137 | 1 | 30 | 30 | MRHIICHGGVITEEMAASLLDQLIEEVLAD | 80.52 |
| DP01928 | P03254 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) | 1 | 137 | 43 | 53 | 11 | LHELYDLDVTA | 90.97 |
| DP01928 | P03254 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) | 1 | 137 | 61 | 67 | 7 | AVSQIFP | 87 |
| DP01928 | P03254 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) | 1 | 137 | 74 | 83 | 10 | VQEGIDLLTF | 81.24 |
| DP01928 | P03254 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) | 1 | 137 | 116 | 127 | 12 | VPEVIDLTCHEA | 74.5 |
| DP01928 | P03254 | Early E1A protein (Early E1A 32 kDa protein) | Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) | 191 | 289 | 265 | 277 | 13 | AVECIEDLLNESG | 77.28 |
| DP01930 | P29990 | Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5) | Dengue virus type 2 (strain Thailand/16681/1984) (DENV-2) | 108 | 128 | 111 | 119 | 9 | TVMAFHLTT | 79.6 |
| DP01937 | Q9EPH0 | Prestin (Solute carrier family 26 member 5) | Rattus norvegicus (Rat) | 564 | 636 | 574 | 596 | 23 | AMRKYAKEVGNANIANATVVKVD | 80.24 |
| DP01937 | Q9EPH0 | Prestin (Solute carrier family 26 member 5) | Rattus norvegicus (Rat) | 564 | 636 | 612 | 625 | 14 | DEVKFPPIVIKTTF | 77.54 |
| DP01938 | P11021 | Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) | Homo sapiens (Human) | 1 | 24 | 4 | 15 | 12 | SLVAAMLLLLSA | 82.08 |
| DP01939 | Q5JJ98 | Helicase-associated endonuclease for fork-structured DNA | Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) | 493 | 588 | 547 | 555 | 9 | KVENTEIRE | 75.92 |
| DP01941 | Q4JC68 | ATP-dependent DNA helicase Saci_0192 (EC 3.6.4.12) | Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) | 99 | 143 | 100 | 117 | 18 | IPCKYCELKGSIVEVKTD | 75.92 |
| DP01941 | Q4JC68 | ATP-dependent DNA helicase Saci_0192 (EC 3.6.4.12) | Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) | 99 | 143 | 132 | 138 | 7 | LQDKFCP | 81.32 |
| DP01942 | P50553 | Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46) | Homo sapiens (Human) | 1 | 236 | 28 | 52 | 25 | AACFFATAAAAAAAAAAAAAQSAQQ | 80.58 |
| DP01942 | P50553 | Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46) | Homo sapiens (Human) | 1 | 236 | 101 | 114 | 14 | RRLNFSGFGYSLPQ | 82.49 |
| DP01942 | P50553 | Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46) | Homo sapiens (Human) | 1 | 236 | 129 | 142 | 14 | NRVKLVNLGFATLR | 76.85 |
| DP01942 | P50553 | Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46) | Homo sapiens (Human) | 1 | 236 | 162 | 176 | 15 | SAVEYIRALQQLLDE | 82.88 |
| DP01942 | P50553 | Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46) | Homo sapiens (Human) | 1 | 236 | 180 | 204 | 25 | VSAAFQAGVLSPTISPNYSNDLNSM | 79.26 |
| DP01942 | P50553 | Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46) | Homo sapiens (Human) | 1 | 236 | 208 | 220 | 13 | PVSSYSSDEGSYD | 76.72 |
| DP01943 | Q9NRY2 | SOSS complex subunit C (INTS3- and NABP-interacting protein) (Sensor of single-strand DNA complex subunit C) (Sensor of ssDNA subunit C) (SOSS-C) (Single-stranded DNA-binding protein-interacting protein 1) (SSB-interacting protein 1) (hSSBIP1) | Homo sapiens (Human) | 1 | 62 | 1 | 23 | 23 | MAANSSGQGFQNKNRVAILAELD | 79.48 |
| DP01943 | Q9NRY2 | SOSS complex subunit C (INTS3- and NABP-interacting protein) (Sensor of single-strand DNA complex subunit C) (Sensor of ssDNA subunit C) (SOSS-C) (Single-stranded DNA-binding protein-interacting protein 1) (SSB-interacting protein 1) (hSSBIP1) | Homo sapiens (Human) | 1 | 62 | 41 | 48 | 8 | GASIALSR | 75.13 |
| DP01944 | P31324 | cAMP-dependent protein kinase type II-beta regulatory subunit | Mus musculus (Mouse) | 1 | 103 | 1 | 23 | 23 | MSIEIPAGLTELLQGFTVEVLRH | 79.6 |
| DP01944 | P31324 | cAMP-dependent protein kinase type II-beta regulatory subunit | Mus musculus (Mouse) | 1 | 103 | 26 | 45 | 20 | ADLLEFALQHFTRLQQENER | 89.65 |
| DP01944 | P31324 | cAMP-dependent protein kinase type II-beta regulatory subunit | Mus musculus (Mouse) | 1 | 103 | 72 | 80 | 9 | KGVNFAEEP | 79.64 |
| DP01944 | P31324 | cAMP-dependent protein kinase type II-beta regulatory subunit | Mus musculus (Mouse) | 394 | 416 | 400 | 411 | 12 | QLVALFGTNMDI | 82.55 |
| DP01945 | A0A2K8FR49 | LEA | Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus) | 1 | 172 | 4 | 15 | 12 | HGQSYRAGEATG | 79.77 |
| DP01945 | A0A2K8FR49 | LEA | Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus) | 1 | 172 | 58 | 77 | 20 | SEKAYEAKDKTSNMAQSAKG | 77.26 |
| DP01945 | A0A2K8FR49 | LEA | Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus) | 1 | 172 | 85 | 92 | 8 | QTGSFASD | 77.17 |
| DP01945 | A0A2K8FR49 | LEA | Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus) | 1 | 172 | 98 | 109 | 12 | KDKAYQAAQATK | 78.76 |
| DP01945 | A0A2K8FR49 | LEA | Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus) | 1 | 172 | 114 | 123 | 10 | DMTEYAKETA | 79.26 |
| DP01945 | A0A2K8FR49 | LEA | Amaranthus cruentus (Purple amaranth) (Amaranthus paniculatus) | 1 | 172 | 151 | 157 | 7 | AVKNTFG | 78.83 |
| DP01946 | S6AWC2 | Cold induced 16 | Triticum aestivum (Wheat) | 1 | 158 | 16 | 28 | 13 | KLVAEAAKTAYEK | 78.08 |
| DP01946 | S6AWC2 | Cold induced 16 | Triticum aestivum (Wheat) | 1 | 158 | 39 | 54 | 16 | VAAASADILDSAAKYG | 78.01 |
| DP01946 | S6AWC2 | Cold induced 16 | Triticum aestivum (Wheat) | 1 | 158 | 61 | 78 | 18 | VGQYLEKAEGYLKQYSSG | 76.46 |
| DP01947 | O65934 | ABC transporter ATP-binding/permease protein Rv1747 (EC 7.-.-.-) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 104 | 230 | 204 | 216 | 13 | EAGNLATSMMKIL | 77.46 |
| DP01948 | Q9HZJ8 | Cell division inhibitor SulA | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) | 1 | 42 | 11 | 34 | 24 | QLPLFQEAFWASNGAPLLDDVIDS | 85.09 |
| DP01951 | P04083 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) | Homo sapiens (Human) | 2 | 26 | 2 | 21 | 20 | AMVSEFLKQAWFIENEEQEY | 84.82 |
| DP01951 | P04083 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) | Homo sapiens (Human) | 116 | 185 | 134 | 158 | 25 | EDTLIEILASRTNKEIRDINRVYRE | 87.08 |
| DP01963 | P19619 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) | Sus scrofa (Pig) | 1 | 41 | 2 | 25 | 24 | AMVSEFLKQAWFIDNEEQEYIKTV | 82.8 |
| DP01963 | P19619 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) | Sus scrofa (Pig) | 1 | 40 | 2 | 25 | 24 | AMVSEFLKQAWFIDNEEQEYIKTV | 82.8 |
| DP01965 | P0CE48 | Elongation factor Tu 2 (EF-Tu 2) (Bacteriophage Q beta RNA-directed RNA polymerase subunit III) (P-43) | Escherichia coli (strain K12) | 42 | 63 | 43 | 52 | 10 | AARAFDQIDN | 78.83 |
| DP01965 | P0CE48 | Elongation factor Tu 2 (EF-Tu 2) (Bacteriophage Q beta RNA-directed RNA polymerase subunit III) (P-43) | Escherichia coli (strain K12) | 43 | 63 | 43 | 52 | 10 | AARAFDQIDN | 78.83 |
| DP01965 | P0CE48 | Elongation factor Tu 2 (EF-Tu 2) (Bacteriophage Q beta RNA-directed RNA polymerase subunit III) (P-43) | Escherichia coli (strain K12) | 44 | 64 | 46 | 52 | 7 | AFDQIDN | 76.35 |
| DP01968 | A4C1A5 | Cold shock protein; putative DNA-binding protein | Polaribacter irgensii 23-P | 1 | 86 | 4 | 12 | 9 | SQQTFSKSE | 92.64 |
| DP01968 | A4C1A5 | Cold shock protein; putative DNA-binding protein | Polaribacter irgensii 23-P | 1 | 86 | 41 | 55 | 15 | SGIQFAYVDHNGNLT | 77.03 |
| DP01968 | A4C1A5 | Cold shock protein; putative DNA-binding protein | Polaribacter irgensii 23-P | 1 | 86 | 63 | 78 | 16 | LKVEYELEDIQISVSK | 82.07 |
| DP01969 | P27058 | Systemin | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 200 | 32 | 40 | 9 | KEKIIEKET | 80.6 |
| DP01969 | P27058 | Systemin | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 200 | 50 | 64 | 15 | TISSYVLRDDTQEIP | 80.33 |
| DP01969 | P27058 | Systemin | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 200 | 72 | 93 | 22 | GYVKEKIVEKETISQYIIKIEG | 84.01 |
| DP01969 | P27058 | Systemin | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 200 | 101 | 120 | 20 | LKVEYEEEEYEKEKIVEKET | 77.16 |
| DP01969 | P27058 | Systemin | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 200 | 150 | 156 | 7 | SQDIIKM | 81.27 |
| DP01969 | P27058 | Systemin | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 200 | 160 | 166 | 7 | GALEITK | 81.94 |
| DP01969 | P27058 | Systemin | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 1 | 200 | 168 | 177 | 10 | VCEKIIVRED | 80.77 |
| DP01970 | M1GUG5 | MEG-14 (Fragment) | Schistosoma mansoni (Blood fluke) | 1 | 86 | 10 | 22 | 13 | ATSTSTHGATSTA | 73.91 |
| DP01970 | M1GUG5 | MEG-14 (Fragment) | Schistosoma mansoni (Blood fluke) | 1 | 86 | 31 | 39 | 9 | KAAATSTIK | 82.53 |
| DP01970 | M1GUG5 | MEG-14 (Fragment) | Schistosoma mansoni (Blood fluke) | 1 | 86 | 46 | 54 | 9 | KAAATSTTE | 74.51 |
| DP01971 | P01071 | Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) | Glycine max (Soybean) (Glycine hispida) | 1 | 181 | 1 | 9 | 9 | DFVLDNEGN | 80.27 |
| DP01971 | P01071 | Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) | Glycine max (Soybean) (Glycine hispida) | 1 | 181 | 13 | 30 | 18 | NGGTYYILSDITAFGGIR | 80.21 |
| DP01971 | P01071 | Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) | Glycine max (Soybean) (Glycine hispida) | 1 | 181 | 53 | 71 | 19 | GIGTIISSPFRIRFIAEGN | 84.1 |
| DP01971 | P01071 | Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) | Glycine max (Soybean) (Glycine hispida) | 1 | 181 | 73 | 99 | 27 | LRLKFDSFAVIMLCVGIPTEWSVVEDL | 78.26 |
| DP01971 | P01071 | Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) | Glycine max (Soybean) (Glycine hispida) | 1 | 181 | 114 | 122 | 9 | VDGWFRIER | 82.05 |
| DP01971 | P01071 | Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) | Glycine max (Soybean) (Glycine hispida) | 1 | 181 | 124 | 142 | 19 | SDDEFNNYKLVFCTQQAED | 78.45 |
| DP01971 | P01071 | Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) | Glycine max (Soybean) (Glycine hispida) | 1 | 181 | 146 | 153 | 8 | GDIGISID | 79.43 |
| DP01971 | P01071 | Trypsin inhibitor B (Kunitz-type trypsin inhibitor B) | Glycine max (Soybean) (Glycine hispida) | 1 | 181 | 169 | 176 | 8 | LVVQFQKV | 87.63 |
| DP01972 | P13693 | Translationally-controlled tumor protein (TCTP) (Fortilin) (Histamine-releasing factor) (HRF) (p23) | Homo sapiens (Human) | 37 | 68 | 39 | 56 | 18 | TEGNIDDSLIGGNASAEG | 82.37 |
| DP01973 | Q09514 | GLOBIN domain-containing protein | Caenorhabditis elegans | 216 | 266 | 226 | 233 | 8 | HQHIEISE | 80.14 |
| DP01973 | Q09514 | GLOBIN domain-containing protein | Caenorhabditis elegans | 216 | 266 | 242 | 255 | 14 | KQSEIENTAVSNEP | 80.17 |
| DP01974 | P39748 | Flap endonuclease 1 (FEN-1) (EC 3.1.-.-) (DNase IV) (Flap structure-specific endonuclease 1) (Maturation factor 1) (MF1) (hFEN-1) | Homo sapiens (Human) | 106 | 130 | 111 | 125 | 15 | LQQAQAAGAEQEVEK | 76.83 |
| DP01975 | O74958 | RNA binding exosome specificity factor Mmi1 (Meiotic mRNA interception protein 1) (YTH domain-containing protein mmi1) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 282 | 327 | 286 | 302 | 17 | EKSSYLLSNSSNDSASR | 80.05 |
| DP01977 | P49736 | DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28) | Homo sapiens (Human) | 1 | 160 | 4 | 11 | 8 | SSESFTMA | 79.43 |
| DP01977 | P49736 | DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28) | Homo sapiens (Human) | 1 | 160 | 35 | 41 | 7 | TDALTSS | 74.82 |
| DP01977 | P49736 | DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28) | Homo sapiens (Human) | 1 | 160 | 80 | 107 | 28 | DYRAIPELDAYEAEGLALDDEDVEELTA | 76.99 |
| DP01977 | P49736 | DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28) | Homo sapiens (Human) | 1 | 160 | 133 | 139 | 7 | RGLLYDS | 77.02 |
| DP01979 | Q6CMF0 | KLLA0E20769p | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) | 1 | 39 | 1 | 17 | 17 | MDQQFVAQLEQALGAIV | 84.81 |
| DP01979 | Q6CMF0 | KLLA0E20769p | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) | 631 | 656 | 636 | 646 | 11 | GDEDFLEGIED | 76.89 |
| DP01983 | Q9Q8N4 | Probable host range protein 2-3 | Myxoma virus (strain Lausanne) (MYXV) | 151 | 203 | 154 | 164 | 11 | IEEAYDASTEE | 88.29 |
| DP01983 | Q9Q8N4 | Probable host range protein 2-3 | Myxoma virus (strain Lausanne) (MYXV) | 151 | 203 | 175 | 191 | 17 | DTVHLYCLEEEDEEKIA | 81.53 |
| DP01984 | B4Y891 | Capsid protein VP1 (Fragment) | Adeno-associated virus | 1 | 213 | 3 | 24 | 22 | ADGYLPDWLEDNLSEGIREWWD | 75.28 |
| DP01984 | B4Y891 | Capsid protein VP1 (Fragment) | Adeno-associated virus | 1 | 213 | 44 | 57 | 14 | GLVLPGYKYLGPFN | 75.47 |
| DP01984 | B4Y891 | Capsid protein VP1 (Fragment) | Adeno-associated virus | 1 | 213 | 75 | 94 | 20 | HDKAYDQQLKAGDNPYLRYN | 80.3 |
| DP01984 | B4Y891 | Capsid protein VP1 (Fragment) | Adeno-associated virus | 1 | 213 | 96 | 105 | 10 | ADAEFQERLQ | 87.96 |
| DP01984 | B4Y891 | Capsid protein VP1 (Fragment) | Adeno-associated virus | 1 | 213 | 115 | 123 | 9 | GRAVFQAKK | 75.44 |
| DP01984 | B4Y891 | Capsid protein VP1 (Fragment) | Adeno-associated virus | 1 | 213 | 168 | 175 | 8 | KRLNFEED | 80.27 |
| DP01987 | Q14493 | Histone RNA hairpin-binding protein (Histone stem-loop-binding protein) | Homo sapiens (Human) | 200 | 224 | 206 | 219 | 14 | DLQEIHPVDLESAE | 78.26 |
| DP01993 | Q80VP1 | Epsin-1 (EPS-15-interacting protein 1) (Intersectin-EH-binding protein 1) (Ibp1) | Mus musculus (Mouse) | 229 | 407 | 238 | 246 | 9 | LQMAIEESK | 87.63 |
| DP01993 | Q80VP1 | Epsin-1 (EPS-15-interacting protein 1) (Intersectin-EH-binding protein 1) (Ibp1) | Mus musculus (Mouse) | 229 | 407 | 260 | 267 | 8 | LADVFTTP | 76.88 |
| DP01996 | Q07009 | Calpain-2 catalytic subunit (EC 3.4.22.53) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (Calpain-2 large subunit) (Millimolar-calpain) (M-calpain) | Rattus norvegicus (Rat) | 292 | 321 | 293 | 307 | 15 | WTGKWNDNCPSWNTV | 76.72 |
| DP01996 | Q07009 | Calpain-2 catalytic subunit (EC 3.4.22.53) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (Calpain-2 large subunit) (Millimolar-calpain) (M-calpain) | Rattus norvegicus (Rat) | 437 | 459 | 442 | 454 | 13 | GQTNIHLSKNFFL | 82.71 |
| DP01997 | E2IHW6 | TarP | Chlamydia trachomatis | 726 | 825 | 760 | 766 | 7 | LDVVYPG | 91.97 |
| DP01997 | E2IHW6 | TarP | Chlamydia trachomatis | 726 | 825 | 776 | 786 | 11 | LQANQTLGDIV | 75.92 |
| DP01997 | E2IHW6 | TarP | Chlamydia trachomatis | 726 | 825 | 794 | 800 | 7 | TSQETVV | 73.91 |
| DP01999 | Q8K4J6 | Myocardin-related transcription factor A (MRTF-A) (Basic SAP coiled-coil transcription activator) (MKL/myocardin-like protein 1) (Megakaryoblastic leukemia 1 protein homolog) (Megakaryocytic acute leukemia protein homolog) | Mus musculus (Mouse) | 67 | 98 | 75 | 85 | 11 | VRMHILEETSA | 74.89 |
| DP01999 | Q8K4J6 | Myocardin-related transcription factor A (MRTF-A) (Basic SAP coiled-coil transcription activator) (MKL/myocardin-like protein 1) (Megakaryoblastic leukemia 1 protein homolog) (Megakaryocytic acute leukemia protein homolog) | Mus musculus (Mouse) | 111 | 142 | 119 | 137 | 19 | VEKNILPVESSLKEAIIVG | 88.93 |
| DP02000 | O14745 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory factor 1) | Homo sapiens (Human) | 242 | 358 | 260 | 268 | 9 | TNGEIQKEN | 76.37 |
| DP02000 | O14745 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory factor 1) | Homo sapiens (Human) | 242 | 358 | 274 | 281 | 8 | AEAALESP | 74.08 |
| DP02000 | O14745 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory factor 1) | Homo sapiens (Human) | 242 | 358 | 319 | 330 | 12 | PILDFNISLAMA | 79.52 |
| DP02002 | O15922 | DNA-(apurinic or apyrimidinic site) endonuclease (EC 3.1.-.-) | Leishmania major | 1 | 89 | 11 | 23 | 13 | GDSASSSTSSLSP | 77.26 |
| DP02002 | O15922 | DNA-(apurinic or apyrimidinic site) endonuclease (EC 3.1.-.-) | Leishmania major | 1 | 89 | 49 | 59 | 11 | TDATSATVTAA | 75.8 |
| DP02002 | O15922 | DNA-(apurinic or apyrimidinic site) endonuclease (EC 3.1.-.-) | Leishmania major | 1 | 89 | 77 | 83 | 7 | SAAKITN | 80.32 |
| DP02003 | P16220 | Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1) | Homo sapiens (Human) | 101 | 160 | 119 | 129 | 11 | SYRKILNDLSS | 79.93 |
| DP02003 | P16220 | Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1) | Homo sapiens (Human) | 101 | 160 | 147 | 154 | 8 | SAPAITTV | 75.92 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 674 | 1080 | 675 | 681 | 7 | KQGILGN | 77.26 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 674 | 1080 | 720 | 727 | 8 | GMNSFNPM | 87.29 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 674 | 1080 | 789 | 802 | 14 | AQSQFLPQNQFPSS | 76.4 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 674 | 1080 | 868 | 874 | 7 | SLQHTTP | 75.25 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 674 | 1080 | 921 | 929 | 9 | AAQAQVTPQ | 75.03 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 674 | 1080 | 964 | 970 | 7 | AAASIDN | 78.07 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 674 | 1080 | 976 | 986 | 11 | SSVASAETNSQ | 74.34 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 674 | 1080 | 1026 | 1044 | 19 | LQGASQVKEETDIAEQKSE | 74.78 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 1852 | 2057 | 1859 | 1866 | 8 | LQQAQLMR | 75.25 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 1852 | 2057 | 1954 | 1964 | 11 | AAVEAARQIER | 75.25 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 1852 | 2057 | 1968 | 1979 | 12 | QQQHLYRVNINN | 88.74 |
| DP02004 | Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | Homo sapiens (Human) | 1852 | 2057 | 2037 | 2051 | 15 | RPVISMQAQAAVAGP | 74.58 |
| DP02005 | P47710 | Alpha-S1-casein Cleaved into: Casoxin-D | Homo sapiens (Human) | 1 | 185 | 1 | 15 | 15 | MRLLILTCLVAVALA | 81.05 |
| DP02005 | P47710 | Alpha-S1-casein Cleaved into: Casoxin-D | Homo sapiens (Human) | 1 | 185 | 41 | 47 | 7 | SREEYMN | 74.77 |
| DP02005 | P47710 | Alpha-S1-casein Cleaved into: Casoxin-D | Homo sapiens (Human) | 1 | 185 | 83 | 91 | 9 | MESSISSSS | 84.95 |
| DP02005 | P47710 | Alpha-S1-casein Cleaved into: Casoxin-D | Homo sapiens (Human) | 1 | 185 | 102 | 124 | 23 | QFCRLNEYNQLQLQAAHAQEQIR | 81.53 |
| DP02005 | P47710 | Alpha-S1-casein Cleaved into: Casoxin-D | Homo sapiens (Human) | 1 | 185 | 132 | 162 | 31 | VQVPFQQLNQLAAYPYAVWYYPQIMQYVPFP | 82.36 |
| DP02005 | P47710 | Alpha-S1-casein Cleaved into: Casoxin-D | Homo sapiens (Human) | 1 | 185 | 172 | 180 | 9 | AHENYEKNN | 87.77 |
| DP02006 | P04183 | Thymidine kinase; cytosolic (EC 2.7.1.21) | Homo sapiens (Human) | 193 | 234 | 218 | 229 | 12 | ARKLFAPQQILQ | 77.45 |
| DP02007 | Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | Homo sapiens (Human) | 1265 | 1521 | 1284 | 1294 | 11 | SAGLSSINKEG | 88.81 |
| DP02007 | Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | Homo sapiens (Human) | 1265 | 1521 | 1307 | 1321 | 15 | CTSSFLRLSFASETP | 75.88 |
| DP02007 | Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | Homo sapiens (Human) | 1265 | 1521 | 1334 | 1346 | 13 | EQQAESTLTSAET | 76.64 |
| DP02007 | Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | Homo sapiens (Human) | 1265 | 1521 | 1394 | 1403 | 10 | GKVTTSTWED | 78.53 |
| DP02007 | Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | Homo sapiens (Human) | 1265 | 1521 | 1423 | 1443 | 21 | LEVLEIPNPQLEVVAIDSSES | 86.42 |
| DP02007 | Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | Homo sapiens (Human) | 1265 | 1521 | 1454 | 1462 | 9 | KDIWNSTEQ | 85.54 |
| DP02007 | Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | Homo sapiens (Human) | 1265 | 1521 | 1491 | 1504 | 14 | VSVAETQTVISSIK | 81.68 |
| DP02007 | Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | Homo sapiens (Human) | 1265 | 1521 | 1508 | 1514 | 7 | NSSEISS | 85.28 |
| DP02008 | Q9M4V2 | O-acyltransferase | Brassica napus (Rape) | 1 | 113 | 82 | 89 | 8 | VDVRYTYR | 80.43 |
| DP02009 | O75683 | Surfeit locus protein 6 | Homo sapiens (Human) | 1 | 182 | 1 | 23 | 23 | MASLLAKDAYLQSLAKKICSHSA | 78.13 |
| DP02009 | O75683 | Surfeit locus protein 6 | Homo sapiens (Human) | 1 | 182 | 88 | 97 | 10 | EEAAWASSSA | 85.82 |
| DP02009 | O75683 | Surfeit locus protein 6 | Homo sapiens (Human) | 1 | 182 | 108 | 119 | 12 | PESVFALDVLRQ | 78.43 |
| DP02009 | O75683 | Surfeit locus protein 6 | Homo sapiens (Human) | 1 | 182 | 171 | 177 | 7 | AEEATEA | 75.59 |
| DP02010 | Q9NRJ3 | C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28) | Homo sapiens (Human) | 1 | 108 | 4 | 27 | 24 | RGLAIVALAVCAALHASEAILPIA | 88.28 |
| DP02010 | Q9NRJ3 | C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28) | Homo sapiens (Human) | 1 | 108 | 60 | 67 | 8 | LAAVILHV | 81.73 |
| DP02012 | Q9Z8L4 | Low calcium response E (Type III secreted protein SctW) (Type III secretion regulator YopN/LcrE/InvE/MxiC) | Chlamydia pneumoniae (Chlamydophila pneumoniae) | 1 | 94 | 14 | 37 | 24 | QGVNLAAVEAAAAKADAAEVVASQ | 77.15 |
| DP02012 | Q9Z8L4 | Low calcium response E (Type III secreted protein SctW) (Type III secretion regulator YopN/LcrE/InvE/MxiC) | Chlamydia pneumoniae (Chlamydophila pneumoniae) | 1 | 94 | 41 | 53 | 13 | EMNMIQQSQDLTN | 78.24 |
| DP02012 | Q9Z8L4 | Low calcium response E (Type III secreted protein SctW) (Type III secretion regulator YopN/LcrE/InvE/MxiC) | Chlamydia pneumoniae (Chlamydophila pneumoniae) | 1 | 94 | 63 | 72 | 10 | KEEKFQTLES | 76.62 |
| DP02015 | P52272 | Heterogeneous nuclear ribonucleoprotein M (hnRNP M) | Homo sapiens (Human) | 41 | 70 | 57 | 65 | 9 | GGNRFEPYA | 77.48 |
| DP02016 | Q9RSK0 | 50S ribosomal protein L36 | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) | 1 | 36 | 22 | 30 | 9 | RVLVICSNV | 82.61 |
| DP02025 | P30429 | Cell death protein 4 | Caenorhabditis elegans | 1 | 108 | 1 | 7 | 7 | MLCEIEC | 77.54 |
| DP02025 | P30429 | Cell death protein 4 | Caenorhabditis elegans | 1 | 108 | 14 | 22 | 9 | HTRLIHDFE | 75.92 |
| DP02025 | P30429 | Cell death protein 4 | Caenorhabditis elegans | 1 | 108 | 24 | 48 | 25 | RDALTYLEGKNIFTEDHSELISKMS | 78.85 |
| DP02025 | P30429 | Cell death protein 4 | Caenorhabditis elegans | 1 | 108 | 50 | 62 | 13 | RLERIANFLRIYR | 83.64 |
| DP02025 | P30429 | Cell death protein 4 | Caenorhabditis elegans | 1 | 108 | 68 | 98 | 31 | LGPLIDFFNYNNQSHLADFLEDYIDFAINEP | 85.31 |
| DP02027 | P17405 | Sphingomyelin phosphodiesterase (EC 3.1.4.12) (Acid sphingomyelinase) (aSMase) | Homo sapiens (Human) | 49 | 85 | 52 | 59 | 8 | SRVLWAPA | 77.59 |
| DP02027 | P17405 | Sphingomyelin phosphodiesterase (EC 3.1.4.12) (Acid sphingomyelinase) (aSMase) | Homo sapiens (Human) | 170 | 197 | 170 | 182 | 13 | WDIFSSWNISLPT | 78.9 |
| DP02030 | P09546 | Bifunctional protein PutA Includes: Proline dehydrogenase (EC 1.5.5.2) (Proline oxidase); Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C dehydrogenase) (EC 1.2.1.88) (L-glutamate gamma-semialdehyde dehydrogenase) | Escherichia coli (strain K12) | 611 | 669 | 630 | 650 | 21 | LASLSSALLNSALQKWQALPM | 84.47 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 1 | 15 | 15 | MRSSILFLLKLMKIM | 80.65 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 29 | 35 | 7 | RFQELVD | 79.93 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 43 | 64 | 22 | HQYKTYYTKYIQWCQLNQIIPT | 82.97 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 68 | 93 | 26 | NSVNSVPYKDLPISAELIHWFLLDTL | 78.85 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 112 | 136 | 25 | EEENSFKIATLKKIIGSLNFLSKLC | 80.64 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 142 | 156 | 15 | PNANIDTKYLESVTK | 78.39 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 158 | 183 | 26 | HTHWIDSQKAITTNETNNTNTQVLCP | 79.83 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 188 | 208 | 21 | VSLNLWNPETNHLSEKFFKTC | 78.2 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 211 | 235 | 25 | KLRFLVDFQLRSYLNLSFEERSKIR | 78.19 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 246 | 254 | 9 | RDAIIYHKV | 78.82 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 266 | 281 | 16 | HHQLLALLPQDCPFIC | 75.82 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 285 | 298 | 14 | TLAAYLYLRFYGIP | 87.2 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 314 | 324 | 11 | NGSLLQDIPIL | 76.77 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 328 | 349 | 22 | SLTTYPREETFSNYYTTVFRYC | 83.66 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 355 | 397 | 43 | RREYFNKCNLVYPTWDEDTFRTFFNEENHGNWLEQPEAFAFPD | 81.21 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 402 | 410 | 9 | DFKKIMNFK | 83.61 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 413 | 420 | 8 | YTSYSTNA | 79.26 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 431 | 443 | 13 | LLVQIFPEIDEYK | 80.91 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 447 | 505 | 59 | YEGLSQNSRDFLDLMEVLRERFLSNLPWIYKFFPNHDIFQDPIFGNSDFQSYFNDKTIH | 79.71 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 510 | 537 | 28 | PILSFDILPGFNKIYKNKTNFYSLLIER | 80.21 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 539 | 546 | 8 | SQLTFASS | 83.28 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 571 | 609 | 39 | TQLNELLKQQSFEYVQFQTLSNFQILLSVFNKIFEKLEM | 82.63 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 613 | 638 | 26 | SRGYILHQLNLFKITLDERIKKSKID | 78.96 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 652 | 660 | 9 | KEENIVNED | 89.07 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 673 | 681 | 9 | QIRLLSIAD | 84.32 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 695 | 711 | 17 | KKDGESIEDGAYGENED | 79.89 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 719 | 739 | 21 | EQLKSMINELINSKISTFLRD | 83.36 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 741 | 795 | 55 | MDQFELKINALLDKILEEKVTRIIEQKLGSHTGKFSTLKRPQLYMTEEHNVGFDM | 80.98 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 803 | 811 | 9 | TSGKYAETV | 77.48 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 833 | 874 | 42 | EAKSYTDEQEFMLDKSIDSIEGIILEWFTPNAKYANQCVHSM | 78.36 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 885 | 893 | 9 | NCEALYKER | 80.3 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 895 | 908 | 14 | SIVEFYIYLVNHES | 85.26 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 925 | 936 | 12 | NEGSFSRLAKFL | 80.43 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 956 | 942 | 951 | 10 | DHQNSFDGLL | 85.79 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 43 | 1 | 15 | 15 | MRSSILFLLKLMKIM | 80.65 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 43 | 29 | 35 | 7 | RFQELVD | 79.93 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 539 | 546 | 8 | SQLTFASS | 83.28 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 571 | 609 | 39 | TQLNELLKQQSFEYVQFQTLSNFQILLSVFNKIFEKLEM | 82.63 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 613 | 638 | 26 | SRGYILHQLNLFKITLDERIKKSKID | 78.96 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 652 | 660 | 9 | KEENIVNED | 89.07 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 673 | 681 | 9 | QIRLLSIAD | 84.32 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 695 | 711 | 17 | KKDGESIEDGAYGENED | 79.89 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 719 | 739 | 21 | EQLKSMINELINSKISTFLRD | 83.36 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 741 | 795 | 55 | MDQFELKINALLDKILEEKVTRIIEQKLGSHTGKFSTLKRPQLYMTEEHNVGFDM | 80.98 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 803 | 811 | 9 | TSGKYAETV | 77.48 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 833 | 874 | 42 | EAKSYTDEQEFMLDKSIDSIEGIILEWFTPNAKYANQCVHSM | 78.36 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 885 | 893 | 9 | NCEALYKER | 80.3 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 895 | 908 | 14 | SIVEFYIYLVNHES | 85.26 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 925 | 936 | 12 | NEGSFSRLAKFL | 80.43 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 538 | 956 | 942 | 951 | 10 | DHQNSFDGLL | 85.79 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 571 | 609 | 39 | TQLNELLKQQSFEYVQFQTLSNFQILLSVFNKIFEKLEM | 82.63 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 613 | 638 | 26 | SRGYILHQLNLFKITLDERIKKSKID | 78.96 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 652 | 660 | 9 | KEENIVNED | 89.07 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 673 | 681 | 9 | QIRLLSIAD | 84.32 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 695 | 711 | 17 | KKDGESIEDGAYGENED | 79.89 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 719 | 739 | 21 | EQLKSMINELINSKISTFLRD | 83.36 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 741 | 795 | 55 | MDQFELKINALLDKILEEKVTRIIEQKLGSHTGKFSTLKRPQLYMTEEHNVGFDM | 80.98 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 803 | 811 | 9 | TSGKYAETV | 77.48 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 833 | 874 | 42 | EAKSYTDEQEFMLDKSIDSIEGIILEWFTPNAKYANQCVHSM | 78.36 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 885 | 893 | 9 | NCEALYKER | 80.3 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 895 | 908 | 14 | SIVEFYIYLVNHES | 85.26 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 925 | 936 | 12 | NEGSFSRLAKFL | 80.43 |
| DP02033 | P32504 | Centromere DNA-binding protein complex CBF3 subunit A (Centromere-binding factor 2) (Chromosome transmission fidelity protein 14) (Kinetochore protein CTF14) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 552 | 956 | 942 | 951 | 10 | DHQNSFDGLL | 85.79 |
| DP02035 | A6QHR2 | Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) | Staphylococcus aureus (strain Newman) | 323 | 420 | 326 | 333 | 8 | GDLKSLSA | 74.58 |
| DP02035 | A6QHR2 | Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) | Staphylococcus aureus (strain Newman) | 323 | 420 | 344 | 365 | 22 | PQVTLSNDTTNIVEVLIETGIS | 77.76 |
| DP02035 | A6QHR2 | Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) | Staphylococcus aureus (strain Newman) | 323 | 420 | 376 | 385 | 10 | NNGAIYINGE | 81.81 |
| DP02035 | A6QHR2 | Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) | Staphylococcus aureus (strain Newman) | 323 | 420 | 388 | 395 | 8 | QDVNYALA | 81.86 |
| DP02035 | A6QHR2 | Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) | Staphylococcus aureus (strain Newman) | 323 | 420 | 400 | 406 | 7 | IDGEFTI | 86 |
| DP02049 | O74774 | Elongation factor 1 alpha-like protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 155 | 30 | 79 | 50 | QEEEFRSAVATVRETLLGVPISEKEIADTVWYYYFDVEKSVNYLLQKASS | 82.13 |
| DP02049 | O74774 | Elongation factor 1 alpha-like protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 155 | 111 | 126 | 16 | LDESSNGIKNLSLNKN | 74.96 |
| DP02049 | O74774 | Elongation factor 1 alpha-like protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 204 | 259 | 221 | 232 | 12 | KGSFSYAWLLDT | 87.76 |
| DP02049 | O74774 | Elongation factor 1 alpha-like protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 204 | 259 | 243 | 254 | 12 | MDVASTTFESDK | 77.4 |
| DP02050 | P41814 | tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 88 | 188 | 112 | 133 | 22 | SVSLELSSIDSSATNQNLVNMG | 80.34 |
| DP02050 | P41814 | tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 88 | 188 | 135 | 146 | 12 | KAQELTVEEIEK | 85.59 |
| DP02050 | P41814 | tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 88 | 188 | 149 | 163 | 15 | QESLSSKEIIDKIIK | 79.87 |
| DP02050 | P41814 | tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 88 | 188 | 170 | 183 | 14 | NKTVYSQEKYVNRK | 86.5 |
| DP02055 | P33322 | "H/ACA ribonucleoprotein complex subunit CBF5 (EC 5.4.99.-) (Centromere-binding factor 5) (Centromere/microtubule-binding protein CBF5) (H/ACA snoRNP protein CBF5) (Small nucleolar RNP protein CBF5) (p64)" | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 351 | 394 | 367 | 379 | 13 | KLDKYGRVNENTP | 78.13 |
| DP02061 | P70447 | Neurogenin-2 (NGN-2) (Helix-loop-helix protein mATH-4A) (mATH4A) (Protein atonal homolog 4) | Mus musculus (Mouse) | 1 | 31 | 1 | 22 | 22 | MFVKSETLELKEEEEVLMLLGS | 78.31 |
| DP02066 | Q9FG31 | Late embryogenesis abundant protein 46 (Late embryogenesis abundant protein 4-5) (AtLEA4-5) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 158 | 7 | 17 | 11 | TASNIAASAKS | 84.4 |
| DP02066 | Q9FG31 | Late embryogenesis abundant protein 46 (Late embryogenesis abundant protein 4-5) (AtLEA4-5) | Arabidopsis thaliana (Mouse-ear cress) | 1 | 158 | 45 | 58 | 14 | TQVKEDKINQAEMQ | 77.4 |
| DP02071 | P04383 | Capsid protein (Coat protein) (p38) | Carnation mottle virus (CarMV) | 1 | 81 | 24 | 39 | 16 | LAVKLVTRGWASLSTN | 78.26 |
| DP02071 | P04383 | Capsid protein (Coat protein) (p38) | Carnation mottle virus (CarMV) | 1 | 81 | 46 | 57 | 12 | MLAGYTPAILAF | 84.39 |
| DP02075 | P28300 | Protein-lysine 6-oxidase (EC 1.4.3.13) (Lysyl oxidase) Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form | Homo sapiens (Human) | 22 | 168 | 42 | 65 | 24 | WRQQIQWENNGQVFSLLSLGSQYQ | 80.03 |
| DP02075 | P28300 | Protein-lysine 6-oxidase (EC 1.4.3.13) (Lysyl oxidase) Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form | Homo sapiens (Human) | 22 | 168 | 79 | 86 | 8 | AANASAQQ | 80.27 |
| DP02075 | P28300 | Protein-lysine 6-oxidase (EC 1.4.3.13) (Lysyl oxidase) Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form | Homo sapiens (Human) | 22 | 168 | 90 | 96 | 7 | PILLIRD | 75.16 |
| DP02075 | P28300 | Protein-lysine 6-oxidase (EC 1.4.3.13) (Lysyl oxidase) Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form | Homo sapiens (Human) | 22 | 168 | 120 | 133 | 14 | TARHWFQAGYSTSR | 78.4 |
| DP02076 | O69245 | FixK2 protein | Bradyrhizobium japonicum | 1 | 37 | 7 | 20 | 14 | KTQVINTQIGGKIA | 80.72 |
| DP02078 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 1 | 171 | 11 | 23 | 13 | HGSKYLATASTMD | 81.04 |
| DP02078 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 1 | 171 | 38 | 47 | 10 | ILDSIGRFFG | 76.52 |
| DP02078 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 1 | 171 | 86 | 95 | 10 | PVVHFFKNIV | 86.76 |
| DP02078 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 1 | 171 | 109 | 119 | 11 | GLSLSRFSWGA | 76.28 |
| DP02078 | P02686 | Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein) | Homo sapiens (Human) | 1 | 171 | 147 | 158 | 12 | AQGTLSKIFKLG | 79.68 |
| DP02079 | E1BSW7 | Centromere protein S (CENP-S) | Gallus gallus (Chicken) | 107 | 139 | 123 | 133 | 11 | TEENETPVTES | 74.25 |
| DP02086 | Q9JPP1 | Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132) | Neisseria meningitidis | 133 | 274 | 146 | 161 | 16 | NGVLIDGPSQNITLTH | 90.43 |
| DP02086 | Q9JPP1 | Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132) | Neisseria meningitidis | 133 | 274 | 182 | 194 | 13 | EFENLNESERIEK | 78.49 |
| DP02086 | Q9JPP1 | Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132) | Neisseria meningitidis | 133 | 274 | 203 | 226 | 24 | KFTNLVATAVQANGTNKYVIIYKD | 83.85 |
| DP02086 | Q9JPP1 | Gna2132 (Heparin binding protein) (Neisserial heparin binding antigen) (Putative lipoprotein GNA2132) | Neisseria meningitidis | 133 | 274 | 229 | 237 | 9 | ASSSFARFR | 77.26 |
| DP02094 | P49427 | Ubiquitin-conjugating enzyme E2 R1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme R1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme R1) (Ubiquitin-conjugating enzyme E2-32 kDa complementing) (Ubiquitin-conjugating enzyme E2-CDC34) (Ubiquitin-protein ligase R1) | Homo sapiens (Human) | 183 | 236 | 185 | 195 | 11 | TTLAEYCVKTK | 76.1 |
| DP02094 | P49427 | Ubiquitin-conjugating enzyme E2 R1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme R1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme R1) (Ubiquitin-conjugating enzyme E2-32 kDa complementing) (Ubiquitin-conjugating enzyme E2-CDC34) (Ubiquitin-protein ligase R1) | Homo sapiens (Human) | 183 | 236 | 202 | 225 | 24 | GSDLFYDDYYEDGEVEEEADSCFG | 78.51 |
| DP02097 | P27472 | Glycogen starch synthase isoform 2 (EC 2.4.1.11) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 627 | 705 | 662 | 668 | 7 | NSTVYMT | 77.69 |
| DP02097 | P27472 | Glycogen starch synthase isoform 2 (EC 2.4.1.11) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 627 | 705 | 676 | 692 | 17 | QEVNNADDYFSLGVNPA | 77.61 |
| DP02097 | P27472 | Glycogen starch synthase isoform 2 (EC 2.4.1.11) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 640 | 705 | 662 | 668 | 7 | NSTVYMT | 77.69 |
| DP02097 | P27472 | Glycogen starch synthase isoform 2 (EC 2.4.1.11) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 640 | 705 | 676 | 692 | 17 | QEVNNADDYFSLGVNPA | 77.61 |
| DP02097 | P27472 | Glycogen starch synthase isoform 2 (EC 2.4.1.11) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 648 | 705 | 662 | 668 | 7 | NSTVYMT | 77.69 |
| DP02097 | P27472 | Glycogen starch synthase isoform 2 (EC 2.4.1.11) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 648 | 705 | 676 | 692 | 17 | QEVNNADDYFSLGVNPA | 77.61 |
| DP02105 | P74518 | Ribosome hibernation promotion factor (HPF) (Light-repressed protein A) | Synechocystis sp. (strain PCC 6803 / Kazusa) | 100 | 191 | 104 | 112 | 9 | GNVKTSEIV | 83.39 |
| DP02105 | P74518 | Ribosome hibernation promotion factor (HPF) (Light-repressed protein A) | Synechocystis sp. (strain PCC 6803 / Kazusa) | 100 | 191 | 117 | 123 | 7 | VEENLIG | 86.53 |
| DP02105 | P74518 | Ribosome hibernation promotion factor (HPF) (Light-repressed protein A) | Synechocystis sp. (strain PCC 6803 / Kazusa) | 100 | 191 | 131 | 142 | 12 | SEVLRMKYFAMP | 78.68 |
| DP02105 | P74518 | Ribosome hibernation promotion factor (HPF) (Light-repressed protein A) | Synechocystis sp. (strain PCC 6803 / Kazusa) | 100 | 191 | 150 | 165 | 16 | LEQLQLVDHDFYMFRN | 78.03 |
| DP02105 | P74518 | Ribosome hibernation promotion factor (HPF) (Light-repressed protein A) | Synechocystis sp. (strain PCC 6803 / Kazusa) | 100 | 191 | 167 | 186 | 20 | DTDEINVIYIRNHGGYGVIQ | 83.58 |
| DP02109 | O94316 | Pre-mRNA-splicing factor cwf10 (114 kDa U5 small nuclear ribonucleoprotein component homolog) (Complexed with cdc5 protein 10) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 60 | 3 | 15 | 13 | EEDLYDEFGNYIG | 85.1 |
| DP02109 | O94316 | Pre-mRNA-splicing factor cwf10 (114 kDa U5 small nuclear ribonucleoprotein component homolog) (Complexed with cdc5 protein 10) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1 | 60 | 35 | 55 | 21 | AQVPSFEEVIPDEELEDVERA | 78.82 |
| DP02117 | A0A045GWT8 | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) | Mycobacterium tuberculosis | 1 | 50 | 39 | 45 | 7 | LLDEIDD | 79.93 |
| DP02117 | A0A045GWT8 | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) | Mycobacterium tuberculosis | 21 | 58 | 39 | 53 | 15 | LLDEIDDVLEENAED | 79.93 |
| DP02117 | A0A045GWT8 | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) | Mycobacterium tuberculosis | 30 | 59 | 39 | 54 | 16 | LLDEIDDVLEENAEDF | 80.41 |
| DP02118 | P19836 | Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A) | Rattus norvegicus (Rat) | 1 | 75 | 48 | 56 | 9 | SDEIEVDFS | 80.16 |
| DP02118 | P19836 | Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A) | Rattus norvegicus (Rat) | 233 | 272 | 233 | 246 | 14 | SFINEKKYHLQERV | 75.25 |
| DP02118 | P19836 | Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A) | Rattus norvegicus (Rat) | 236 | 312 | 271 | 280 | 10 | SIDLIQKWEE | 84.38 |
| DP02118 | P19836 | Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A) | Rattus norvegicus (Rat) | 236 | 312 | 282 | 294 | 13 | SREFIGSFLEMFG | 80.89 |
| DP02118 | P19836 | Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A) | Rattus norvegicus (Rat) | 237 | 293 | 271 | 280 | 10 | SIDLIQKWEE | 84.38 |
| DP02118 | P19836 | Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A) | Rattus norvegicus (Rat) | 237 | 293 | 282 | 288 | 7 | SREFIGS | 81.13 |
| DP02122 | Q02199 | Nucleoporin NUP49/NSP49 (Nuclear pore protein NUP49/NSP49) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 121 | 154 | 123 | 139 | 17 | SRGLFGNNNTNNINNSS | 83.2 |
| DP02123 | P52948 | Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96) | Homo sapiens (Human) | 2 | 150 | 16 | 56 | 41 | GFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQ | 79.66 |
| DP02123 | P52948 | Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96) | Homo sapiens (Human) | 2 | 150 | 61 | 70 | 10 | GLFGTSSFSQ | 79.8 |
| DP02123 | P52948 | Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96) | Homo sapiens (Human) | 2 | 150 | 72 | 96 | 25 | ATSTSTGFGFGTSTGTANTLFGTAS | 78.1 |
| DP02123 | P52948 | Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96) | Homo sapiens (Human) | 2 | 150 | 98 | 112 | 15 | GTSLFSSQNNAFAQN | 79.93 |
| DP02123 | P52948 | Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96) | Homo sapiens (Human) | 2 | 150 | 116 | 138 | 23 | GFGNFGTSTSSGGLFGTTNTTSN | 78.78 |
| DP02124 | Q03281 | Inner nuclear membrane protein HEH2 (Helix-extension-helix domain-containing protein 2) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 99 | 140 | 105 | 112 | 8 | REQISTDN | 75.92 |
| DP02127 | P0AG30 | Transcription termination factor Rho | Escherichia coli (strain K12) | 1 | 30 | 11 | 18 | 8 | VSELITLG | 81.4 |
| DP02127 | P0AG30 | Transcription termination factor Rho | Escherichia coli (strain K12) | 355 | 411 | 356 | 363 | 8 | PAIDYNRS | 73.58 |
| DP02127 | P0AG30 | Transcription termination factor Rho | Escherichia coli (strain K12) | 355 | 411 | 367 | 388 | 22 | KEELLTTQEELQKMWILRKIIH | 78.2 |
| DP02127 | P0AG30 | Transcription termination factor Rho | Escherichia coli (strain K12) | 355 | 411 | 394 | 406 | 13 | DAMEFLINKLAMT | 83.59 |
| DP02128 | P06437 | Envelope glycoprotein B (gB) | Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1) | 31 | 109 | 40 | 48 | 9 | VAAATQAAN | 76.25 |
| DP02128 | P06437 | Envelope glycoprotein B (gB) | Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1) | 31 | 109 | 85 | 97 | 13 | GDNATVAAGHATL | 80.6 |
| DP02128 | P06437 | Envelope glycoprotein B (gB) | Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1) | 31 | 104 | 40 | 48 | 9 | VAAATQAAN | 76.25 |
| DP02128 | P06437 | Envelope glycoprotein B (gB) | Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1) | 31 | 104 | 85 | 97 | 13 | GDNATVAAGHATL | 80.6 |
| DP02128 | P06437 | Envelope glycoprotein B (gB) | Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1) | 460 | 492 | 460 | 466 | 7 | LAELYVR | 97.99 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 233 | 240 | 8 | VPGNFKSQ | 74.08 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 265 | 271 | 7 | GGNEITR | 85.95 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 291 | 298 | 8 | SAGSWNSG | 79.26 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 330 | 337 | 8 | STGSWNSG | 78.43 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 356 | 363 | 8 | STGTWNPG | 79.93 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 369 | 378 | 10 | SAGHWTSESS | 76.96 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 383 | 389 | 7 | TGQWHSE | 80.51 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 409 | 418 | 10 | DWGTFEEVSG | 79 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 480 | 486 | 7 | KEVVTSE | 76.4 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 499 | 507 | 9 | TLSGIGTLD | 76.03 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 515 | 546 | 32 | DEAAFFDTASTGKTFPGFFSPMLGEFVSETES | 79.66 |
| DP02130 | P02671 | Fibrinogen alpha chain Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain | Homo sapiens (Human) | 232 | 581 | 549 | 558 | 10 | SESGIFTNTK | 77.56 |
| DP02132 | P04386 | Regulatory protein GAL4 | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 107 | 144 | 126 | 132 | 7 | RISATSS | 75.92 |
| DP02137 | P0AGE0 | Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) | Escherichia coli (strain K12) | 113 | 178 | 144 | 151 | 8 | GGNQFSGG | 75.59 |
| DP02143 | O67086 | 50S ribosomal protein L20 | Aquifex aeolicus (strain VF5) | 1 | 59 | 38 | 47 | 10 | MRALYYQYRD | 80.27 |
| DP02143 | O67086 | 50S ribosomal protein L20 | Aquifex aeolicus (strain VF5) | 90 | 118 | 100 | 113 | 14 | DPQAFEQVVNKVKE | 76.49 |
| DP02145 | P47054 | Nucleoporin NUP192 (Nuclear pore protein NUP192) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 328 | 424 | 337 | 357 | 21 | SMELFYDIRSLLERHIPRLIP | 78.56 |
| DP02145 | P47054 | Nucleoporin NUP192 (Nuclear pore protein NUP192) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 328 | 424 | 362 | 376 | 15 | DDEKIFSQTTNSTYN | 84.48 |
| DP02145 | P47054 | Nucleoporin NUP192 (Nuclear pore protein NUP192) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 328 | 424 | 386 | 393 | 8 | GRGLWNPS | 78.01 |
| DP02145 | P47054 | Nucleoporin NUP192 (Nuclear pore protein NUP192) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 328 | 424 | 411 | 419 | 9 | NNVNEYSYT | 84.8 |
| DP02145 | P47054 | Nucleoporin NUP192 (Nuclear pore protein NUP192) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 576 | 601 | 579 | 596 | 18 | RQQFSESTHNDIDSTAVA | 76.92 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 49 | 307 | 52 | 58 | 7 | LAQKLQA | 75.25 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 49 | 307 | 73 | 99 | 27 | HDGTWNDNQLQEMAQLRIKHQEELTEL | 78.61 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 49 | 307 | 107 | 117 | 11 | AQLVIDLNNQM | 81.24 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 49 | 307 | 124 | 148 | 25 | MQMNEAKIAECLQTISDLETECLDL | 79.46 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 49 | 307 | 167 | 178 | 12 | DALQITFTALEG | 80.07 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 49 | 307 | 187 | 196 | 10 | NQELVTRWMA | 73.91 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 49 | 307 | 204 | 211 | 8 | RLNAENEK | 75.25 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 49 | 307 | 239 | 249 | 11 | DIEVIVDETSD | 75.95 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 49 | 307 | 272 | 284 | 13 | AGGLLDSITNIFG | 84.46 |
| DP02148 | Q676U5 | Autophagy-related protein 16-1 (APG16-like 1) | Homo sapiens (Human) | 59 | 84 | 73 | 79 | 7 | HDGTWND | 79.36 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 125 | 1 | 19 | 19 | MFNKSVNSGFTFGNQNTST | 79.55 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 125 | 37 | 52 | 16 | STGLFGNVNVNANTST | 77.24 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 125 | 56 | 71 | 16 | SGGLFNANSNANSISQ | 80.73 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 125 | 75 | 81 | 7 | NNSLFGN | 88.29 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 125 | 87 | 120 | 34 | SGGLFGATNNTTSKSAGSLFGNNNATANSTGSTG | 79.99 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 124 | 1 | 19 | 19 | MFNKSVNSGFTFGNQNTST | 79.55 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 124 | 37 | 52 | 16 | STGLFGNVNVNANTST | 77.24 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 124 | 56 | 71 | 16 | SGGLFNANSNANSISQ | 80.73 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 124 | 75 | 81 | 7 | NNSLFGN | 88.29 |
| DP02155 | P49687 | Nucleoporin NUP145 (EC 3.4.21.-) (Nuclear pore protein NUP145) Cleaved into: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 124 | 87 | 119 | 33 | SGGLFGATNNTTSKSAGSLFGNNNATANSTGST | 79.79 |
| DP02156 | P46673 | Nucleoporin NUP85 (Nuclear pore protein NUP85) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 43 | 14 | 21 | 8 | DQFDFLDD | 77.34 |
| DP02156 | P46673 | Nucleoporin NUP85 (Nuclear pore protein NUP85) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 43 | 23 | 29 | 7 | TAQLSNN | 86.62 |
| DP02157 | P35729 | Nucleoporin NUP120 (Nuclear pore protein NUP120) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 30 | 52 | 40 | 46 | 7 | GDKSIST | 78.26 |
| DP02158 | P36161 | Nucleoporin NUP133 (Nuclear pore protein NUP133) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 55 | 14 | 44 | 31 | LSVPIAVVENESLAQLSYEEESQASLMDISM | 78.15 |
| DP02159 | P32566 | Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 340 | 505 | 376 | 384 | 9 | TLNAESIKG | 79.3 |
| DP02159 | P32566 | Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 340 | 505 | 390 | 407 | 18 | ADVQSVQDHESVKIVKTE | 81.16 |
| DP02159 | P32566 | Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 340 | 505 | 414 | 429 | 16 | TTVNTESLGQAEHEIK | 75.77 |
| DP02162 | P16050 | Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12) | Homo sapiens (Human) | 22 | 162 | 22 | 28 | 7 | VQLWLVG | 79.41 |
| DP02162 | P16050 | Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12) | Homo sapiens (Human) | 22 | 162 | 52 | 66 | 15 | EVPEYLGPLLFVKLR | 79.06 |
| DP02162 | P16050 | Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12) | Homo sapiens (Human) | 22 | 162 | 72 | 83 | 12 | KDDAWFCNWISV | 83.05 |
| DP02162 | P16050 | Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12) | Homo sapiens (Human) | 22 | 162 | 103 | 109 | 7 | NGVLSLP | 82.94 |
| DP02162 | P16050 | Polyunsaturated fatty acid lipoxygenase ALOX15 (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase; leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12) | Homo sapiens (Human) | 22 | 162 | 145 | 157 | 13 | KDGLILNMAGAKL | 83.1 |
| DP02163 | Q02388 | Collagen alpha-1(VII) chain (Long-chain collagen) (LC collagen) | Homo sapiens (Human) | 1940 | 1978 | 1944 | 1973 | 30 | RLLETAGIKASALREIVETWDESSGSFLPV | 77.26 |
| DP02164 | Q8WUM0 | Nuclear pore complex protein Nup133 (133 kDa nucleoporin) (Nucleoporin Nup133) | Homo sapiens (Human) | 244 | 293 | 259 | 268 | 10 | VSSLFGILSP | 85.75 |
| DP02164 | Q8WUM0 | Nuclear pore complex protein Nup133 (133 kDa nucleoporin) (Nucleoporin Nup133) | Homo sapiens (Human) | 244 | 293 | 270 | 280 | 11 | SDLTLSSVLWD | 82.27 |
| DP02167 | Q8N726 | Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF) | Homo sapiens (Human) | 1 | 132 | 4 | 12 | 9 | RFLVTLRIR | 79.6 |
| DP02167 | Q8N726 | Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF) | Homo sapiens (Human) | 1 | 132 | 19 | 28 | 10 | RVRVFVVHIP | 83.88 |
| DP02167 | Q8N726 | Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF) | Homo sapiens (Human) | 1 | 132 | 30 | 37 | 8 | LTGEWAAP | 76.92 |
| DP02167 | Q8N726 | Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF) | Homo sapiens (Human) | 1 | 132 | 41 | 52 | 12 | AAVALVLMLLRS | 78.26 |
| DP02167 | Q8N726 | Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF) | Homo sapiens (Human) | 1 | 37 | 4 | 12 | 9 | RFLVTLRIR | 79.6 |
| DP02167 | Q8N726 | Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF) | Homo sapiens (Human) | 1 | 37 | 19 | 28 | 10 | RVRVFVVHIP | 83.88 |
| DP02171 | P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | Homo sapiens (Human) | 1 | 100 | 8 | 16 | 9 | NLLALFAPR | 94.91 |
| DP02171 | P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | Homo sapiens (Human) | 1 | 100 | 34 | 49 | 16 | HNQPYCGIAPYIREFE | 77.3 |
| DP02171 | P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | Homo sapiens (Human) | 1 | 100 | 80 | 86 | 7 | QEVETEL | 77.26 |
| DP02171 | P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | Homo sapiens (Human) | 1 | 33 | 8 | 16 | 9 | NLLALFAPR | 94.91 |
| DP02173 | Q9BS26 | Endoplasmic reticulum resident protein 44 (ER protein 44) (ERp44) (Thioredoxin domain-containing protein 4) | Homo sapiens (Human) | 328 | 358 | 328 | 341 | 14 | HMYVFGDFKDVLIP | 84.23 |
| DP02173 | Q9BS26 | Endoplasmic reticulum resident protein 44 (ER protein 44) (ERp44) (Thioredoxin domain-containing protein 4) | Homo sapiens (Human) | 328 | 358 | 343 | 353 | 11 | KLKQFVFDLHS | 80.15 |
| DP02192 | O00571 | ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2) | Homo sapiens (Human) | 1 | 167 | 4 | 25 | 22 | VAVENALGLDQQFAGLDLNSSD | 77.61 |
| DP02192 | O00571 | ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2) | Homo sapiens (Human) | 1 | 167 | 66 | 73 | 8 | KDAYSSFG | 85.45 |
| DP02192 | O00571 | ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2) | Homo sapiens (Human) | 1 | 167 | 80 | 87 | 8 | GKSSFFSD | 77.97 |
| DP02192 | O00571 | ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3; X-chromosomal) (DEAD box; X isoform) (DBX) (Helicase-like protein 2) (HLP2) | Homo sapiens (Human) | 1 | 167 | 146 | 162 | 17 | LEQELFSGGNTGINFEK | 81.21 |
| DP02193 | P21734 | Ubiquitin-conjugating enzyme E2 1 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 1) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 150 | 172 | 158 | 167 | 10 | GNVEESDLYG | 75.65 |
| DP02195 | P53136 | Ribosome biogenesis protein NSA1 (NOP7-associated protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 434 | 463 | 441 | 448 | 8 | ADELWNKL | 80.02 |
| DP02196 | P37455 | Single-stranded DNA-binding protein A (SSB A) | Bacillus subtilis (strain 168) | 107 | 171 | 112 | 137 | 26 | GSGGYNEGNSGGGQYFGGGQNDNPFG | 80.73 |
| DP02196 | P37455 | Single-stranded DNA-binding protein A (SSB A) | Bacillus subtilis (strain 168) | 107 | 171 | 146 | 157 | 12 | NQGNSFNDDPFA | 83.36 |
| DP02197 | P0ADV9 | Lipopolysaccharide export system protein LptC | Escherichia coli (strain K12) | 24 | 58 | 31 | 43 | 13 | AQVVVNNNDPTYK | 77.67 |
| DP02201 | P0A9A6 | Cell division protein FtsZ | Escherichia coli (strain K12) | 317 | 383 | 323 | 329 | 7 | ITLVTNK | 75.59 |
| DP02202 | P17865 | Cell division protein FtsZ | Bacillus subtilis (strain 168) | 317 | 382 | 330 | 336 | 7 | LNQSIKT | 75.06 |
| DP02202 | P17865 | Cell division protein FtsZ | Bacillus subtilis (strain 168) | 317 | 382 | 352 | 358 | 7 | QQQNTVS | 87.96 |
| DP02202 | P17865 | Cell division protein FtsZ | Bacillus subtilis (strain 168) | 317 | 382 | 370 | 377 | 8 | DIPTFLRN | 77.26 |
| DP02203 | Q9Q6P4 | Genome polyprotein Cleaved into: Peptide 2k; Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (NS5) | West Nile virus (strain NY-99) (WNV) (West Nile virus (strain NY-1999)) | 899 | 919 | 900 | 914 | 15 | EKLEIGWKAWGKSIL | 77.88 |
| DP02204 | Q5UB51 | Genome polyprotein Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5) | Dengue virus type 3 (strain Singapore/8120/1995) (DENV-3) | 1413 | 1438 | 1415 | 1421 | 7 | HNLMITV | 81.18 |
| DP02205 | Q2TUW1 | Abscisic stress ripening-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 238 | 28 | 36 | 9 | GYDNTSYSK | 75.14 |
| DP02205 | Q2TUW1 | Abscisic stress ripening-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 238 | 57 | 68 | 12 | YEGGYNKTSYSS | 77.01 |
| DP02205 | Q2TUW1 | Abscisic stress ripening-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 238 | 124 | 130 | 7 | GGGVYPD | 75.92 |
| DP02205 | Q2TUW1 | Abscisic stress ripening-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 238 | 133 | 152 | 20 | TDGGYSKTSGGGYDDEVDYK | 75.82 |
| DP02205 | Q2TUW1 | Abscisic stress ripening-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 238 | 171 | 180 | 10 | SAAAYALHEK | 76.05 |
| DP02205 | Q2TUW1 | Abscisic stress ripening-like protein | Glycine max (Soybean) (Glycine hispida) | 1 | 238 | 194 | 215 | 22 | KIEEEVAAAAAVGSGGFAFHEH | 74.93 |
| DP02207 | P02808 | Statherin | Homo sapiens (Human) | 20 | 62 | 22 | 41 | 20 | SEEKFLRRIGRFGYGYGPYQ | 77.96 |
| DP02207 | P02808 | Statherin | Homo sapiens (Human) | 20 | 62 | 45 | 57 | 13 | EQPLYPQPYQPQY | 77.98 |
| DP02208 | A0A140GKJ0 | ICP47 protein (Immediate-early protein IE12) (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12) | Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1) | 56 | 88 | 57 | 69 | 13 | LLPEIAPNASLGV | 77.15 |
| DP02209 | O82132 | Dehydration-responsive element-binding protein 2A (Protein DREB2A) | Arabidopsis thaliana (Mouse-ear cress) | 168 | 335 | 181 | 190 | 10 | MYCLENGAEE | 82.61 |
| DP02209 | O82132 | Dehydration-responsive element-binding protein 2A (Protein DREB2A) | Arabidopsis thaliana (Mouse-ear cress) | 168 | 335 | 197 | 214 | 18 | ADKHWLSEFEHNYWSDIL | 79.36 |
| DP02209 | O82132 | Dehydration-responsive element-binding protein 2A (Protein DREB2A) | Arabidopsis thaliana (Mouse-ear cress) | 168 | 335 | 221 | 229 | 9 | KEQGIVETC | 83.5 |
| DP02209 | O82132 | Dehydration-responsive element-binding protein 2A (Protein DREB2A) | Arabidopsis thaliana (Mouse-ear cress) | 168 | 335 | 234 | 246 | 13 | QDSLSVADYGWPN | 80.94 |
| DP02209 | O82132 | Dehydration-responsive element-binding protein 2A (Protein DREB2A) | Arabidopsis thaliana (Mouse-ear cress) | 168 | 335 | 270 | 293 | 24 | GDDVFAGLNQDRYPGNSVANGSYR | 78.93 |
| DP02209 | O82132 | Dehydration-responsive element-binding protein 2A (Protein DREB2A) | Arabidopsis thaliana (Mouse-ear cress) | 168 | 335 | 304 | 312 | 9 | LQSLNYGIP | 87.07 |
| DP02209 | O82132 | Dehydration-responsive element-binding protein 2A (Protein DREB2A) | Arabidopsis thaliana (Mouse-ear cress) | 168 | 335 | 321 | 330 | 10 | GNGFFDDLSY | 83.41 |
| DP02210 | Q03519 | Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11) | Homo sapiens (Human) | 1 | 129 | 9 | 24 | 16 | WTSLLLVDAALLWLLQ | 85.43 |
| DP02210 | Q03519 | Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11) | Homo sapiens (Human) | 1 | 129 | 35 | 42 | 8 | LPGLWLEG | 84.11 |
| DP02210 | Q03519 | Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11) | Homo sapiens (Human) | 1 | 129 | 46 | 86 | 41 | LGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGA | 75.7 |
| DP02210 | Q03519 | Antigen peptide transporter 2 (APT2) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 3) (Peptide supply factor 2) (Peptide transporter PSF2) (PSF-2) (Peptide transporter TAP2) (Peptide transporter involved in antigen processing 2) (Really interesting new gene 11 protein) (RING11) | Homo sapiens (Human) | 1 | 129 | 92 | 119 | 28 | ARVASAPWSWLLVGYGAAGLSWSLWAVL | 81.83 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 1 | 100 | 14 | 24 | 11 | SDQYIDPLGIV | 96.32 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 1 | 100 | 49 | 57 | 9 | DTNSYGNSS | 77.03 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 1 | 100 | 61 | 67 | 7 | DYDSYLD | 81.27 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 1 | 100 | 74 | 83 | 10 | DVDAYYANDN | 77.12 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 410 | 422 | 13 | QPSTFAGGISNNA | 77.67 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 432 | 441 | 10 | TSSHFNRNTD | 76.32 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 490 | 498 | 9 | SRSTITNGN | 79.93 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 518 | 530 | 13 | SDSEITSEGSYSD | 83.35 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 572 | 580 | 9 | IETRFNTYK | 83.72 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 639 | 648 | 10 | EVGNFYSKSN | 79.73 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 687 | 695 | 9 | SANGFINRR | 90.04 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 716 | 722 | 7 | QTAVYQN | 79.93 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 726 | 737 | 12 | GAPYIPQQPTYQ | 80.1 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 766 | 772 | 7 | HGQQYPP | 73.91 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 775 | 781 | 7 | QQQPIYQ | 86.53 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 789 | 798 | 10 | PYNSIQNNPQ | 74.45 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 802 | 808 | 7 | SPFNYSQ | 78.07 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 826 | 840 | 15 | NQPHINQNGYQNSYN | 88.18 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 856 | 862 | 7 | PQFNHYG | 89.39 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 893 | 903 | 11 | GNFKLADYERD | 75.55 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 905 | 911 | 7 | MTVGYSQ | 77.54 |
| DP02216 | Q9U3S5 | MUTator | Caenorhabditis elegans | 400 | 950 | 931 | 945 | 15 | GYDNFNGNSAPYFNK | 87.18 |
| DP02220 | P32521 | Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1191 | 1480 | 1205 | 1215 | 11 | PSAAFSQNSTN | 76.28 |
| DP02220 | P32521 | Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1191 | 1480 | 1241 | 1247 | 7 | GHNPYFK | 76.25 |
| DP02220 | P32521 | Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1191 | 1480 | 1331 | 1338 | 8 | QANTSNEK | 79.93 |
| DP02220 | P32521 | Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1191 | 1480 | 1376 | 1388 | 13 | SAPAIATAVQKSG | 77.26 |
| DP02220 | P32521 | Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1191 | 1480 | 1407 | 1425 | 19 | TQQASTSEPIIAHVDNYNG | 82.17 |
| DP02220 | P32521 | Actin cytoskeleton-regulatory complex protein PAN1 (Mitochondrial distribution of proteins protein 3) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1191 | 1480 | 1439 | 1446 | 8 | DDVLSIPE | 78.39 |
| DP02224 | P29375 | Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A) | Homo sapiens (Human) | 184 | 360 | 194 | 200 | 7 | PEVLSTD | 74.58 |
| DP02224 | P29375 | Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A) | Homo sapiens (Human) | 184 | 360 | 209 | 215 | 7 | TRMNILP | 80.27 |
| DP02224 | P29375 | Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A) | Homo sapiens (Human) | 184 | 360 | 237 | 244 | 8 | KKLQIFGA | 77.01 |
| DP02224 | P29375 | Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A) | Homo sapiens (Human) | 184 | 360 | 271 | 279 | 9 | RSDAFNMQM | 76.51 |
| DP02224 | P29375 | Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A) | Homo sapiens (Human) | 184 | 360 | 286 | 299 | 14 | LSVNFVDLYVCMFC | 86.79 |
| DP02224 | P29375 | Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) (histone H3-trimethyl-L-lysine(4) demethylase 5A) | Homo sapiens (Human) | 184 | 360 | 317 | 325 | 9 | SYHTFCLIP | 88.63 |
| DP02226 | P24385 | G1/S-specific cyclin-D1 (B-cell lymphoma 1 protein) (BCL-1) (BCL-1 oncogene) (PRAD1 oncogene) | Homo sapiens (Human) | 1 | 24 | 3 | 19 | 17 | HQLLCCEVETIRRAYPD | 78.79 |
| DP02233 | Q13547 | Histone deacetylase 1 (HD1) (EC 3.5.1.98) | Homo sapiens (Human) | 377 | 482 | 380 | 386 | 7 | QMQAIPE | 83.28 |
| DP02233 | Q13547 | Histone deacetylase 1 (HD1) (EC 3.5.1.98) | Homo sapiens (Human) | 377 | 482 | 403 | 426 | 24 | KRISICSSDKRIACEEEFSDSEEE | 76.06 |
| DP02234 | P08476 | Inhibin beta A chain (Activin beta-A chain) (Erythroid differentiation protein) (EDF) | Homo sapiens (Human) | 359 | 386 | 363 | 377 | 15 | GSSLSFHSTVINHYR | 80.91 |
| DP02247 | P10721 | Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117) | Homo sapiens (Human) | 544 | 565 | 553 | 560 | 8 | YEVQWKVV | 79.6 |
| DP02248 | Q8RWK8 | Coilin (Atcoilin) | Arabidopsis thaliana (Mouse-ear cress) | 117 | 350 | 123 | 144 | 22 | GEMLLANEEFQKETGGYESESE | 83.55 |
| DP02248 | Q8RWK8 | Coilin (Atcoilin) | Arabidopsis thaliana (Mouse-ear cress) | 117 | 350 | 194 | 201 | 8 | TAVVSNVV | 75.33 |
| DP02248 | Q8RWK8 | Coilin (Atcoilin) | Arabidopsis thaliana (Mouse-ear cress) | 117 | 350 | 210 | 217 | 8 | LDVQSANN | 75.25 |
| DP02248 | Q8RWK8 | Coilin (Atcoilin) | Arabidopsis thaliana (Mouse-ear cress) | 117 | 350 | 235 | 241 | 7 | SQQEESK | 74.58 |
| DP02248 | Q8RWK8 | Coilin (Atcoilin) | Arabidopsis thaliana (Mouse-ear cress) | 117 | 350 | 246 | 253 | 8 | LCQLSAET | 76.17 |
| DP02248 | Q8RWK8 | Coilin (Atcoilin) | Arabidopsis thaliana (Mouse-ear cress) | 117 | 350 | 279 | 292 | 14 | KEELLQTQLVVAPS | 76.25 |
| DP02248 | Q8RWK8 | Coilin (Atcoilin) | Arabidopsis thaliana (Mouse-ear cress) | 117 | 350 | 294 | 300 | 7 | KPVITID | 79.65 |
| DP02248 | Q8RWK8 | Coilin (Atcoilin) | Arabidopsis thaliana (Mouse-ear cress) | 117 | 350 | 314 | 322 | 9 | NQQAEEVSD | 75.66 |
| DP02253 | Q96F86 | Enhancer of mRNA-decapping protein 3 (LSM16 homolog) (YjeF N-terminal domain-containing protein 2) (YjeF_N2) (hYjeF_N2) (YjeF domain-containing protein 1) | Homo sapiens (Human) | 203 | 258 | 206 | 226 | 21 | FEGNLALFDKAAVFEEIDTYE | 85.67 |
| DP02253 | Q96F86 | Enhancer of mRNA-decapping protein 3 (LSM16 homolog) (YjeF N-terminal domain-containing protein 2) (YjeF_N2) (hYjeF_N2) (YjeF domain-containing protein 1) | Homo sapiens (Human) | 203 | 258 | 246 | 253 | 8 | HDENILES | 78.43 |
| DP02262 | P42226 | Signal transducer and activator of transcription 6 (IL-4 Stat) | Homo sapiens (Human) | 783 | 814 | 783 | 792 | 10 | GTWIGEDIFP | 77.59 |
| DP02263 | P32120 | Beta-arrestin-2 (Arrestin beta-2) (Arrestin-3) | Bos taurus (Bovine) | 350 | 393 | 381 | 388 | 8 | DTNLIEFE | 84.57 |
| DP02267 | Q8IVG9 | Humanin (Humanin mitochondrial) (HNM) | Homo sapiens (Human) | 1 | 24 | 5 | 17 | 13 | GFSCLLLLTSEID | 81.55 |
| DP02269 | Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | Homo sapiens (Human) | 1 | 43 | 4 | 14 | 11 | HLWKSQLCEMV | 79.93 |
| DP02269 | Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | Homo sapiens (Human) | 1 | 43 | 24 | 31 | 8 | QDVLGEES | 74.25 |
| DP02269 | Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | Homo sapiens (Human) | 44 | 111 | 67 | 74 | 8 | QSNQILRE | 75.25 |
| DP02269 | Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | Homo sapiens (Human) | 44 | 111 | 78 | 86 | 9 | ELLHFQASQ | 82.5 |
| DP02269 | Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | Homo sapiens (Human) | 44 | 111 | 88 | 98 | 11 | EEKEFLMCKFQ | 78.66 |
| DP02271 | P29131 | Cell division protein FtsN | Escherichia coli (strain K12) | 124 | 215 | 134 | 144 | 11 | TQLVEVPWNEQ | 76.83 |
| DP02271 | P29131 | Cell division protein FtsN | Escherichia coli (strain K12) | 124 | 215 | 159 | 185 | 27 | AQQLAEQQRLAQQSRTTEQSWQQQTRT | 76.58 |
| DP02271 | P29131 | Cell division protein FtsN | Escherichia coli (strain K12) | 124 | 215 | 203 | 210 | 8 | SQQPYQDL | 77.59 |
| DP02272 | Q7KLE5 | Endophilin-A (SH3 domain-containing GRB2-like protein) | Drosophila melanogaster (Fruit fly) | 242 | 452 | 267 | 284 | 18 | KLNNANINSNYQNQITTN | 84.26 |
| DP02272 | Q7KLE5 | Endophilin-A (SH3 domain-containing GRB2-like protein) | Drosophila melanogaster (Fruit fly) | 242 | 452 | 321 | 328 | 8 | AALVSATP | 79.93 |
| DP02272 | Q7KLE5 | Endophilin-A (SH3 domain-containing GRB2-like protein) | Drosophila melanogaster (Fruit fly) | 242 | 452 | 348 | 360 | 13 | GLNASAKATTTTQ | 79.93 |
| DP02272 | Q7KLE5 | Endophilin-A (SH3 domain-containing GRB2-like protein) | Drosophila melanogaster (Fruit fly) | 242 | 452 | 367 | 374 | 8 | KAVVSEAV | 79.43 |
| DP02272 | Q7KLE5 | Endophilin-A (SH3 domain-containing GRB2-like protein) | Drosophila melanogaster (Fruit fly) | 242 | 452 | 382 | 389 | 8 | AAVAASVT | 79.52 |
| DP02272 | Q7KLE5 | Endophilin-A (SH3 domain-containing GRB2-like protein) | Drosophila melanogaster (Fruit fly) | 242 | 452 | 397 | 412 | 16 | AQINGNNNEPSIVKEG | 77.05 |
| DP02272 | Q7KLE5 | Endophilin-A (SH3 domain-containing GRB2-like protein) | Drosophila melanogaster (Fruit fly) | 242 | 452 | 433 | 442 | 10 | AANNGNSIEE | 75.15 |
| DP02290 | Q92905 | COP9 signalosome complex subunit 5 (SGN5) (Signalosome subunit 5) (EC 3.4.-.-) (Jun activation domain-binding protein 1) | Homo sapiens (Human) | 198 | 218 | 199 | 213 | 15 | GPSEYQTIPLNKIED | 79.6 |
| DP02291 | P04486 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1) | 412 | 490 | 416 | 427 | 12 | TDVSLGDELHLD | 74.94 |
| DP02291 | P04486 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1) | 412 | 490 | 471 | 485 | 15 | ADFEFEQMFTDALGI | 77.86 |
| DP02291 | P04486 | Tegument protein VP16 (Alpha trans-inducing protein) (Alpha-TIF) (ICP25) (Vmw65) | Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1) | 456 | 490 | 471 | 485 | 15 | ADFEFEQMFTDALGI | 77.86 |
| DP02292 | Q96PU5 | E3 ubiquitin-protein ligase NEDD4-like (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase NED4L) (NEDD4.2) (Nedd4-2) | Homo sapiens (Human) | 400 | 480 | 402 | 408 | 7 | YYVNHNN | 86.62 |
| DP02292 | Q96PU5 | E3 ubiquitin-protein ligase NEDD4-like (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase NED4L) (NEDD4.2) (Nedd4-2) | Homo sapiens (Human) | 400 | 480 | 426 | 439 | 14 | SGSATNSNNHLIEP | 78.36 |
| DP02295 | Q05471 | Helicase SWR1 (EC 3.6.4.12) (Swi2/Snf2-related 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 599 | 627 | 599 | 607 | 9 | SVGLSALFG | 83.24 |
| DP02296 | P60761 | Neurogranin (Ng) (RC3) Cleaved into: NEUG(55-78) | Mus musculus (Mouse) | 26 | 47 | 29 | 39 | 11 | AAAKIQASFRG | 81.97 |
| DP02299 | P50498 | Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen) | Plasmodium falciparum (isolate 3D7) | 1 | 272 | 5 | 40 | 36 | KTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIR | 84.61 |
| DP02299 | P50498 | Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen) | Plasmodium falciparum (isolate 3D7) | 1 | 272 | 238 | 267 | 30 | GAATSLLNNSSNIASINKFVVLISATLVLS | 86.63 |
| DP02299 | P50498 | Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen) | Plasmodium falciparum (isolate 3D7) | 1 | 270 | 5 | 40 | 36 | KTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIR | 84.61 |
| DP02299 | P50498 | Merozoite surface antigen 2 (MSA-2) (45 kDa merozoite surface antigen) | Plasmodium falciparum (isolate 3D7) | 1 | 270 | 238 | 265 | 28 | GAATSLLNNSSNIASINKFVVLISATLV | 85.99 |
| DP02304 | Q9Y5X1 | Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A) | Homo sapiens (Human) | 73 | 183 | 75 | 104 | 30 | ADQAFLDSLSASTAQASSSAASNNHQVGSG | 76.42 |
| DP02304 | Q9Y5X1 | Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A) | Homo sapiens (Human) | 73 | 183 | 108 | 122 | 15 | WSAWSASKSGNWESS | 78.06 |
| DP02304 | Q9Y5X1 | Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A) | Homo sapiens (Human) | 73 | 183 | 134 | 155 | 22 | AQRNTNTPNNWDTAFGHPQAYQ | 80.3 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 1 | 29 | 29 | MRIIILALLIVCTIINYYCAVQNNGNKSL | 85.5 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 64 | 76 | 13 | NDNNEMNNENAES | 76.18 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 80 | 96 | 17 | QGENSNNQEQLNENVHA | 78.44 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 98 | 104 | 7 | DDAMYEG | 79.93 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 116 | 126 | 11 | VDANNNEQEYG | 82.12 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 149 | 174 | 26 | GNDNINNNDNFNNNDNYNDNDNFNEE | 79.07 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 184 | 190 | 7 | EDELTEG | 75.25 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 201 | 216 | 16 | EEATINEMGKITNPFE | 78.39 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 236 | 246 | 11 | NLQSFLSSLTG | 77.29 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 258 | 265 | 8 | DMMNIFGV | 89.84 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 284 | 290 | 7 | KQINELK | 79.93 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 314 | 331 | 18 | NDLLKNKQLLKEAISKLT | 77.31 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 358 | 373 | 16 | MMKMFNALSNENGNLD | 82.55 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 380 | 389 | 10 | TDGSFDSFND | 80.17 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 391 | 399 | 9 | VDNNLVPSN | 85.62 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 420 | 443 | 24 | DDKSFVVNSKYADNSFEDKFNTFD | 84.39 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 447 | 470 | 24 | DDVKYELFGENEEAEELNNNTTTA | 83.1 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 475 | 483 | 9 | DANNSVNTQ | 80.6 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 487 | 539 | 53 | GEEESFSANEENINNNNNHNNKNYNNYNTSQQEEDDNSFNENDEPLISSSQFD | 81.2 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 562 | 584 | 23 | LDLESTNYGSNSSSSMSNNYNSK | 82.11 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 606 | 623 | 18 | GKVSFDMATLQKTIKNFG | 81.61 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 1 | 667 | 625 | 642 | 18 | ADNEIVQNILKKYVTIDN | 90.77 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 824 | 993 | 828 | 841 | 14 | EGGNFKSPLYDKYG | 77.21 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 824 | 993 | 843 | 861 | 19 | KLQKFKRQRAFNILKQWRA | 85 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 824 | 993 | 879 | 893 | 15 | KEFDFSKNYNFSSKN | 81.81 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 824 | 993 | 895 | 913 | 19 | GGVTMFSKDQLEDMVKNFG | 78.88 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 824 | 993 | 927 | 935 | 9 | KENPFVPTN | 75.25 |
| DP02305 | Q8ILA1 | Translocon component PTEX150 | Plasmodium falciparum (isolate 3D7) | 824 | 993 | 946 | 954 | 9 | MDNGYVTFD | 91.19 |
| DP02306 | Q8TBC4 | NEDD8-activating enzyme E1 catalytic subunit (EC 6.2.1.64) (NEDD8-activating enzyme E1C) (Ubiquitin-activating enzyme E1C) (Ubiquitin-like modifier-activating enzyme 3) (Ubiquitin-activating enzyme 3) | Homo sapiens (Human) | 405 | 463 | 410 | 423 | 14 | NRTLYLQSVTSIEE | 75.56 |
| DP02306 | Q8TBC4 | NEDD8-activating enzyme E1 catalytic subunit (EC 6.2.1.64) (NEDD8-activating enzyme E1C) (Ubiquitin-activating enzyme E1C) (Ubiquitin-like modifier-activating enzyme 3) (Ubiquitin-activating enzyme 3) | Homo sapiens (Human) | 405 | 463 | 441 | 458 | 18 | GQELAVADVTTPQTVLFK | 79.23 |
| DP02309 | Q96RF0 | Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1) | Homo sapiens (Human) | 59 | 224 | 103 | 110 | 8 | AFQALLQP | 81.73 |
| DP02309 | Q96RF0 | Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1) | Homo sapiens (Human) | 59 | 224 | 124 | 134 | 11 | AGFPYGGGALQ | 79.93 |
| DP02309 | Q96RF0 | Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1) | Homo sapiens (Human) | 59 | 224 | 137 | 148 | 12 | PQQLYGGYQASQ | 82.02 |
| DP02309 | Q96RF0 | Sorting nexin-18 (SH3 and PX domain-containing protein 3B) (Sorting nexin-associated Golgi protein 1) | Homo sapiens (Human) | 59 | 224 | 189 | 197 | 9 | AAGRYRLST | 75.25 |
| DP02311 | Q7DD77 | PilP protein | Neisseria meningitidis serogroup B (strain MC58) | 20 | 84 | 22 | 29 | 8 | DLNEWMAQ | 76.63 |
| DP02311 | Q7DD77 | PilP protein | Neisseria meningitidis serogroup B (strain MC58) | 20 | 84 | 34 | 42 | 9 | AKAEIIPFQ | 78.08 |
| DP02311 | Q7DD77 | PilP protein | Neisseria meningitidis serogroup B (strain MC58) | 20 | 84 | 48 | 54 | 7 | VAPVYSP | 77.93 |
| DP02311 | Q7DD77 | PilP protein | Neisseria meningitidis serogroup B (strain MC58) | 20 | 84 | 59 | 66 | 8 | GPNAFDFR | 78.68 |
| DP02311 | Q7DD77 | PilP protein | Neisseria meningitidis serogroup B (strain MC58) | 20 | 69 | 22 | 29 | 8 | DLNEWMAQ | 76.63 |
| DP02311 | Q7DD77 | PilP protein | Neisseria meningitidis serogroup B (strain MC58) | 20 | 69 | 34 | 42 | 9 | AKAEIIPFQ | 78.08 |
| DP02311 | Q7DD77 | PilP protein | Neisseria meningitidis serogroup B (strain MC58) | 20 | 69 | 48 | 54 | 7 | VAPVYSP | 77.93 |
| DP02312 | Q8T9B6 | LDLR chaperone boca | Drosophila melanogaster (Fruit fly) | 19 | 91 | 46 | 52 | 7 | LDQWEED | 79.5 |
| DP02312 | Q8T9B6 | LDLR chaperone boca | Drosophila melanogaster (Fruit fly) | 31 | 91 | 46 | 52 | 7 | LDQWEED | 79.5 |
| DP02313 | Q8IG33 | Boca/MESD chaperone for YWTD beta-propeller-EGF | Caenorhabditis elegans | 18 | 88 | 26 | 45 | 20 | DLSSYTDAELEKLYEEWEEN | 78.7 |
| DP02316 | O43663 | Protein regulator of cytokinesis 1 | Homo sapiens (Human) | 467 | 620 | 487 | 514 | 28 | KLNTTTMSNATANSSIRPIFGGTVYHSP | 78.32 |
| DP02316 | O43663 | Protein regulator of cytokinesis 1 | Homo sapiens (Human) | 467 | 620 | 543 | 558 | 16 | GANKENLELNGSILSG | 77.68 |
| DP02316 | O43663 | Protein regulator of cytokinesis 1 | Homo sapiens (Human) | 467 | 620 | 566 | 583 | 18 | LQRNFSINSVASTYSEFA | 86.64 |
| DP02316 | O43663 | Protein regulator of cytokinesis 1 | Homo sapiens (Human) | 467 | 620 | 608 | 615 | 8 | ATSGILNS | 78.72 |
| DP02317 | Q03689 | Heterokaryon incompatibility protein s (Small s protein) (Vegetative incompatibility protein s) | Podospora anserina (Pleurage anserina) | 228 | 289 | 242 | 267 | 26 | GNVVTAAALHGGIRISDQTTNSVETV | 77.91 |
| DP02317 | Q03689 | Heterokaryon incompatibility protein s (Small s protein) (Vegetative incompatibility protein s) | Podospora anserina (Pleurage anserina) | 228 | 289 | 273 | 284 | 12 | SRVLIGNEYGGK | 81.63 |
| DP02322 | A0LU48 | Depupylase (EC 3.4.-.-) | Acidothermus cellulolyticus (strain ATCC 43068 / 11B) | 36 | 80 | 45 | 53 | 9 | ARWDFEEEN | 75.59 |
| DP02323 | Q5L0X5 | Cell division protein DivIB | Geobacillus kaustophilus (strain HTA426) | 233 | 261 | 233 | 246 | 14 | KGVIHLEVGSYFVP | 84.73 |
| DP02327 | Q00169 | Phosphatidylinositol transfer protein alpha isoform (PI-TP-alpha) (PtdIns transfer protein alpha) (PtdInsTP alpha) | Homo sapiens (Human) | 119 | 190 | 136 | 144 | 9 | VEAVYIDIA | 82.53 |
| DP02327 | Q00169 | Phosphatidylinositol transfer protein alpha isoform (PI-TP-alpha) (PtdIns transfer protein alpha) (PtdInsTP alpha) | Homo sapiens (Human) | 119 | 190 | 178 | 185 | 8 | KQELVNQK | 75.59 |
| DP02327 | Q00169 | Phosphatidylinositol transfer protein alpha isoform (PI-TP-alpha) (PtdIns transfer protein alpha) (PtdInsTP alpha) | Homo sapiens (Human) | 233 | 270 | 235 | 241 | 7 | WVDLTMD | 74.25 |
| DP02328 | P53779 | Mitogen-activated protein kinase 10 (MAP kinase 10) (MAPK 10) (EC 2.7.11.24) (MAP kinase p49 3F12) (Stress-activated protein kinase 1b) (SAPK1b) (Stress-activated protein kinase JNK3) (c-Jun N-terminal kinase 3) | Homo sapiens (Human) | 206 | 231 | 213 | 226 | 14 | TAGTSFMMTPYVVT | 75.47 |
| DP02329 | K7J0R2 | Uncharacterized protein | Nasonia vitripennis | 351 | 385 | 364 | 376 | 13 | DGSVFDNNDDSYL | 77.1 |
| DP02330 | C4PB33 | Vitellogenin | Bombus ignitus (Bumblebee) | 361 | 395 | 364 | 390 | 27 | KGQNYRSLSSDSSSSSSFSNSEEDHYW | 78.79 |
| DP02331 | O17428 | Vitellogenin | Pimpla nipponica | 356 | 397 | 383 | 392 | 10 | LESNEEQLYW | 84.58 |
| DP02332 | Q9BUQ8 | Probable ATP-dependent RNA helicase DDX23 (EC 3.6.4.13) (100 kDa U5 snRNP-specific protein) (DEAD box protein 23) (PRP28 homolog) (U5-100kD) | Homo sapiens (Human) | 1 | 257 | 143 | 149 | 7 | SLEELLA | 79.36 |
| DP02332 | Q9BUQ8 | Probable ATP-dependent RNA helicase DDX23 (EC 3.6.4.13) (100 kDa U5 snRNP-specific protein) (DEAD box protein 23) (PRP28 homolog) (U5-100kD) | Homo sapiens (Human) | 1 | 257 | 246 | 252 | 7 | ELHAIKE | 77.26 |
| DP02334 | Q98148 | "Kaposis sarcoma-associated herpes-like virus ORF73 homolog" | "Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)" | 1110 | 1162 | 1118 | 1125 | 8 | ARLAWEAS | 79.31 |
| DP02334 | Q98148 | "Kaposis sarcoma-associated herpes-like virus ORF73 homolog" | "Human herpesvirus 8 (HHV-8) (Kaposis sarcoma-associated herpesvirus)" | 1110 | 1162 | 1128 | 1140 | 13 | LAGNLQSSIVKFK | 85.34 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 1 | 342 | 11 | 38 | 28 | LEGIETDTQPILLQSCTGLVTHRLLEED | 73.91 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 1 | 342 | 84 | 93 | 10 | ADSPYSSGIM | 77.26 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 1 | 342 | 95 | 109 | 15 | TQSLESKAERIARYK | 77.93 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 1 | 342 | 116 | 125 | 10 | LAEKYGLTLD | 81.94 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 1 | 342 | 163 | 174 | 12 | AGSSYSRTELSG | 86.62 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 1 | 342 | 196 | 204 | 9 | TEVLLNAEN | 83.61 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 1 | 342 | 224 | 234 | 11 | GEVSSSFSFSG | 79.72 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 1 | 342 | 284 | 290 | 7 | KHEWFLQ | 87.63 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 1 | 342 | 297 | 305 | 9 | TPSLINWPS | 78.67 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 11 | 174 | 11 | 38 | 28 | LEGIETDTQPILLQSCTGLVTHRLLEED | 73.91 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 11 | 174 | 84 | 93 | 10 | ADSPYSSGIM | 77.26 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 11 | 174 | 95 | 109 | 15 | TQSLESKAERIARYK | 77.93 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 11 | 174 | 116 | 125 | 10 | LAEKYGLTLD | 81.94 |
| DP02337 | O46385 | Supervillin (Archvillin) (p205/p250) | Bos taurus (Bovine) | 11 | 174 | 163 | 169 | 7 | AGSSYSR | 86.62 |
| DP02340 | A0A3N4AZ09 | Putative exported protein | Yersinia pestis | 21 | 112 | 26 | 53 | 28 | KVCFYMDDDYNGESLCAAQGNSVASIPD | 78.69 |
| DP02340 | A0A3N4AZ09 | Putative exported protein | Yersinia pestis | 21 | 112 | 56 | 65 | 10 | NDRISSISIP | 83.68 |
| DP02340 | A0A3N4AZ09 | Putative exported protein | Yersinia pestis | 21 | 112 | 67 | 107 | 41 | GLVVTVYEDVDFLGASRSFEADVDLVSDKDLIYLNDNISAF | 80.49 |
| DP02340 | A0A3N4AZ09 | Putative exported protein | Yersinia pestis | 110 | 215 | 111 | 142 | 32 | KAVCFYGESNFTGDSLCLSSGEQFDLYRGNYP | 82.31 |
| DP02340 | A0A3N4AZ09 | Putative exported protein | Yersinia pestis | 110 | 215 | 145 | 163 | 19 | KQSHLVNPLNDEVYSIKIP | 77.59 |
| DP02340 | A0A3N4AZ09 | Putative exported protein | Yersinia pestis | 110 | 215 | 165 | 188 | 24 | GMQTTVYEDDDYNGKYFVLTEDYT | 79.4 |
| DP02340 | A0A3N4AZ09 | Putative exported protein | Yersinia pestis | 110 | 215 | 190 | 203 | 14 | DDLLIIRMNNKISS | 81.82 |
| DP02341 | A0A178W0D3 | Plastid transcriptionally active 4 | Arabidopsis thaliana (Mouse-ear cress) | 221 | 259 | 231 | 238 | 8 | TVAASTRY | 73.91 |
| DP02341 | A0A178W0D3 | Plastid transcriptionally active 4 | Arabidopsis thaliana (Mouse-ear cress) | 221 | 259 | 241 | 252 | 12 | KDSEIENELNEL | 80.52 |
| DP02345 | Q92804 | TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) | Homo sapiens (Human) | 1 | 198 | 13 | 21 | 9 | EQQSYSTYG | 88.93 |
| DP02345 | Q92804 | TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) | Homo sapiens (Human) | 1 | 198 | 24 | 84 | 61 | GSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYN | 80.22 |
| DP02345 | Q92804 | TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) | Homo sapiens (Human) | 1 | 198 | 88 | 94 | 7 | QQQNMES | 77.26 |
| DP02345 | Q92804 | TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) | Homo sapiens (Human) | 1 | 198 | 112 | 123 | 12 | QQDSYDQQSGYD | 80.1 |
| DP02345 | Q92804 | TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) | Homo sapiens (Human) | 1 | 198 | 125 | 136 | 12 | HQGSYDEQSNYD | 90.47 |
| DP02345 | Q92804 | TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) | Homo sapiens (Human) | 1 | 198 | 139 | 160 | 22 | HDSYSQNQQSYHSQRENYSHHT | 82.49 |
| DP02346 | Q9BTL3 | RNA guanine-N7 methyltransferase activating subunit | Homo sapiens | 2 | 45 | 11 | 29 | 19 | FEEMFASRFTENDKEYQEY | 81.18 |
| DP02353 | P0DMV9 | Heat shock 70 kDa protein 1B (Heat shock 70 kDa protein 2) (HSP70-2) (HSP70.2) | Homo sapiens (Human) | 229 | 306 | 236 | 246 | 11 | RLVNHFVEEFK | 84.01 |
| DP02353 | P0DMV9 | Heat shock 70 kDa protein 1B (Heat shock 70 kDa protein 2) (HSP70-2) (HSP70.2) | Homo sapiens (Human) | 229 | 306 | 279 | 299 | 21 | QASLEIDSLFEGIDFYTSITR | 82.04 |
| DP02355 | P36080 | Ribosomal RNA-processing protein 14 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 1 | 295 | 12 | 39 | 28 | NSSAFDGLLALIPAKYYYDEKSQEQWKA | 84.71 |
| DP02355 | P36080 | Ribosomal RNA-processing protein 14 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 1 | 295 | 130 | 136 | 7 | DIKVIFD | 89.44 |
| DP02355 | P36080 | Ribosomal RNA-processing protein 14 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 1 | 295 | 181 | 187 | 7 | LQAKISD | 89.63 |
| DP02355 | P36080 | Ribosomal RNA-processing protein 14 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 1 | 295 | 197 | 205 | 9 | SREAILAQR | 76.66 |
| DP02355 | P36080 | Ribosomal RNA-processing protein 14 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 1 | 295 | 224 | 231 | 8 | DQDEIASD | 79.93 |
| DP02355 | P36080 | Ribosomal RNA-processing protein 14 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 1 | 295 | 261 | 272 | 12 | DGVMFQNIIFDD | 89.66 |
| DP02356 | P78794 | Pre-mRNA-splicing factor cwf15 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 71 | 222 | 80 | 89 | 10 | NSKLIEGFTS | 76.72 |
| DP02356 | P78794 | Pre-mRNA-splicing factor cwf15 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 71 | 222 | 100 | 114 | 15 | VEVDYQELLRQTLEA | 80.56 |
| DP02356 | P78794 | Pre-mRNA-splicing factor cwf15 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 71 | 222 | 141 | 149 | 9 | TESNSQESV | 76.25 |
| DP02356 | P78794 | Pre-mRNA-splicing factor cwf15 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 71 | 222 | 167 | 179 | 13 | TQQLLRELENIKQ | 81.61 |
| DP02356 | P78794 | Pre-mRNA-splicing factor cwf15 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 71 | 222 | 200 | 214 | 15 | REREIAFGNELLNKA | 79.82 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2046 | 2055 | 10 | QRQQIAEIEK | 84.08 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2060 | 2072 | 13 | NAQVTAVTTKTTN | 80.09 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2077 | 2093 | 17 | EMVVTTTSAYENEKFSS | 78.63 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2098 | 2144 | 47 | RNRAISSISLPLRTKNIYVNSDNISETFPYTYILPQNLLRKFVTISD | 81.92 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2147 | 2155 | 9 | TQVAGYMYG | 80.94 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2163 | 2173 | 11 | QIKEIRCIALV | 75.55 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2175 | 2186 | 12 | QLGSIRNVQLPS | 77.26 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2192 | 2198 | 7 | LQPSILE | 77.26 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2202 | 2230 | 29 | PLGWIHTQSSELPYLSSVDVTTHAKILSS | 77.81 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2237 | 2258 | 22 | KAVTLTVSYIPGSISLAAYTVS | 87.61 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2269 | 2281 | 13 | MDINSDEAIGYEP | 78.24 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2286 | 2327 | 42 | KCQLLLSDRIQGFFLVPEEGVWNYNFNGASFSPKMTYSLKLD | 80.9 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2331 | 2337 | 7 | PFFALEH | 74.3 |
| DP02357 | O14187 | Pre-mRNA-splicing factor spp42 (Complexed with cdc5 protein 6) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 2044 | 2363 | 2340 | 2356 | 17 | THVISYTELETNDRLEE | 80.9 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 1 | 299 | 1 | 21 | 21 | MDAGFFRGTSAEQDNRFSNKQ | 80.12 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 1 | 299 | 26 | 36 | 11 | KQLKFAECLEK | 81.36 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 1 | 299 | 42 | 77 | 36 | KVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEV | 80.91 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 1 | 299 | 83 | 142 | 60 | KMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLA | 79.33 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 1 | 299 | 235 | 247 | 13 | VQEATSTSDILKV | 80.27 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 1 | 31 | 1 | 21 | 21 | MDAGFFRGTSAEQDNRFSNKQ | 80.12 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 127 | 904 | 235 | 247 | 13 | VQEATSTSDILKV | 80.27 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 127 | 904 | 459 | 466 | 8 | KVELSESE | 75.25 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 127 | 904 | 489 | 495 | 7 | NQQSSSD | 76.25 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 127 | 904 | 835 | 863 | 29 | KAVAAAAAAAVTPAAIAAATTTLAQEEPV | 76.81 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 351 | 688 | 459 | 466 | 8 | KVELSESE | 75.25 |
| DP02359 | Q8IYB3 | Serine/arginine repetitive matrix protein 1 | Homo sapiens | 351 | 688 | 489 | 495 | 7 | NQQSSSD | 76.25 |
| DP02369 | Q00780 | Collagen alpha-1(VIII) chain Cleaved into: Vastatin | Mus musculus (Mouse) | 570 | 612 | 580 | 586 | 7 | PQGEYLP | 80.27 |
| DP02371 | O08583 | THO complex subunit 4 | Mus musculus | 77 | 182 | 87 | 96 | 10 | QHDLFDSGFG | 75.45 |
| DP02371 | O08583 | THO complex subunit 4 | Mus musculus | 77 | 182 | 99 | 132 | 34 | AGVETGGKLLVSNLDFGVSDADIQELFAEFGTLK | 82.24 |
| DP02371 | O08583 | THO complex subunit 4 | Mus musculus | 77 | 182 | 161 | 168 | 8 | AMKQYNGV | 75.25 |
| DP02371 | O08583 | THO complex subunit 4 | Mus musculus | 77 | 104 | 87 | 96 | 10 | QHDLFDSGFG | 75.45 |
| DP02372 | Q88MI5 | Putative Killer protein | Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) | 1 | 22 | 10 | 17 | 8 | TEALFTTG | 86.08 |
| DP02373 | Q92837 | Proto-oncogene FRAT1 | Homo sapiens | 1 | 198 | 22 | 38 | 17 | EDSFLLLQQSVALGSSG | 76.08 |
| DP02373 | Q92837 | Proto-oncogene FRAT1 | Homo sapiens | 1 | 198 | 43 | 60 | 18 | LVAQIGETLQLDAAQHSP | 75.07 |
| DP02373 | Q92837 | Proto-oncogene FRAT1 | Homo sapiens | 1 | 198 | 128 | 141 | 14 | YCVAELATGPSALS | 77.9 |
| DP02373 | Q92837 | Proto-oncogene FRAT1 | Homo sapiens | 188 | 226 | 202 | 216 | 15 | LLQQLVLSGNLIKEA | 79.26 |
| DP02380 | O23661 | Auxin response factor 3 | Arabidopsis thaliana | 388 | 594 | 390 | 403 | 14 | SGSISNSGSFVTTG | 80.29 |
| DP02380 | O23661 | Auxin response factor 3 | Arabidopsis thaliana | 388 | 594 | 408 | 414 | 7 | RIGFSSG | 73.91 |
| DP02380 | O23661 | Auxin response factor 3 | Arabidopsis thaliana | 388 | 594 | 427 | 451 | 25 | TDFEESLRFQRVLQGQEIFPGFINT | 81.08 |
| DP02380 | O23661 | Auxin response factor 3 | Arabidopsis thaliana | 388 | 594 | 470 | 478 | 9 | GDSYGFHKV | 75.25 |
| DP02380 | O23661 | Auxin response factor 3 | Arabidopsis thaliana | 388 | 594 | 480 | 492 | 13 | QGQETVPAYSITD | 81.32 |
| DP02380 | O23661 | Auxin response factor 3 | Arabidopsis thaliana | 388 | 594 | 500 | 517 | 18 | SQRNIWCGPFQNFSTRIL | 81.25 |
| DP02380 | O23661 | Auxin response factor 3 | Arabidopsis thaliana | 388 | 594 | 526 | 536 | 11 | SSVLLTNSNSP | 79.08 |
| DP02380 | O23661 | Auxin response factor 3 | Arabidopsis thaliana | 388 | 594 | 549 | 569 | 21 | RCRLFGFPLTDETTAVASATA | 77.61 |
| DP02380 | O23661 | Auxin response factor 3 | Arabidopsis thaliana | 388 | 594 | 582 | 589 | 8 | SAVQSNHH | 75.25 |
| DP02381 | O60706-2 | Isoform SUR2B of ATP-binding cassette sub-family C member 9 | Homo sapiens | 618 | 669 | 651 | 657 | 7 | HLDSYEQ | 79.36 |
| DP02382 | Q15046 | Lysine--tRNA ligase | Homo sapiens | 1 | 70 | 4 | 12 | 9 | VQAAEVKVD | 79.93 |
| DP02382 | Q15046 | Lysine--tRNA ligase | Homo sapiens | 1 | 70 | 48 | 60 | 13 | LSQATAAATNHTT | 75.92 |
| DP02383 | P08631 | Tyrosine-protein kinase HCK | Homo sapiens | 2 | 79 | 25 | 44 | 20 | MKSKFLQVGGNTFSKTETSA | 77.29 |
| DP02384 | P82804 | Partner of Y14 and mago (DmPYM) (Protein within the bgcn gene intron) | Drosophila melanogaster (Fruit fly) | 33 | 58 | 38 | 44 | 7 | EVPLYES | 79.26 |
| DP02386 | Q9NYB9 | Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) | Homo sapiens (Human) | 156 | 513 | 237 | 245 | 9 | RNRTYSSSG | 75.92 |
| DP02386 | Q9NYB9 | Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) | Homo sapiens (Human) | 156 | 513 | 346 | 354 | 9 | HPVQFYSMN | 79.19 |
| DP02386 | Q9NYB9 | Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) | Homo sapiens (Human) | 156 | 513 | 382 | 395 | 14 | SLQNQMNGGPFYSQ | 76.45 |
| DP02386 | Q9NYB9 | Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) | Homo sapiens (Human) | 156 | 513 | 431 | 438 | 8 | AAVVEYSD | 82.32 |
| DP02386 | Q9NYB9 | Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) | Homo sapiens (Human) | 156 | 513 | 455 | 464 | 10 | KVVAIYDYTK | 87.39 |
| DP02386 | Q9NYB9 | Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) | Homo sapiens (Human) | 156 | 513 | 467 | 483 | 17 | EDELSFQEGAIIYVIKK | 84.73 |
| DP02386 | Q9NYB9 | Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) | Homo sapiens (Human) | 156 | 513 | 485 | 508 | 24 | DDGWYEGVMNGVTGLFPGNYVESI | 81.66 |
| DP02390 | Q9NQS7 | Inner centromere protein | Homo sapiens (Human) | 853 | 903 | 853 | 862 | 10 | QAIIHQYYHP | 83.91 |
| DP02390 | Q9NQS7 | Inner centromere protein | Homo sapiens (Human) | 853 | 903 | 864 | 873 | 10 | NLLELFGTIL | 91.1 |
| DP02390 | Q9NQS7 | Inner centromere protein | Homo sapiens (Human) | 853 | 903 | 876 | 884 | 9 | DLEDIFKKS | 79.64 |
| DP02391 | Q9Y580 | RNA-binding protein 7 | Homo sapiens | 90 | 266 | 93 | 101 | 9 | QDVSLSYPQ | 77.85 |
| DP02391 | Q9Y580 | RNA-binding protein 7 | Homo sapiens | 90 | 266 | 127 | 142 | 16 | SAQIIQRSFSSPENFQ | 79.83 |
| DP02391 | Q9Y580 | RNA-binding protein 7 | Homo sapiens | 90 | 266 | 152 | 161 | 10 | RQMSYGGKFG | 76.86 |
| DP02391 | Q9Y580 | RNA-binding protein 7 | Homo sapiens | 90 | 266 | 166 | 191 | 26 | DQSGFSPSVQSHSHSFNQSSSSQWRQ | 75.97 |
| DP02391 | Q9Y580 | RNA-binding protein 7 | Homo sapiens | 90 | 266 | 201 | 221 | 21 | RMNSYPYLADRHYSREQRYTD | 77.8 |
| DP02391 | Q9Y580 | RNA-binding protein 7 | Homo sapiens | 90 | 266 | 232 | 239 | 8 | RDDFFYED | 87.63 |
| DP02395 | P35201 | Inner kinetochore subunit MIF2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 331 | 438 | 378 | 409 | 32 | NEDIIERIESGGIENGEWLKHGILEANVKISD | 81.4 |
| DP02395 | P35201 | Inner kinetochore subunit MIF2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 331 | 438 | 415 | 430 | 16 | KDEIIAFAPNLSQTEQ | 92.43 |
| DP02395 | P35201 | Inner kinetochore subunit MIF2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 365 | 436 | 378 | 409 | 32 | NEDIIERIESGGIENGEWLKHGILEANVKISD | 81.4 |
| DP02395 | P35201 | Inner kinetochore subunit MIF2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 365 | 436 | 415 | 430 | 16 | KDEIIAFAPNLSQTEQ | 92.43 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1735 | 1918 | 1738 | 1746 | 9 | SLWKSVFSG | 78.78 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1735 | 1918 | 1789 | 1796 | 8 | RQLSFSED | 78.43 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1735 | 1918 | 1802 | 1809 | 8 | DDVLEKSS | 76.59 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1735 | 1918 | 1820 | 1830 | 11 | TEEELNAKLTR | 75.92 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1735 | 1918 | 1850 | 1856 | 7 | RAQIIQR | 76.68 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1735 | 1918 | 1858 | 1864 | 7 | LQQVEER | 74.58 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1735 | 1918 | 1893 | 1913 | 21 | LMQEWFKLVQEKNAMVRYESE | 80.12 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1881 | 1990 | 1893 | 1925 | 33 | LMQEWFKLVQEKNAMVRYESELMIFARELELED | 78.44 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1881 | 1990 | 1930 | 1936 | 7 | LQQELRE | 74.25 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1881 | 1990 | 1953 | 1966 | 14 | EKQILNEMLEVVEQ | 77.09 |
| DP02396 | Q7RTP6 | F-actin-monooxygenase MICAL3 | Homo sapiens | 1881 | 1990 | 1969 | 1977 | 9 | SLVALLEEQ | 77.74 |
| DP02398 | Q04637 | Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220) | Homo sapiens (Human) | 161 | 216 | 192 | 198 | 7 | ITEEIMS | 76.06 |
| DP02398 | Q04637 | Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220) | Homo sapiens (Human) | 178 | 203 | 192 | 198 | 7 | ITEEIMS | 76.06 |
| DP02400 | P48598 | Eukaryotic translation initiation factor 4E1 | Drosophila melanogaster | 1 | 68 | 16 | 22 | 7 | SMFKTSA | 75.25 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 1 | 272 | 32 | 44 | 13 | GASSTNGGLHYSE | 76.82 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 1 | 272 | 61 | 73 | 13 | VGAEYQARIPEFD | 77.51 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 1 | 272 | 75 | 81 | 7 | GATKYTD | 80.6 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 1 | 272 | 86 | 93 | 8 | GMLVWSPY | 84.7 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 1 | 272 | 100 | 111 | 12 | KLDEYIAIAKEK | 91.86 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 1 | 272 | 113 | 134 | 22 | GYNVEQALGMLFWHKHNIEKSL | 76.41 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 1 | 272 | 151 | 163 | 13 | DKVLFEQAFSFHG | 78.98 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 1 | 272 | 165 | 190 | 26 | SFHRIQQMLPDKTIASLVKYYYSWKK | 79.17 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 406 | 553 | 407 | 427 | 21 | GTQASNGDASTLGEETKSASN | 79.93 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 406 | 553 | 494 | 501 | 8 | QQQARFIQ | 84.53 |
| DP02408 | Q9P2K3 | REST corepressor 3 | Homo sapiens (Human) | 406 | 553 | 540 | 548 | 9 | SLIGIQTDS | 77.26 |
| DP02409 | Q9BTT0 | Acidic leucine-rich nuclear phosphoprotein 32 family member E | Homo sapiens | 186 | 232 | 215 | 227 | 13 | EVGLSYLMKEEIQ | 81.48 |
| DP02446 | Q8IU57 | Interferon lambda receptor 1 | Homo sapiens | 270 | 299 | 274 | 280 | 7 | HPVATFQ | 78.4 |
| DP02446 | Q8IU57 | Interferon lambda receptor 1 | Homo sapiens | 270 | 299 | 287 | 294 | 8 | VNDLFLCP | 80.6 |
| DP02451 | P46938 | Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog) | Mus musculus (Mouse) | 35 | 64 | 44 | 58 | 15 | GDSETDLEALFNAVM | 78.13 |
| DP02455 | Q9UKX7 | Nuclear pore complex protein Nup50 (50 kDa nucleoporin) (Nuclear pore-associated protein 60 kDa-like) (Nucleoporin Nup50) | Homo sapiens (Human) | 48 | 109 | 48 | 62 | 15 | VGFESDTGGAFKGFK | 75.45 |
| DP02455 | Q9UKX7 | Nuclear pore complex protein Nup50 (50 kDa nucleoporin) (Nuclear pore-associated protein 60 kDa-like) (Nucleoporin Nup50) | Homo sapiens (Human) | 48 | 109 | 85 | 97 | 13 | LEGLSNGNNITSA | 77.18 |
| DP02458 | P17181 | Interferon alpha/beta receptor 1 | Homo sapiens | 330 | 436 | 335 | 352 | 18 | PVFNIRSLSDSFHIYIGA | 80.64 |
| DP02458 | P17181 | Interferon alpha/beta receptor 1 | Homo sapiens | 330 | 436 | 361 | 386 | 26 | VIQDYPLIYEIIFWENTSNAERKIIE | 82.11 |
| DP02458 | P17181 | Interferon alpha/beta receptor 1 | Homo sapiens | 330 | 436 | 411 | 423 | 13 | MDEKLNKSSVFSD | 76.07 |
| DP02460 | Q23985 | Protein deltex (Probable E3 ubiquitin-protein ligase deltex) (EC 2.3.2.27) (RING-type E3 ubiquitin transferase deltex) | Drosophila melanogaster (Fruit fly) | 212 | 261 | 215 | 235 | 21 | QQANQLKSNSASVSSQYNTLP | 80.98 |
| DP02463 | Q9NRR4 | Ribonuclease 3 | Homo sapiens | 411 | 432 | 417 | 425 | 9 | HSENYYSSD | 78.48 |
| DP02463 | Q9NRR4 | Ribonuclease 3 | Homo sapiens | 459 | 521 | 498 | 509 | 12 | DSEVFDVIAEIK | 82.16 |
| DP02463 | Q9NRR4 | Ribonuclease 3 | Homo sapiens | 712 | 849 | 715 | 737 | 23 | PEEEIANMLQWEELEWQKYAEEC | 80.37 |
| DP02463 | Q9NRR4 | Ribonuclease 3 | Homo sapiens | 712 | 849 | 739 | 745 | 7 | GMIVTNP | 77.26 |
| DP02463 | Q9NRR4 | Ribonuclease 3 | Homo sapiens | 712 | 849 | 764 | 801 | 38 | PDVITFPIIVHFGIRPAQLSYAGDPQYQKLWKSYVKLR | 83.12 |
| DP02463 | Q9NRR4 | Ribonuclease 3 | Homo sapiens | 712 | 849 | 824 | 834 | 11 | ALQKIRQKNTM | 86.96 |
| DP02463 | Q9NRR4 | Ribonuclease 3 | Homo sapiens | 712 | 849 | 838 | 844 | 7 | VTVELSS | 79.93 |
| DP02463 | Q9NRR4 | Ribonuclease 3 | Homo sapiens | 930 | 957 | 940 | 950 | 11 | KGINTLINIMS | 82.67 |
| DP02463 | Q9NRR4 | Ribonuclease 3 | Homo sapiens | 1333 | 1365 | 1340 | 1349 | 10 | QKRFIERKYR | 73.91 |
| DP02471 | Q96G97 | Seipin | Homo sapiens | 2 | 60 | 8 | 22 | 15 | PALLWAQEVGQVLAG | 77.97 |
| DP02471 | Q96G97 | Seipin | Homo sapiens | 2 | 60 | 27 | 55 | 29 | LLLQFGVLFCTILLLLWVSVFLYGSFYYS | 85.27 |
| DP02471 | Q96G97 | Seipin | Homo sapiens | 220 | 398 | 221 | 264 | 44 | TGLRYLLYNFPMTCAFIGVASNFTFLSVIVLFSYMQWVWGGIWP | 84.78 |
| DP02471 | Q96G97 | Seipin | Homo sapiens | 220 | 398 | 267 | 276 | 10 | RFSLQVNIRK | 90.94 |
| DP02471 | Q96G97 | Seipin | Homo sapiens | 220 | 398 | 354 | 364 | 11 | DAALLTEANLP | 80.27 |
| DP02471 | Q96G97 | Seipin | Homo sapiens | 220 | 398 | 373 | 380 | 8 | APVLETLG | 75.42 |
| DP02474 | Q12000 | Translation machinery-associated protein 46 (DRG family-regulatory protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 283 | 319 | 299 | 311 | 13 | QGSAWDLTEFTDA | 77.28 |
| DP02475 | Q86UE8 | Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2) | Homo sapiens (Human) | 191 | 391 | 197 | 205 | 9 | SQKQISIQH | 84.32 |
| DP02475 | Q86UE8 | Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2) | Homo sapiens (Human) | 191 | 391 | 210 | 224 | 15 | SDLTIEKISALENSK | 81.16 |
| DP02475 | Q86UE8 | Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2) | Homo sapiens (Human) | 191 | 391 | 271 | 284 | 14 | KKLLIEKSKQEKMA | 75.78 |
| DP02475 | Q86UE8 | Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2) | Homo sapiens (Human) | 191 | 391 | 295 | 302 | 8 | RLGHFTTV | 80.69 |
| DP02475 | Q86UE8 | Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2) | Homo sapiens (Human) | 191 | 391 | 304 | 329 | 26 | HGASFTEQWTDGYAFQNLIKQQERIN | 85.43 |
| DP02475 | Q86UE8 | Serine/threonine-protein kinase tousled-like 2 (EC 2.7.11.1) (HsHPK) (PKU-alpha) (Tousled-like kinase 2) | Homo sapiens (Human) | 191 | 391 | 369 | 375 | 7 | GAENETP | 77.26 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 231 | 12 | 27 | 16 | GQNKYIEYLLQEETEA | 79.74 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 231 | 68 | 76 | 9 | ADEGYVRCL | 84.95 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 231 | 78 | 91 | 14 | GANNENYDAAEYSH | 82.01 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 231 | 122 | 143 | 22 | EDSKYYCELCDPSLYAHLETSK | 78.47 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 231 | 154 | 160 | 7 | HDDVYKP | 74.58 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 231 | 168 | 175 | 8 | DADVFLDE | 86.66 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 231 | 189 | 195 | 7 | KGIHIKS | 77.26 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 74 | 134 | 78 | 91 | 14 | GANNENYDAAEYSH | 82.01 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 74 | 134 | 122 | 129 | 8 | EDSKYYCE | 78.85 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 134 | 232 | 137 | 143 | 7 | AHLETSK | 73.91 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 134 | 232 | 154 | 160 | 7 | HDDVYKP | 74.58 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 134 | 232 | 168 | 175 | 8 | DADVFLDE | 86.66 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 134 | 232 | 189 | 195 | 7 | KGIHIKS | 77.26 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 594 | 379 | 387 | 9 | GDELIEDIA | 80.49 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 594 | 391 | 410 | 20 | EDILYSKDSIRLHNIDSIDS | 79.9 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 594 | 417 | 460 | 44 | QTHAISKEPSPSTIINEESLNCAFLYPGLGLEFTGYLNYIGASQ | 79.77 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 594 | 465 | 480 | 16 | DIFKEAIGDGKLYVEG | 79.35 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 594 | 486 | 534 | 49 | TAAPYLKEISCSRAILVYQLFPSNDSESKTTFADVVDSLENKGRIAGIK | 85.17 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 594 | 552 | 563 | 12 | EIPEILKDILGS | 75.59 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 594 | 579 | 589 | 11 | ERTLFAFVVVK | 79.2 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 447 | 379 | 387 | 9 | GDELIEDIA | 80.49 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 447 | 391 | 410 | 20 | EDILYSKDSIRLHNIDSIDS | 79.9 |
| DP02476 | P36106 | Transcription factor BYE1 (Bypass of ESS1 protein 1) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 366 | 447 | 417 | 442 | 26 | QTHAISKEPSPSTIINEESLNCAFLY | 78.35 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 471 | 572 | 488 | 498 | 11 | EQSNSALSESS | 78.47 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 938 | 949 | 12 | RDDLIASILSEV | 77.03 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 984 | 990 | 7 | KAVTLTR | 80.6 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 1030 | 1047 | 18 | RYQEFQNRQVQSLLELRE | 77.41 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 1069 | 1083 | 15 | REVVLDANTTQFKRL | 74.31 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 1093 | 1099 | 7 | ELQKILD | 77.26 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 1102 | 1108 | 7 | RHNSISE | 74.68 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 1118 | 1137 | 20 | EAELTEINRRHITESVNSIR | 80.5 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 1154 | 1165 | 12 | QQQVLQQLAEEE | 77.31 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 1170 | 1177 | 8 | AQLAQECQ | 73.58 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 882 | 1234 | 1223 | 1229 | 7 | ADSESQE | 75.82 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 934 | 1192 | 938 | 949 | 12 | RDDLIASILSEV | 77.03 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 934 | 1192 | 984 | 990 | 7 | KAVTLTR | 80.6 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 934 | 1192 | 1030 | 1047 | 18 | RYQEFQNRQVQSLLELRE | 77.41 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 934 | 1192 | 1069 | 1083 | 15 | REVVLDANTTQFKRL | 74.31 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 934 | 1192 | 1093 | 1099 | 7 | ELQKILD | 77.26 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 934 | 1192 | 1102 | 1108 | 7 | RHNSISE | 74.68 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 934 | 1192 | 1118 | 1137 | 20 | EAELTEINRRHITESVNSIR | 80.5 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 934 | 1192 | 1154 | 1165 | 12 | QQQVLQQLAEEE | 77.31 |
| DP02477 | Q01970 | 1-phosphatidylinositol 4;5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | Homo sapiens (Human) | 934 | 1192 | 1170 | 1177 | 8 | AQLAQECQ | 73.58 |
| DP02478 | Q6SJQ7 | CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) | Mus musculus (Mouse) | 132 | 330 | 144 | 170 | 27 | STTTIFTVTTTVKETSMFPTLTSYYSD | 79.55 |
| DP02478 | Q6SJQ7 | CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) | Mus musculus (Mouse) | 132 | 330 | 186 | 218 | 33 | GDGFLDLSVLLPVISAVLLLLLLVASLFAWRMV | 80.66 |
| DP02478 | Q6SJQ7 | CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) | Mus musculus (Mouse) | 132 | 330 | 232 | 247 | 16 | AQSLEGDLCYADLSLK | 85.79 |
| DP02478 | Q6SJQ7 | CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) | Mus musculus (Mouse) | 132 | 330 | 272 | 280 | 9 | EEVEYVTMA | 81.05 |
| DP02478 | Q6SJQ7 | CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) | Mus musculus (Mouse) | 132 | 330 | 285 | 295 | 11 | EEVSYAALTLA | 83.16 |
| DP02478 | Q6SJQ7 | CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Leukocyte mono-Ig-like receptor 3) (Myeloid-associated immunoglobulin-like receptor 5) (MAIR-5) (MAIR-V) (CD antigen CD300f) | Mus musculus (Mouse) | 132 | 330 | 299 | 311 | 13 | QEPTYGNTGCPIT | 75.87 |
| DP02479 | O60502 | Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT) | Homo sapiens (Human) | 335 | 372 | 351 | 363 | 13 | STVSIQIKLENEG | 77.85 |
| DP02479 | O60502 | Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT) | Homo sapiens (Human) | 341 | 371 | 351 | 363 | 13 | STVSIQIKLENEG | 77.85 |
| DP02479 | O60502 | Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT) | Homo sapiens (Human) | 341 | 370 | 351 | 363 | 13 | STVSIQIKLENEG | 77.85 |
| DP02479 | O60502 | Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase and acetyltransferase) (NCOAT) | Homo sapiens (Human) | 348 | 369 | 351 | 363 | 13 | STVSIQIKLENEG | 77.85 |
| DP02480 | Q12102 | Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 423 | 625 | 452 | 459 | 8 | NGNAIIDD | 91.39 |
| DP02480 | Q12102 | Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 423 | 625 | 468 | 479 | 12 | NQDILVENVNGV | 76.09 |
| DP02480 | Q12102 | Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 423 | 625 | 498 | 508 | 11 | NDNLLNLLKDN | 81.88 |
| DP02480 | Q12102 | Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 423 | 625 | 521 | 528 | 8 | PVDIIIQP | 94.36 |
| DP02480 | Q12102 | Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 423 | 625 | 535 | 545 | 11 | KMFPFNPAKIK | 80.27 |
| DP02480 | Q12102 | Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 423 | 625 | 551 | 561 | 11 | TVVDFTMFLPD | 80.15 |
| DP02480 | Q12102 | Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 423 | 625 | 564 | 571 | 8 | DNVNQNSR | 75.25 |
| DP02480 | Q12102 | Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 423 | 625 | 611 | 620 | 10 | RASRYSGFSG | 75.99 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 142 | 10 | 19 | 10 | PSTNFNFFKG | 90.43 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 142 | 23 | 44 | 22 | NDNTSANSTVNNSNFFLNSNET | 84.48 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 142 | 47 | 58 | 12 | SKNVFMVHSTSQ | 76.37 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 142 | 64 | 75 | 12 | PLQNLSHSPSYT | 76.11 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 142 | 83 | 102 | 20 | KKYMINDAKTIQLVGPLISS | 79 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 142 | 119 | 126 | 8 | PRFLINQE | 87.29 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 551 | 557 | 7 | NLASSVY | 85.38 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 570 | 593 | 24 | ADQSFLMENFQNNYNEKLNQNSSV | 86.51 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 595 | 601 | 7 | PQINTSP | 75.25 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 609 | 615 | 7 | NHFPFSQ | 78.26 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 624 | 632 | 9 | SQSHTLSTN | 75.92 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 647 | 654 | 8 | KQQQIKTV | 79.39 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 657 | 699 | 43 | GGSPFVFDQSAQNSTVEASKAHMISTTSNGAYDEKLSSEQEEM | 79.79 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 703 | 709 | 7 | EEQRIEE | 75.25 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 722 | 783 | 62 | DKQVITEQIANDLVKEVVNSSVISIVKREFSEANYRKDFIDTMTRELYDAFLHERLYLIYMD | 81.78 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 798 | 808 | 11 | FFEKWQASYSQ | 82.06 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 838 | 844 | 7 | STCLFRT | 80.94 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 848 | 886 | 39 | GNVNSSFMLSSSDKNLIFSPVNDEFNKFATHLTKISKLW | 80.66 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 890 | 901 | 12 | EMQSIYYDNLTK | 81.1 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 910 | 938 | 29 | PANLFIYAKDWTSLSNRWILSKFNLQTAQ | 84.43 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 943 | 961 | 19 | FSNNIISSRIICIDDEYEP | 80.07 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 966 | 986 | 21 | DLQLLIFNTGVTNPDIFDLEM | 83.29 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 992 | 1057 | 66 | GEELIKLITGISLNTNICFSLLIIYWESAENTLSESTIKHLLKLNRISKNYSSVIERIDLMNLTEE | 81.07 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 1066 | 1085 | 20 | KLSEISHSYVYKLTERGKYD | 77.51 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 1121 | 1143 | 23 | EKNKYQQQIGERNTYAHLESHID | 82.13 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 1154 | 1168 | 15 | PILLSTSHSSQFKTP | 74.4 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 1212 | 1228 | 17 | HSNNIPAASFSGNNTTD | 77.41 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 1231 | 1264 | 34 | SQQLIENQKSTSVYLNNVSERILGNQEICQTPIN | 80.38 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 1301 | 1285 | 1293 | 9 | LELKILIDS | 86.85 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 719 | 551 | 557 | 7 | NLASSVY | 85.38 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 719 | 570 | 593 | 24 | ADQSFLMENFQNNYNEKLNQNSSV | 86.51 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 719 | 595 | 601 | 7 | PQINTSP | 75.25 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 719 | 609 | 615 | 7 | NHFPFSQ | 78.26 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 719 | 624 | 632 | 9 | SQSHTLSTN | 75.92 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 719 | 647 | 654 | 8 | KQQQIKTV | 79.39 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 719 | 657 | 699 | 43 | GGSPFVFDQSAQNSTVEASKAHMISTTSNGAYDEKLSSEQEEM | 79.79 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 551 | 719 | 703 | 709 | 7 | EEQRIEE | 75.25 |
| DP02481 | P46674 | Nuclear mRNA export protein SAC3 (Leucine permease transcriptional regulator) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 720 | 805 | 722 | 783 | 62 | DKQVITEQIANDLVKEVVNSSVISIVKREFSEANYRKDFIDTMTRELYDAFLHERLYLIYMD | 81.78 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 4 | 32 | 29 | KKLLIASLLFSSATVYGAEGFVVKDIHFE | 80.61 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 40 | 46 | 7 | GAALLSM | 86.05 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 55 | 91 | 37 | NDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKER | 81.21 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 93 | 101 | 9 | TIASITFSG | 87.11 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 111 | 118 | 8 | KQNLEASG | 76 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 136 | 156 | 21 | GLEDFYYSVGKYSASVKAVVT | 82.88 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 163 | 208 | 46 | VDLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNV | 82.01 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 221 | 246 | 26 | GDLETLRSYYLDRGYARFNIDSTQVS | 84.64 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 251 | 299 | 49 | KKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIENLTKIEPGELYNGT | 80.35 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 311 | 320 | 10 | LLGRYGYAYP | 80.8 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 343 | 356 | 14 | AGNRFYVRKIRFEG | 86.77 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 372 | 379 | 8 | MEGAWLGS | 79.93 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 391 | 399 | 9 | RLGFFETVD | 88.81 |
| DP02483 | Q8ZRP0 | Outer membrane protein assembly factor BamA | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 426 | 412 | 418 | 7 | VDVVYKV | 79.36 |
| DP02484 | P0AD27 | Inner membrane protein YejM | Escherichia coli (strain K12) | 1 | 244 | 14 | 83 | 70 | QMVSWGHWFALFNILLSLVIGSRYLFIADWPTTLAGRIYSYVSIIGHFSFLVFATYLLILFPLTFIVGSQ | 83.38 |
| DP02484 | P0AD27 | Inner membrane protein YejM | Escherichia coli (strain K12) | 1 | 244 | 86 | 131 | 46 | MRFLSVILATAGMTLLLIDSEVFTRFHLHLNPIVWQLVINPDENEM | 79.05 |
| DP02484 | P0AD27 | Inner membrane protein YejM | Escherichia coli (strain K12) | 1 | 244 | 133 | 158 | 26 | RDWQLMFISVPVILLLELVFATWSWQ | 83.56 |
| DP02484 | P0AD27 | Inner membrane protein YejM | Escherichia coli (strain K12) | 1 | 244 | 172 | 200 | 29 | PLAAFLFIAFIASHVVYIWADANFYRPIT | 85.93 |
| DP02484 | P0AD27 | Inner membrane protein YejM | Escherichia coli (strain K12) | 1 | 244 | 225 | 235 | 11 | DAQEYQRRLIE | 81.18 |
| DP02485 | P40709 | Inner membrane protein YejM | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 244 | 14 | 83 | 70 | QMVSWGHWFALFNILLATLLGSRYLFVADWPTTLAGRIYSYLSIVGHFSFLVFATYLLILFPLTFIVMSQ | 82.51 |
| DP02485 | P40709 | Inner membrane protein YejM | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 244 | 86 | 158 | 73 | MRFLSAILATAGMTLLLIDSEVFTRFHLHLNPIVWELVINPDQNEMARDWQLMFISVPVILLIEMLFATWSWQ | 84.12 |
| DP02485 | P40709 | Inner membrane protein YejM | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 244 | 172 | 200 | 29 | PLAAFFFVSFIASHLIYIWADANFYRPIT | 86.29 |
| DP02485 | P40709 | Inner membrane protein YejM | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 244 | 225 | 231 | 7 | DAQEYQR | 88.29 |
| DP02486 | A7ZUK2 | "DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)" | Escherichia coli O139:H28 (strain E24377A / ETEC) | 931 | 1134 | 944 | 978 | 35 | AAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSR | 83.4 |
| DP02486 | A7ZUK2 | "DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)" | Escherichia coli O139:H28 (strain E24377A / ETEC) | 931 | 1134 | 981 | 989 | 9 | ELKLIDEFG | 80.38 |
| DP02486 | A7ZUK2 | "DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)" | Escherichia coli O139:H28 (strain E24377A / ETEC) | 931 | 1134 | 1016 | 1022 | 7 | TVANWDP | 86.62 |
| DP02486 | A7ZUK2 | "DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)" | Escherichia coli O139:H28 (strain E24377A / ETEC) | 931 | 1134 | 1025 | 1048 | 24 | MPVITEVSGFVRFTDMIDGQTITR | 81.74 |
| DP02486 | A7ZUK2 | "DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)" | Escherichia coli O139:H28 (strain E24377A / ETEC) | 931 | 1134 | 1050 | 1067 | 18 | TDELTGLSSLVVLDSAER | 77.96 |
| DP02486 | A7ZUK2 | "DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)" | Escherichia coli O139:H28 (strain E24377A / ETEC) | 931 | 1134 | 1096 | 1118 | 23 | PAQYFLPGKAIVQLEDGVQISSG | 81.91 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 3 | 22 | 20 | AIVGLCLLSEKVVLSRSLTD | 79.26 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 24 | 31 | 8 | VSKLYKLN | 77.26 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 58 | 137 | 80 | PVSTIILDYKNEDFIKQNPTYSAMDIIGSPSNTAPQTAFQSIMPSLSALFNTPFIQGAFRHRIISSMGPEISYLVMVIGP | 82.07 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 152 | 175 | 24 | SSVHTVSNADVDLNDIIAINSTMA | 78.9 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 180 | 197 | 18 | LVSASTLQAMLVNDVYDR | 75.85 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 201 | 221 | 21 | LDGILLSQALPFFRNYVNVQS | 82.94 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 230 | 244 | 15 | AACLNTPIKELFSMG | 78.51 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 251 | 257 | 7 | LALEFRK | 83.61 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 260 | 270 | 11 | EGQCIGIVLPK | 78.84 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 1 | 288 | 274 | 283 | 10 | GDTLSSRYPA | 77.02 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 301 | 506 | 310 | 336 | 27 | AYEKLYSETISKHVSDGSYGNRVIISH | 86.6 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 301 | 506 | 344 | 372 | 29 | GGVKIIGRFKISDFNTVKKNLSSRSGEID | 84.29 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 301 | 506 | 375 | 383 | 9 | KEQWEALSG | 76.48 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 301 | 506 | 385 | 406 | 22 | GLVTDSNISMLHDKILDTITSN | 76.21 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 301 | 506 | 418 | 428 | 11 | KSENIVVCFKN | 84.01 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 301 | 506 | 434 | 463 | 30 | KHSLLQLTKNGISVVSLDELTDAGILVEST | 76.98 |
| DP02487 | P22473 | Protein P7 (55 kDa core protein) | Rice dwarf virus (isolate O) (RDV) | 301 | 506 | 475 | 483 | 9 | LANKLSSFK | 78.04 |
| DP02488 | O28769 | HAMP domain-containing protein | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) | 1 | 233 | 6 | 33 | 28 | QIVLIVVVASLVPLSVLGYLTIAGMTSS | 84.9 |
| DP02488 | O28769 | HAMP domain-containing protein | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) | 1 | 233 | 39 | 56 | 18 | QGVTTVSQEYLTKAGEEA | 78.13 |
| DP02488 | O28769 | HAMP domain-containing protein | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) | 1 | 233 | 62 | 92 | 31 | QDLALAVQTYIEAKMKLENKTMLTTFDLIQD | 78.98 |
| DP02488 | O28769 | HAMP domain-containing protein | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) | 1 | 233 | 99 | 117 | 19 | GAQRWGAKEYTWVGAGNKV | 82.57 |
| DP02488 | O28769 | HAMP domain-containing protein | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) | 1 | 233 | 121 | 165 | 45 | DVAVILTHPAFTGQYEKYLGVDVAMLRWNETMPELYNLLLKITEN | 82.71 |
| DP02488 | O28769 | HAMP domain-containing protein | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) | 1 | 233 | 172 | 180 | 9 | VCGYYHWDD | 86.44 |
| DP02488 | O28769 | HAMP domain-containing protein | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) | 1 | 233 | 188 | 228 | 41 | EIPKYLCHYPTTIKVYDPISKGQLWVVVGTSAYIDGYFQYL | 82.05 |
| DP02489 | Q9YIJ1 | Capsid protein | Adeno-associated virus - 5 | 1 | 208 | 17 | 25 | 9 | GLREFLGLE | 79.19 |
| DP02489 | Q9YIJ1 | Capsid protein | Adeno-associated virus - 5 | 1 | 208 | 43 | 53 | 11 | GLVLPGYNYLG | 80.63 |
| DP02489 | Q9YIJ1 | Capsid protein | Adeno-associated virus - 5 | 1 | 208 | 74 | 93 | 20 | HDISYNEQLEAGDNPYLKYN | 85.15 |
| DP02489 | Q9YIJ1 | Capsid protein | Adeno-associated virus - 5 | 1 | 208 | 95 | 122 | 28 | ADAEFQEKLADDTSFGGNLGKAVFQAKK | 78.32 |
| DP02489 | Q9YIJ1 | Capsid protein | Adeno-associated virus - 5 | 1 | 208 | 124 | 134 | 11 | VLEPFGLVEEG | 75.74 |
| DP02489 | Q9YIJ1 | Capsid protein | Adeno-associated virus - 5 | 1 | 208 | 175 | 190 | 16 | SQQLQIPAQPASSLGA | 79.64 |
| DP02490 | D1A4G7 | ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) | Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) | 200 | 413 | 202 | 214 | 13 | LPVAISLRSFARI | 81.27 |
| DP02490 | D1A4G7 | ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) | Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) | 200 | 413 | 221 | 238 | 18 | KAVYGMVRALIMQLAAFH | 81.53 |
| DP02490 | D1A4G7 | ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) | Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) | 200 | 413 | 240 | 251 | 12 | PDDVRITVCASR | 75.56 |
| DP02490 | D1A4G7 | ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) | Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) | 200 | 413 | 255 | 263 | 9 | PQWQWMKWL | 79.93 |
| DP02490 | D1A4G7 | ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) | Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) | 200 | 413 | 276 | 293 | 18 | GQVRLLTHSLVELESMLG | 77.81 |
| DP02490 | D1A4G7 | ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) | Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) | 200 | 413 | 312 | 331 | 20 | FHLVIVDGGQASYDSQIASD | 80.95 |
| DP02490 | D1A4G7 | ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) | Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) | 200 | 413 | 335 | 354 | 20 | GVCVIDLTGSVAETNEATML | 76.37 |
| DP02490 | D1A4G7 | ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) | Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) | 200 | 413 | 373 | 379 | 7 | KEVLSSV | 82.94 |
| DP02490 | D1A4G7 | ESX secretion system protein EccC (Type VII secretion system protein EccC) (T7SS protein EccC) | Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) | 200 | 413 | 383 | 394 | 12 | DQASIAEAEALA | 78.6 |
| DP02491 | Q9WBP8 | Capsid protein | Adeno-associated virus - 1 | 1 | 216 | 3 | 24 | 22 | ADGYLPDWLEDNLSEGIREWWD | 75.28 |
| DP02491 | Q9WBP8 | Capsid protein | Adeno-associated virus - 1 | 1 | 216 | 44 | 57 | 14 | GLVLPGYKYLGPFN | 75.47 |
| DP02491 | Q9WBP8 | Capsid protein | Adeno-associated virus - 1 | 1 | 216 | 75 | 94 | 20 | HDKAYDQQLKAGDNPYLRYN | 80.3 |
| DP02491 | Q9WBP8 | Capsid protein | Adeno-associated virus - 1 | 1 | 216 | 96 | 105 | 10 | ADAEFQERLQ | 87.96 |
| DP02491 | Q9WBP8 | Capsid protein | Adeno-associated virus - 1 | 1 | 216 | 115 | 123 | 9 | GRAVFQAKK | 75.44 |
| DP02491 | Q9WBP8 | Capsid protein | Adeno-associated virus - 1 | 1 | 216 | 169 | 181 | 13 | KRLNFGQTGDSES | 79.11 |
| DP02492 | Q808Y3 | Capsid protein | Non-human primate Adeno-associated virus | 1 | 216 | 3 | 24 | 22 | ADGYLPDWLEDNLSEGIREWWD | 75.28 |
| DP02492 | Q808Y3 | Capsid protein | Non-human primate Adeno-associated virus | 1 | 216 | 44 | 57 | 14 | GLVLPGYKYLGPFN | 75.47 |
| DP02492 | Q808Y3 | Capsid protein | Non-human primate Adeno-associated virus | 1 | 216 | 75 | 94 | 20 | HDKAYDQQLKAGDNPYLRYN | 80.3 |
| DP02492 | Q808Y3 | Capsid protein | Non-human primate Adeno-associated virus | 1 | 216 | 96 | 105 | 10 | ADAEFQERLQ | 87.96 |
| DP02492 | Q808Y3 | Capsid protein | Non-human primate Adeno-associated virus | 1 | 216 | 115 | 123 | 9 | GRAVFQAKK | 75.44 |
| DP02492 | Q808Y3 | Capsid protein | Non-human primate Adeno-associated virus | 1 | 216 | 169 | 181 | 13 | KRLNFGQTGDSES | 79.11 |
| DP02493 | P21401 | Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) | Rift valley fever virus (strain ZH-548 M12) (RVFV) | 154 | 370 | 164 | 170 | 7 | KGHNYID | 90.35 |
| DP02493 | P21401 | Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) | Rift valley fever virus (strain ZH-548 M12) (RVFV) | 154 | 370 | 180 | 197 | 18 | KPVTYAGACSSFDVLLEK | 86.23 |
| DP02493 | P21401 | Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) | Rift valley fever virus (strain ZH-548 M12) (RVFV) | 154 | 370 | 199 | 208 | 10 | KFPLFQSYAH | 92.31 |
| DP02493 | P21401 | Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) | Rift valley fever virus (strain ZH-548 M12) (RVFV) | 154 | 370 | 216 | 224 | 9 | VHDTIIAKA | 89.82 |
| DP02493 | P21401 | Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) | Rift valley fever virus (strain ZH-548 M12) (RVFV) | 154 | 370 | 229 | 236 | 8 | CDLLSAHG | 75.25 |
| DP02493 | P21401 | Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) | Rift valley fever virus (strain ZH-548 M12) (RVFV) | 154 | 370 | 274 | 284 | 11 | KYELTEDCNFC | 84.49 |
| DP02493 | P21401 | Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) | Rift valley fever virus (strain ZH-548 M12) (RVFV) | 154 | 370 | 299 | 308 | 10 | LQDLFCQSSE | 87.29 |
| DP02493 | P21401 | Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) | Rift valley fever virus (strain ZH-548 M12) (RVFV) | 154 | 370 | 341 | 357 | 17 | EVVPFAVFKNSKKVYLD | 78.38 |
| DP02493 | P21401 | Envelopment polyprotein (M polyprotein) Cleaved into: NSm-Gn protein (p78 protein); Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2) | Rift valley fever virus (strain ZH-548 M12) (RVFV) | 440 | 469 | 441 | 453 | 13 | GIVQIQVSGVWKK | 76.85 |
| DP02494 | O56139 | Capsid protein VP1 | Adeno-associated virus 3B | 1 | 216 | 3 | 24 | 22 | ADGYLPDWLEDNLSEGIREWWA | 75.8 |
| DP02494 | O56139 | Capsid protein VP1 | Adeno-associated virus 3B | 1 | 216 | 44 | 54 | 11 | GLVLPGYKYLG | 74.07 |
| DP02494 | O56139 | Capsid protein VP1 | Adeno-associated virus 3B | 1 | 216 | 75 | 94 | 20 | HDKAYDQQLKAGDNPYLKYN | 82.41 |
| DP02494 | O56139 | Capsid protein VP1 | Adeno-associated virus 3B | 1 | 216 | 96 | 105 | 10 | ADAEFQERLQ | 87.96 |
| DP02494 | O56139 | Capsid protein VP1 | Adeno-associated virus 3B | 1 | 216 | 115 | 123 | 9 | GRAVFQAKK | 75.44 |
| DP02494 | O56139 | Capsid protein VP1 | Adeno-associated virus 3B | 1 | 216 | 130 | 139 | 10 | GLVEEAAKTA | 80.6 |
| DP02494 | O56139 | Capsid protein VP1 | Adeno-associated virus 3B | 1 | 216 | 169 | 181 | 13 | KRLNFGQTGDSES | 79.11 |
| DP02494 | O56139 | Capsid protein VP1 | Adeno-associated virus 3B | 1 | 216 | 198 | 204 | 7 | LGSNTMA | 79.93 |
| DP02495 | Q928V6 | Putative integrase Bacteriophage A118 | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) | 133 | 350 | 137 | 145 | 9 | VMGKIKRIE | 75.25 |
| DP02495 | Q928V6 | Putative integrase Bacteriophage A118 | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) | 133 | 350 | 156 | 173 | 18 | RTFGYDVIDTKLYINEEE | 79.88 |
| DP02495 | Q928V6 | Putative integrase Bacteriophage A118 | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) | 133 | 350 | 176 | 195 | 20 | QLRLIYDIFEEEQSITFLQK | 79.25 |
| DP02495 | Q928V6 | Putative integrase Bacteriophage A118 | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) | 133 | 350 | 203 | 227 | 25 | KVRTYNRYNNWLTNDLYCGYVSYKD | 87.46 |
| DP02495 | Q928V6 | Putative integrase Bacteriophage A118 | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) | 133 | 350 | 235 | 254 | 20 | HEPIISEEQFYRVQEIFSRM | 87.93 |
| DP02495 | Q928V6 | Putative integrase Bacteriophage A118 | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) | 133 | 350 | 264 | 276 | 13 | SASLLNNLVVCSK | 79.73 |
| DP02495 | Q928V6 | Putative integrase Bacteriophage A118 | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) | 133 | 350 | 295 | 306 | 12 | YHYRYYSCKTYK | 82.3 |
| DP02495 | Q928V6 | Putative integrase Bacteriophage A118 | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) | 133 | 350 | 324 | 343 | 20 | LEELIIDRVNNYSFASRNID | 86.49 |
| DP02495 | Q928V6 | Putative integrase Bacteriophage A118 | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) | 400 | 452 | 409 | 447 | 39 | IQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQV | 84.3 |
| DP02496 | P56926 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) | 633 | 852 | 682 | 696 | 15 | QDAEFTRLLGLGASE | 76.77 |
| DP02496 | P56926 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) | 633 | 852 | 707 | 715 | 9 | ALLAFVGGA | 97.32 |
| DP02496 | P56926 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) | 633 | 852 | 722 | 738 | 17 | AQVASWTVNELVAGLRA | 78.34 |
| DP02496 | P56926 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) | 633 | 852 | 757 | 770 | 14 | SGQLSARIAREALA | 75.66 |
| DP02496 | P56926 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) | 633 | 852 | 778 | 785 | 8 | APLTIIER | 80.31 |
| DP02496 | P56926 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) | 633 | 852 | 789 | 808 | 20 | NAGLSAEALQQVVAQVIAAN | 80.75 |
| DP02496 | P56926 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) | 633 | 852 | 811 | 817 | 7 | KAEAYRG | 85.28 |
| DP02496 | P56926 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) | 633 | 852 | 820 | 835 | 16 | TALLGFFTGQVMRATA | 77.01 |
| DP02497 | P05844 | Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 | Infectious pancreatic necrosis virus (strain Jasper) (IPNV) | 735 | 960 | 741 | 750 | 10 | LQGLLQATMA | 77.16 |
| DP02497 | P05844 | Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 | Infectious pancreatic necrosis virus (strain Jasper) (IPNV) | 735 | 960 | 757 | 771 | 15 | DAEVFKLLKLMSWTR | 76.28 |
| DP02497 | P05844 | Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 | Infectious pancreatic necrosis virus (strain Jasper) (IPNV) | 735 | 960 | 776 | 784 | 9 | TDHMYEWSK | 79.38 |
| DP02497 | P05844 | Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 | Infectious pancreatic necrosis virus (strain Jasper) (IPNV) | 735 | 960 | 788 | 795 | 8 | DAIKFGRL | 80.27 |
| DP02497 | P05844 | Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 | Infectious pancreatic necrosis virus (strain Jasper) (IPNV) | 735 | 960 | 829 | 845 | 17 | AGADFASPEWIAENNYR | 85.64 |
| DP02497 | P05844 | Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 | Infectious pancreatic necrosis virus (strain Jasper) (IPNV) | 735 | 960 | 850 | 859 | 10 | GQFKYYMITG | 83.95 |
| DP02497 | P05844 | Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 | Infectious pancreatic necrosis virus (strain Jasper) (IPNV) | 735 | 960 | 865 | 872 | 8 | GEEYEDYV | 79.26 |
| DP02497 | P05844 | Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 | Infectious pancreatic necrosis virus (strain Jasper) (IPNV) | 735 | 960 | 887 | 895 | 9 | RLANSVYGL | 76.11 |
| DP02497 | P05844 | Structural polyprotein (PP) Cleaved into: Precursor of VP2 (Pre-VP2); Capsid protein VP2; Structural peptide 1 (p1); Structural peptide 2 (p2); Structural peptide 3 (p3); Protease VP4 (EC 3.4.21.-) (Non-structural protein VP4) (NS); Capsid protein VP3 | Infectious pancreatic necrosis virus (strain Jasper) (IPNV) | 735 | 960 | 902 | 916 | 15 | PDDFYQAVVEVFAEN | 80.62 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 24 | 33 | 10 | TAVEQAVPIQ | 78.13 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 44 | 61 | 18 | AAGQINQIDPWIFQNFVQ | 90.45 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 63 | 71 | 9 | PLGEFSISP | 77.18 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 74 | 85 | 12 | TPGEILFDLALG | 81.38 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 87 | 120 | 34 | GLNPYLAHLSAMYTGWVGNMEVQLVLAGNAFTAG | 78.32 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 122 | 131 | 10 | VVVALVPPYF | 87.29 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 133 | 145 | 13 | KGSLTTAQITCFP | 76.97 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 153 | 163 | 11 | TLEPIQLPLLD | 75.92 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 165 | 172 | 8 | RRVLWHAT | 75.13 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 182 | 188 | 7 | VCMLYTP | 90.97 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 195 | 208 | 14 | GDESFVVSGRLLSK | 81.58 |
| DP02498 | A7YK37 | Capsid protein | Murine norovirus GV/CR10/2005/USA | 1 | 227 | 211 | 220 | 10 | ADFNFVYLTP | 84.31 |
| DP02499 | A0KJC7 | ImpA-related domain protein | Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) | 1 | 230 | 9 | 15 | 7 | ARLLTSL | 74.53 |
| DP02499 | A0KJC7 | ImpA-related domain protein | Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) | 1 | 230 | 32 | 65 | 34 | DYVETELVKLGSLAHSQVDLNAVAEACLGLLESR | 76.7 |
| DP02499 | A0KJC7 | ImpA-related domain protein | Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) | 1 | 230 | 72 | 78 | 7 | LAQLLRC | 77.4 |
| DP02499 | A0KJC7 | ImpA-related domain protein | Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) | 1 | 230 | 88 | 109 | 22 | LGAAISLLEAWIQAYWLLAWPG | 84.16 |
| DP02499 | A0KJC7 | ImpA-related domain protein | Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) | 1 | 230 | 117 | 126 | 10 | LMVQIVKRFE | 78.9 |
| DP02499 | A0KJC7 | ImpA-related domain protein | Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) | 1 | 230 | 141 | 158 | 18 | LAQLLAQAEQLERVWLAQ | 76.18 |
| DP02499 | A0KJC7 | ImpA-related domain protein | Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) | 1 | 230 | 179 | 189 | 11 | QQLAQAEANAA | 78.35 |
| DP02499 | A0KJC7 | ImpA-related domain protein | Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) | 1 | 230 | 204 | 211 | 8 | ASVASTAS | 79.93 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 2 | 16 | 15 | HKFRYSLHQHYSKRN | 83.12 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 22 | 36 | 15 | KDSPISQNSNEENDS | 77.95 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 51 | 69 | 19 | LDDIYNNYTLAQGTNNNSV | 78.49 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 76 | 84 | 9 | NNQAINKFI | 85.8 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 108 | 124 | 17 | SLGNTTNETGESIAKSA | 78.67 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 143 | 155 | 13 | AVTNSSLNVLLDT | 79.26 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 158 | 166 | 9 | VSSEFNHLV | 81.05 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 174 | 193 | 20 | SVERFDDSNNTVDNTEEEEN | 75.45 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 207 | 215 | 9 | KQNEENWEK | 83.28 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1 | 232 | 218 | 226 | 9 | AAVKTIKTM | 80.01 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 554 | 567 | 14 | TNSNSNTNNVATAV | 80.27 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 587 | 595 | 9 | SPATINNKS | 80.27 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 603 | 611 | 9 | SVAAYVLNK | 81.38 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 614 | 622 | 9 | TNQNSSTSE | 74.8 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 635 | 652 | 18 | RKLSYSQQDYIPGTNILR | 78.35 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 660 | 668 | 9 | SVGSYVKTT | 81.72 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 703 | 712 | 10 | LEAAWEPYLT | 76.66 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 717 | 726 | 10 | RILRIGPVIA | 79.26 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 740 | 753 | 14 | ASLHISPLDINKEQ | 87.29 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 758 | 777 | 20 | NTSLLTQIVNEVNNNTSELK | 79.67 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 782 | 794 | 13 | ADESLAIIEPQYN | 76.33 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 816 | 835 | 20 | SGSRISKKAIFKKLGFSHLE | 75.35 |
| DP02500 | Q5A3P6 | Serine/threonine-protein kinase PKH2 (EC 2.7.11.1) (PKB-activating kinase homolog 2) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 522 | 944 | 852 | 939 | 88 | QTCTLVVTTHGRALLFIRNDIESNYLLIAEIKLKYPFIHFQELVISQTKFSKLVPSVGVFVISSIDNSLIFEVEKFEVNQWTEALAKS | 82.44 |
| DP02501 | P00800 | Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) | Bacillus thermoproteolyticus | 1 | 232 | 6 | 52 | 47 | KLASFGLAAGLAAQVFLPYNALASTEHVTWNQQFQTPQFISGDLLKV | 80.32 |
| DP02501 | P00800 | Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) | Bacillus thermoproteolyticus | 1 | 232 | 58 | 77 | 20 | EELVYQYVEKNENKFKFHEN | 77.42 |
| DP02501 | P00800 | Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) | Bacillus thermoproteolyticus | 1 | 232 | 89 | 116 | 28 | NDNLGFTFMRFQQTYKGIPVFGAVVTSH | 82.3 |
| DP02501 | P00800 | Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) | Bacillus thermoproteolyticus | 1 | 232 | 126 | 134 | 9 | SGTLIPNLD | 75.25 |
| DP02501 | P00800 | Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) | Bacillus thermoproteolyticus | 1 | 232 | 157 | 171 | 15 | DLVANVTKEVPEYEQ | 75.25 |
| DP02501 | P00800 | Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) | Bacillus thermoproteolyticus | 1 | 232 | 173 | 198 | 26 | KDTEFVVYVNGDEASLAYVVNLNFLT | 82.17 |
| DP02501 | P00800 | Thermolysin (EC 3.4.24.27) (Thermostable neutral proteinase) | Bacillus thermoproteolyticus | 1 | 232 | 200 | 224 | 25 | EPGNWLYIIDAVDGKILNKFNQLDA | 85.5 |
| DP02502 | A0R1T8 | LAO/AO transport system ATPase (EC 2.7.-.-) | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) | 1 | 238 | 8 | 17 | 10 | VPELITVARG | 76.25 |
| DP02502 | A0R1T8 | LAO/AO transport system ATPase (EC 2.7.-.-) | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) | 1 | 238 | 24 | 33 | 10 | GRLLTLVESD | 78.86 |
| DP02502 | A0R1T8 | LAO/AO transport system ATPase (EC 2.7.-.-) | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) | 1 | 238 | 36 | 43 | 8 | GEVLAALG | 76.42 |
| DP02502 | A0R1T8 | LAO/AO transport system ATPase (EC 2.7.-.-) | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) | 1 | 238 | 78 | 84 | 7 | VAVLAVD | 80.27 |
| DP02502 | A0R1T8 | LAO/AO transport system ATPase (EC 2.7.-.-) | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) | 1 | 238 | 91 | 115 | 25 | GGALLGDRIRMAAHINDPDVLIRSM | 82.86 |
| DP02502 | A0R1T8 | LAO/AO transport system ATPase (EC 2.7.-.-) | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) | 1 | 238 | 128 | 148 | 21 | VPAAIRLLAALSYDLIVLETV | 79.52 |
| DP02502 | A0R1T8 | LAO/AO transport system ATPase (EC 2.7.-.-) | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) | 1 | 238 | 151 | 171 | 21 | GQSEIEIAAIADPTVVILNPG | 90.94 |
| DP02502 | A0R1T8 | LAO/AO transport system ATPase (EC 2.7.-.-) | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) | 1 | 238 | 181 | 195 | 15 | AGVLEVADLVVVNKA | 82.88 |
| DP02502 | A0R1T8 | LAO/AO transport system ATPase (EC 2.7.-.-) | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) | 1 | 238 | 226 | 233 | 8 | LHELIEAI | 80.73 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 38 | 47 | 10 | GQWTRFPKWN | 80.6 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 52 | 61 | 10 | SEMSFQLKTR | 75.25 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 65 | 86 | 22 | GLVLYFDDEGFCDFLELILTRG | 85.57 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 88 | 106 | 19 | RLQLSFSIFCAEPATLLTD | 88.96 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 110 | 120 | 11 | NDGAWHNVRIR | 76.07 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 122 | 143 | 22 | QFRNTTLFIDQVEAKWVEVKSK | 76.85 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 146 | 157 | 12 | DMTVFSGLFVGG | 84.36 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 165 | 174 | 10 | AALKLTLASV | 77.06 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 180 | 197 | 18 | FKGWIRDVRVNSSLALPV | 78.3 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 225 | 236 | 12 | GGVCLNGGVCSV | 75.59 |
| DP02503 | Q28146 | Neurexin-1 (Neurexin I-alpha) (Neurexin-1-alpha) | Bos taurus (Bovine) | 31 | 280 | 264 | 270 | 7 | GLAHLMM | 77.26 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 256 | 1 | 18 | 18 | MAYTTAQLVTAYTNANLG | 81.01 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 256 | 24 | 71 | 48 | ATTLTLDAYATQTQTGGLSDAAALTNTLKLVNSTTAVAIQTYQFFTGV | 79.54 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 256 | 76 | 152 | 77 | AGLDFLVDSTTNTNDLNDAYYSKFAQENRFINFSINLATGAGAGATAFAAAYTGVSYAQTVATAYDKIIGNAVATAA | 82.98 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 256 | 154 | 179 | 26 | VDVAAAVAFLSRQANIDYLTAFVRAN | 80.72 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 256 | 184 | 223 | 40 | AAADIDLAVKAALIGTILNAATVSGIGGYATATAAMINDL | 80.15 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 256 | 226 | 232 | 7 | GALSTDN | 73.91 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 256 | 234 | 243 | 10 | AGVNLFTAYP | 85.18 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 248 | 1 | 18 | 18 | MAYTTAQLVTAYTNANLG | 81.01 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 248 | 24 | 71 | 48 | ATTLTLDAYATQTQTGGLSDAAALTNTLKLVNSTTAVAIQTYQFFTGV | 79.54 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 248 | 76 | 152 | 77 | AGLDFLVDSTTNTNDLNDAYYSKFAQENRFINFSINLATGAGAGATAFAAAYTGVSYAQTVATAYDKIIGNAVATAA | 82.98 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 248 | 154 | 179 | 26 | VDVAAAVAFLSRQANIDYLTAFVRAN | 80.72 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 248 | 184 | 223 | 40 | AAADIDLAVKAALIGTILNAATVSGIGGYATATAAMINDL | 80.15 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 248 | 226 | 232 | 7 | GALSTDN | 73.91 |
| DP02504 | P35828 | S-layer protein (Paracrystalline surface layer protein) | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) | 1 | 248 | 234 | 243 | 10 | AGVNLFTAYP | 85.18 |
| DP02505 | O53168 | Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 262 | 25 | 34 | 10 | LSVALLVCTP | 80.23 |
| DP02505 | O53168 | Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 262 | 42 | 56 | 15 | QTDTIAALIADVAKA | 77.95 |
| DP02505 | O53168 | Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 262 | 69 | 77 | 9 | AEQESVNKA | 79.93 |
| DP02505 | O53168 | Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 262 | 88 | 99 | 12 | AAAAEDDLEVSQ | 74.25 |
| DP02505 | O53168 | Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 262 | 105 | 126 | 22 | ANAAIAAAQHRFDTFAAATYMN | 82.59 |
| DP02505 | O53168 | Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 262 | 128 | 163 | 36 | PSVSYLSASSPDEIIATVTAAKTLSASSQAVMANLQ | 77.65 |
| DP02505 | O53168 | Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 262 | 196 | 204 | 9 | AAVAALTET | 77.78 |
| DP02505 | O53168 | Peptidoglycan endopeptidase RipA (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein A) (Resuscitation-promoting factor interaction partner A) (Rpf-interacting protein A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 262 | 233 | 240 | 8 | RLVAWSSE | 79.22 |
| DP02506 | Q8A6W3 | SusC homolog | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) | 1 | 235 | 12 | 31 | 20 | CSVCFLFAFMSALWGQNITV | 85.99 |
| DP02506 | Q8A6W3 | SusC homolog | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) | 1 | 235 | 33 | 85 | 53 | GNVTSKTDGQPIIGASVVETTATTNGTITDFDGNFTLSVPVNSTLKITYIGYK | 78.66 |
| DP02506 | Q8A6W3 | SusC homolog | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) | 1 | 235 | 90 | 102 | 13 | KAAAIVNVLLEED | 77.31 |
| DP02506 | Q8A6W3 | SusC homolog | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) | 1 | 235 | 108 | 117 | 10 | EVVVTGYTTQ | 75.59 |
| DP02506 | Q8A6W3 | SusC homolog | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) | 1 | 235 | 130 | 136 | 7 | KVDEIQK | 76.25 |
| DP02506 | Q8A6W3 | SusC homolog | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) | 1 | 235 | 151 | 157 | 7 | PGMNITA | 80.03 |
| DP02506 | Q8A6W3 | SusC homolog | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) | 1 | 235 | 165 | 186 | 22 | ATVRIRGIGTLNNNDPLYIIDG | 83.19 |
| DP02506 | Q8A6W3 | SusC homolog | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) | 1 | 235 | 199 | 218 | 20 | NDIESIQVLKDAASASIYGS | 82.42 |
| DP02506 | Q8A6W3 | SusC homolog | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) | 1 | 235 | 221 | 230 | 10 | ANGVIIITTK | 81.44 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 21 | 42 | 22 | TSVVSNCTDQCASYVANVFTTQ | 81.73 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 49 | 66 | 18 | SDFSFNNWFLLTNSSTLV | 81.05 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 76 | 84 | 9 | LLVNCLWPV | 76.44 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 90 | 99 | 10 | AASTFCFEGA | 82.37 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 106 | 126 | 21 | GAVLNNTVDVIRFNLNFTTNV | 83.55 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 131 | 151 | 21 | GATVFSLNTTGGVTLEISCYN | 80.9 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 155 | 171 | 17 | SDSSFSSYGEIPFGVTN | 81.7 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 175 | 192 | 18 | YCYVLYNGTALKYLGTLP | 85.21 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 194 | 229 | 36 | SVKEIAISKWGHFYINGYNFFSTFPIDCISFNLTTG | 83.22 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 231 | 268 | 38 | SDVFWTIAYTSYTEALVQVENTAITNVTYCNSYVNNIK | 85.15 |
| DP02507 | Q84852 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) | Porcine respiratory coronavirus | 17 | 299 | 272 | 294 | 23 | LTANLNNGFYPVSSSEVGSVNKS | 75.21 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 317 | 335 | 19 | EEERILRYVQQSVSLNLMR | 80.51 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 354 | 372 | 19 | GMYASNRPFINRLMDYLHR | 76.98 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 374 | 387 | 14 | AAVNPEYFTNAILN | 78.69 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 407 | 414 | 8 | NDGFLWDD | 80.23 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 416 | 422 | 7 | DDSVFSP | 85.62 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 425 | 441 | 17 | QTLLELQQREQAEAALR | 76.25 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 467 | 477 | 11 | FPSLIGSLTST | 77.62 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 486 | 497 | 12 | GEEEYLNNSLLQ | 79.68 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 522 | 528 | 7 | RWKTYAQ | 74.58 |
| DP02508 | P12537 | Pre-hexon-linking protein IIIa (Capsid vertex-specific component IIIa) (CVSC) (Protein IIIa) (pIIIa) Cleaved into: Hexon-linking protein IIIa | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) | 304 | 585 | 550 | 556 | 7 | GLVWEDD | 89.97 |
| DP02509 | P0DOC6 | CRISPR-associated endoribonuclease Cas13a | Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) | 103 | 174 | 103 | 116 | 14 | EEVVLYIEAYGKSE | 91.28 |
| DP02509 | P0DOC6 | CRISPR-associated endoribonuclease Cas13a | Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) | 103 | 174 | 119 | 137 | 19 | KALGITKKKIIDEAIRQGI | 80.29 |
| DP02509 | P0DOC6 | CRISPR-associated endoribonuclease Cas13a | Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) | 103 | 174 | 151 | 169 | 19 | NEEEIEIDIRDEYTNKTLN | 82.31 |
| DP02509 | P0DOC6 | CRISPR-associated endoribonuclease Cas13a | Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) | 914 | 1005 | 922 | 942 | 21 | KKEIFNNYYEDIKNNILTEFK | 79.58 |
| DP02509 | P0DOC6 | CRISPR-associated endoribonuclease Cas13a | Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) | 914 | 1005 | 954 | 962 | 9 | KLEKIVIFD | 93.79 |
| DP02509 | P0DOC6 | CRISPR-associated endoribonuclease Cas13a | Leptotrichia shahii (strain DSM 19757 / CCUG 47503 / CIP 107916 / JCM 16776 / LB37) | 914 | 1005 | 965 | 977 | 13 | TKFEIDKKSNILQ | 80.37 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 371 | 380 | 10 | EQVKFDATSM | 82.21 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 399 | 411 | 13 | EVQVWRIENLELV | 79.7 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 413 | 471 | 59 | VDSKWLGHFYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYN | 86.44 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 487 | 493 | 7 | HLMSIFK | 87.24 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 495 | 501 | 7 | RMVVYQG | 79.12 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 506 | 512 | 7 | TNNLETG | 73.91 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 514 | 522 | 9 | STRLFQVQG | 80.27 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 524 | 559 | 36 | GANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCG | 79.02 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 573 | 581 | 9 | VADTISRTE | 80.6 |
| DP02510 | P09327 | Villin-1 | Homo sapiens (Human) | 360 | 613 | 583 | 598 | 16 | QVVVEGQEPANFWMAL | 76.28 |
| DP02511 | P02640 | Villin-1 | Gallus gallus (Chicken) | 723 | 763 | 733 | 758 | 26 | GDNASIGQLVSGLTSKNEVFTATTTL | 76.56 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 42 | 48 | 7 | GASALTP | 79.26 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 53 | 69 | 17 | QVANEAASDVLFGNESV | 81.72 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 104 | 117 | 14 | RAGLIEHVNFKTLK | 81.49 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 119 | 161 | 43 | GSSLLGQISAITKQDLCITFTDGISGYVNLTHISEEFTSILED | 82.81 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 181 | 188 | 8 | EDAEYESS | 76.55 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 203 | 226 | 24 | NLRRYFHIGQWLRCSVIKNTSLEP | 79.06 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 235 | 241 | 7 | RIELTIE | 86.53 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 243 | 260 | 18 | SSVNIYADEDLVKSTSIQ | 86.18 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 262 | 268 | 7 | AVKSIED | 77.26 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 279 | 286 | 8 | GFTGFIAK | 86.58 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 288 | 296 | 9 | DFGNFEKLL | 82.27 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 298 | 307 | 10 | GAVFLGNITK | 78.7 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 309 | 319 | 11 | SDRSIVVNTDF | 84.4 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 322 | 377 | 56 | KKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFGLVSGVVNVSHLRTFSEED | 82.47 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 380 | 418 | 39 | HKFVIGSSIRCRIIACLENKSGDKVLILSNLPHILKLED | 79.08 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 425 | 441 | 17 | GLDAFPIGYTFESCSIK | 76.94 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 443 | 454 | 12 | RDSEYLYLALDD | 81.72 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 464 | 539 | 76 | RVGEIENSENLSSRVLGYSPVDDIYQLSTDPKYLKLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKASV | 77.82 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 547 | 559 | 13 | TRLVYPERKFKIG | 75.56 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 563 | 572 | 10 | KGRVISVNSR | 79.97 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 582 | 588 | 7 | SLVNIED | 82.42 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 593 | 604 | 12 | LVSTYENAKNIK | 86.12 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 610 | 647 | 38 | TLATIQVFKPNGCIISFFGGLSGFLPNSEISEVFVKRP | 84.67 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 654 | 663 | 10 | GQTVIVKLLD | 85.38 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 668 | 693 | 26 | RRRIIATCKVSNEQAAQQKDTIENIV | 80.52 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 695 | 716 | 22 | GRTIITVHVIEKTKDSVIVEIP | 83.25 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 720 | 757 | 38 | LRGVIYVGHLSDSRIEQNRAQLKKLRIGTELTGLVIDK | 81.32 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 760 | 774 | 15 | RTRVFNMSLKSSLIK | 78.46 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 797 | 826 | 30 | MHAYIKSISDKGLFVAFNGKFIGLVLPSYA | 81.74 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 830 | 848 | 19 | RDIDISKAFYINQSVTVYL | 78.28 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 854 | 864 | 11 | KNQKFLLSLKA | 83.98 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 874 | 880 | 7 | VESNIED | 91.97 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 882 | 903 | 22 | VDSSIKSWDDLSIGSIVKAKIK | 83.78 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 908 | 936 | 29 | NQLNVILAANLHGRVDIAEVFDTYEEITD | 79.46 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 947 | 973 | 27 | DDVIKVKIIGNHDVKSHKFLPITHKIS | 79.9 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 975 | 982 | 8 | ASVLELSM | 81.4 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 996 | 1024 | 29 | SLEEINIGQELTGFVNNSSGNHLWLTISP | 84.56 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1029 | 1051 | 23 | RISLLDLADNDSNFSENIESVFP | 82.33 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1056 | 1064 | 9 | LQVKVASID | 78.37 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1068 | 1074 | 7 | GFVNAIG | 88.06 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1076 | 1086 | 11 | SHVDINMSTIK | 81.45 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1094 | 1107 | 14 | RVLKIAEKYVLLDL | 87.67 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1111 | 1147 | 37 | VTGISFITDALNDFSLTLKEAFEDKINNVIPTTVLSV | 81.41 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1175 | 1187 | 13 | KQGEIVDGIVKNV | 82.76 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1189 | 1204 | 16 | DKGIFVYLSRKVEAFV | 84.47 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1210 | 1250 | 41 | SDSYLKEWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEIN | 78.27 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1254 | 1263 | 10 | KVLKTYSDIK | 77.89 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1265 | 1275 | 11 | GDVFEGTIKSV | 80.45 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1277 | 1300 | 24 | DFGVFVKLDNTVNVTGLAHITEIA | 81.72 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1306 | 1313 | 8 | DLSALFGV | 85.24 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1316 | 1325 | 10 | RVKAIVLKTN | 78.46 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1329 | 1363 | 35 | KQISLSLKASHFSKEAELASTTTTTTTVDQLEKED | 78.33 |
| DP02513 | Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1 | 1408 | 1369 | 1389 | 21 | ADAGFNDSDSESDIGDQNTEV | 79.36 |
| DP02514 | P36594 | DNA-directed RNA polymerase II subunit rpb1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1498 | 1752 | 1501 | 1509 | 9 | DAAAFSPLV | 75.07 |
| DP02514 | P36594 | DNA-directed RNA polymerase II subunit rpb1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1498 | 1752 | 1518 | 1532 | 15 | GFGDYGLLGAASPYK | 75.25 |
| DP02514 | P36594 | DNA-directed RNA polymerase II subunit rpb1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1498 | 1752 | 1550 | 1559 | 10 | GYGLTSPSYS | 80.27 |
| DP02514 | P36594 | DNA-directed RNA polymerase II subunit rpb1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 1498 | 1752 | 1605 | 1614 | 10 | SYSATSPSYS | 77.93 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 246 | 256 | 11 | TEQVTIQVLPP | 94.28 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 262 | 268 | 7 | EGDNITL | 84.81 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 279 | 287 | 9 | EEFLFYLPG | 87.96 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 294 | 306 | 13 | SSNTYTLTDVRRN | 76.87 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 312 | 337 | 26 | KCSLIDKKSMIASTAITVHYLDLSLN | 80.92 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 352 | 375 | 24 | VSCTISASRNATVVWMKDNIRLRS | 83.49 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 380 | 402 | 23 | SSLHYQDAGNYVCETALQEVEGL | 80.4 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 405 | 415 | 11 | RESLTLIVEGK | 88.23 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 428 | 435 | 8 | GLSKTIIC | 75.67 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 444 | 477 | 34 | AIQWTITGSGSVINQTEESPYINGRYYSKIIISP | 82.88 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 479 | 507 | 29 | ENVTLTCTAENQLERTVNSLNVSAISIPE | 77.32 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 510 | 516 | 7 | EADEISD | 79.89 |
| DP02515 | Q13740 | CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) | Homo sapiens (Human) | 246 | 583 | 525 | 552 | 28 | QAKLIVGIVVGLLLAALVAGVVYWLYMK | 87.78 |
| DP02516 | P56287 | Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 443 | 678 | 454 | 479 | 26 | DEGEFMEASGLIESTNELHLSDSESS | 76.96 |
| DP02516 | P56287 | Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 443 | 678 | 487 | 496 | 10 | EDMEFIPFSA | 77.46 |
| DP02516 | P56287 | Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 443 | 678 | 500 | 543 | 44 | SANTINSEDFDEGDFNKEAQQSLERAFEENHQIDIAALELNTLR | 77.8 |
| DP02516 | P56287 | Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 443 | 678 | 546 | 566 | 21 | MNANYHEVRSAIVLALLRRIM | 77.43 |
| DP02516 | P56287 | Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 443 | 678 | 587 | 596 | 10 | LAKLTFSHEE | 83.98 |
| DP02516 | P56287 | Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 443 | 678 | 598 | 641 | 44 | VDNVLTLQKYCVRLSMTRHFLQLLGYFYQLEIAEENAIQEWYSD | 87.21 |
| DP02516 | P56287 | Probable translation initiation factor eIF-2B subunit epsilon (eIF-2B GDP-GTP exchange factor subunit epsilon) | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) | 443 | 678 | 659 | 672 | 14 | QFVDWLNTAESESE | 76.33 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 592 | 602 | 11 | GLGASTAEISA | 78.2 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 605 | 615 | 11 | MQSMFAKNFHV | 80.51 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 621 | 645 | 25 | TSVLLSWEIPENYNSAMPFKILYDD | 82.23 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 657 | 665 | 9 | TQKLIVNLK | 88.63 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 668 | 681 | 14 | KSYSFVLTNRGNSA | 90.99 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 700 | 719 | 20 | KPAFIGKTNLDGMITVQLPD | 78.6 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 722 | 735 | 14 | ANENIKGYYIIIVP | 92.74 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 755 | 763 | 9 | LDELLKEIS | 78.93 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 777 | 793 | 17 | LKPYIAAHFDVLPTEFT | 78.12 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 795 | 805 | 11 | GDDKHYGGFTN | 75.89 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 810 | 823 | 14 | SGQEYVFFVLAVMD | 86.14 |
| DP02517 | Q64487 | Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48) | Mus musculus (Mouse) | 585 | 854 | 828 | 836 | 9 | KMYATSPYS | 76.37 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 224 | 7 | 39 | 33 | TLLATMIASALYSHQGLAADLASQCMLGVPSYD | 82.65 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 224 | 50 | 81 | 32 | LPVTINADNAKGNYPDDAVFTGNVDIMQGNSR | 84.22 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 224 | 108 | 120 | 13 | GNVHYDDNQVILK | 89.71 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 224 | 124 | 143 | 20 | GWANLNTKDTNVWEGDYQMV | 78.49 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 224 | 158 | 173 | 16 | GENRYTILENGSFTSC | 79.06 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 224 | 177 | 190 | 14 | SDTWSVVGSEVIHD | 76.4 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 224 | 193 | 204 | 12 | EQVAEIWNARFK | 79.99 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 1 | 224 | 206 | 219 | 14 | GPVPIFYSPYLQLP | 77.02 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 24 | 224 | 25 | 39 | 15 | ADLASQCMLGVPSYD | 77.66 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 24 | 224 | 50 | 81 | 32 | LPVTINADNAKGNYPDDAVFTGNVDIMQGNSR | 84.22 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 24 | 224 | 108 | 120 | 13 | GNVHYDDNQVILK | 89.71 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 24 | 224 | 124 | 143 | 20 | GWANLNTKDTNVWEGDYQMV | 78.49 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 24 | 224 | 158 | 173 | 16 | GENRYTILENGSFTSC | 79.06 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 24 | 224 | 177 | 190 | 14 | SDTWSVVGSEVIHD | 76.4 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 24 | 224 | 193 | 204 | 12 | EQVAEIWNARFK | 79.99 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 24 | 224 | 206 | 219 | 14 | GPVPIFYSPYLQLP | 77.02 |
| DP02518 | Q8ZRW0 | LPS-assembly protein LptD | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 170 | 196 | 177 | 190 | 14 | SDTWSVVGSEVIHD | 76.4 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 137 | 147 | 11 | AKKAIADLERN | 75.92 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 155 | 165 | 11 | TDSAIDIVDSV | 81.94 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 177 | 184 | 8 | QLDEITSN | 76.25 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 189 | 209 | 21 | PLANIDATDVEQIYPIESIIP | 84.46 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 211 | 225 | 15 | KELQFIRVSSILKEA | 82.88 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 230 | 252 | 23 | KLELFPYQNNSKYVAKKLDSLTQ | 83.82 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 258 | 274 | 17 | KLQLLYYLSLLLGVYEN | 85.34 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 295 | 306 | 12 | VDGILSRFTVIK | 77.93 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 314 | 322 | 9 | KDRSYFIDP | 84.24 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 324 | 348 | 25 | NEDKILCYILAIIMHLDNFIVEITP | 86.77 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 359 | 385 | 27 | KVVSLFRVLGAIVKGATVAQAEAFGIP | 81.3 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 115 | 415 | 388 | 397 | 10 | TAASYKIATM | 85.62 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 137 | 147 | 11 | AKKAIADLERN | 75.92 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 155 | 165 | 11 | TDSAIDIVDSV | 81.94 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 177 | 184 | 8 | QLDEITSN | 76.25 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 189 | 209 | 21 | PLANIDATDVEQIYPIESIIP | 84.46 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 211 | 225 | 15 | KELQFIRVSSILKEA | 82.88 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 230 | 252 | 23 | KLELFPYQNNSKYVAKKLDSLTQ | 83.82 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 258 | 274 | 17 | KLQLLYYLSLLLGVYEN | 85.34 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 295 | 306 | 12 | VDGILSRFTVIK | 77.93 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 314 | 322 | 9 | KDRSYFIDP | 84.24 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 324 | 348 | 25 | NEDKILCYILAIIMHLDNFIVEITP | 86.77 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 359 | 385 | 27 | KVVSLFRVLGAIVKGATVAQAEAFGIP | 81.3 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 116 | 415 | 388 | 397 | 10 | TAASYKIATM | 85.62 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 182 | 403 | 189 | 209 | 21 | PLANIDATDVEQIYPIESIIP | 84.46 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 182 | 403 | 211 | 225 | 15 | KELQFIRVSSILKEA | 82.88 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 182 | 403 | 230 | 252 | 23 | KLELFPYQNNSKYVAKKLDSLTQ | 83.82 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 182 | 403 | 258 | 274 | 17 | KLQLLYYLSLLLGVYEN | 85.34 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 182 | 403 | 295 | 306 | 12 | VDGILSRFTVIK | 77.93 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 182 | 403 | 314 | 322 | 9 | KDRSYFIDP | 84.24 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 182 | 403 | 324 | 348 | 25 | NEDKILCYILAIIMHLDNFIVEITP | 86.77 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 182 | 403 | 359 | 385 | 27 | KVVSLFRVLGAIVKGATVAQAEAFGIP | 81.3 |
| DP02519 | Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 182 | 403 | 388 | 397 | 10 | TAASYKIATM | 85.62 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 27 | 39 | 13 | LPAHFIGGNRLEN | 75.2 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 47 | 75 | 29 | DFVAEHGGHTVITNVLIANNGIAAVKEIR | 78.99 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 78 | 95 | 18 | RKWAYETFGDERAIKFTV | 83.87 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 104 | 116 | 13 | ANADYIRMADHYV | 80.09 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 121 | 137 | 17 | GTNNHNYANVELIVDVA | 85.4 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 142 | 149 | 8 | VHAVWAGW | 75.08 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 167 | 174 | 8 | KKIVFIGP | 95.15 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 186 | 204 | 19 | ISSTIVAQHANVPTIPWSG | 87.29 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 208 | 236 | 29 | SEVHIDENGIVTVPEEVYLKGCVNSWEEG | 79.51 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 239 | 250 | 12 | KAREIGFPVMIK | 76.09 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 267 | 291 | 25 | DQFEELYKAAAAEIPGSPIFIMKLA | 84.71 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 297 | 314 | 18 | LEVQLLADQYGNNISLFG | 84.75 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 322 | 335 | 14 | RHQKIIEEAPVTIA | 84.09 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 346 | 379 | 34 | AAVRLGKLVGYVSAGTVEYLYSHADDKFYFLELN | 82.78 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 393 | 407 | 15 | SGVNLPAAQLQIAMG | 76.81 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 415 | 422 | 8 | DIRLLYGV | 85.2 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 426 | 436 | 11 | AATEIDFEFKN | 86.23 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 453 | 459 | 7 | TACRITS | 76.54 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 472 | 492 | 21 | MLQELNFRSSSNVWGYFSVGT | 83.18 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 495 | 512 | 18 | GIHSFSDSQFGHIFAYGE | 87.96 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 521 | 566 | 46 | MIVALKELSIRGDFRTTVEYLIKLLETQAFEENTITTGWLDELISK | 82.33 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 575 | 587 | 13 | TNLAIICGAVIRA | 88.4 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 611 | 647 | 37 | DILKTVSSVDFIYEGLRYKFTVTRSSVDTYRLFINGS | 78.17 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 660 | 667 | 8 | GLLVLLGG | 86.37 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1 | 699 | 669 | 694 | 26 | SHNVYWKDEATGTRISIDGKTCLLEQ | 76.11 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1114 | 1185 | 1125 | 1136 | 12 | RPYFIDWDFALR | 80.16 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1114 | 1185 | 1140 | 1147 | 8 | ANQTESSM | 74.25 |
| DP02520 | G0S3L5 | Biotin carboxylase (EC 6.3.4.14) (EC 6.4.1.2) | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | 1114 | 1185 | 1167 | 1178 | 12 | RIHSISDMTYLA | 81.83 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 185 | 270 | 185 | 191 | 7 | GDFTLTA | 78.4 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 185 | 270 | 206 | 213 | 8 | IYKEFKMS | 74.58 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 185 | 270 | 220 | 247 | 28 | RLFEESVKFNAYESERWNTNLVKIREYT | 81.45 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 185 | 270 | 251 | 265 | 15 | YSEHISKSAKNIFLA | 80.27 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 1759 | 1826 | 68 | SEQNIAFECFKLITHFADSFIDSLSRSAFLQLIIDEFSYKDVKVSKLYDIIKNGYNRTDFIPLLFRTG | 83.14 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 1843 | 1853 | 11 | ERVTWNDWQTS | 79.14 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 1857 | 1876 | 20 | DMGSINLTITGYNRSITIIG | 81.44 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 1879 | 1890 | 12 | NKLTYAELCLTR | 77.17 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 1892 | 1900 | 9 | TPENITISG | 77.59 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 1908 | 1929 | 22 | HGLKFENMSKIQTYPGNYYITY | 85.15 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 1935 | 1949 | 15 | HQFVYQIHSHESITR | 78.86 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 1958 | 1967 | 10 | RTRIYNEITP | 88.7 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 1978 | 2001 | 24 | GDQRILIRSLDYLNNDIFSLSRIK | 77.95 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 2003 | 2023 | 21 | GLDEFATIKKAHFSKMVSFEG | 78.48 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 2031 | 2037 | 7 | LDLTELM | 76.25 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 2039 | 2063 | 25 | SQDLLNLNYDNIRNSNLISFSKLIC | 79.97 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 2066 | 2102 | 37 | GSDNINDGLEFLSDDPMNFTEGEAIHSTPIFNIYYSK | 81.04 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 2110 | 2139 | 30 | YRNAIKLLIERETKIFEEAFTFSENGFISP | 77.76 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 2142 | 2175 | 34 | LGCLEAVVSLIKLLKTNEWSTVIDKCIHICLIKN | 82.94 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 2197 | 2212 | 16 | RDINWVMFREFINSLP | 81.04 |
| DP02521 | A5HC98 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (EC 3.1.-.-) (Large structural protein) (Replicase) (Transcriptase) | Bunyavirus La Crosse | 1751 | 2263 | 2229 | 2251 | 23 | KCIALINSKFETQRDFSEFTKLM | 83.25 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 808 | 822 | 15 | RDSLLIIQWNIRAFM | 87.89 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 825 | 837 | 13 | KNWPWMKLYFKIK | 84.31 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 845 | 857 | 13 | TEKEIALMKEEFG | 75.74 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 876 | 900 | 25 | KMVSLLQEKNDLQLQVQAEQDNLAD | 77.03 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 905 | 922 | 18 | CDQLIKNKIQLEAKVKEM | 79.93 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 956 | 962 | 7 | DLELTLA | 79.93 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 984 | 993 | 10 | GLDEIIAKLT | 95.62 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1003 | 1021 | 19 | HQQALDDLQAEEDKVNTLT | 78.42 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1057 | 1071 | 15 | GDLKLTQESIMDLEN | 85.73 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1083 | 1102 | 20 | KDFELNALNARIEDEQALGS | 76.52 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1111 | 1124 | 14 | LQARIEELEEELEA | 80.27 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1142 | 1148 | 7 | ELEEISE | 78.36 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1157 | 1164 | 8 | TSVQIEMN | 77.26 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1178 | 1194 | 17 | LEEATLQHEATAAALRK | 75.49 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1200 | 1211 | 12 | VAELSEQIDNLQ | 75.75 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1222 | 1247 | 26 | SEFKLELDDVTSNMEQIIKAKANLEK | 84.59 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1279 | 1289 | 11 | KLQTENGELSR | 79.93 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1294 | 1315 | 22 | KEALISQLTRGKLTYTQQLEDL | 80.09 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1368 | 1389 | 22 | VAQWRTKYETDAIQRTEELEEA | 74.6 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1420 | 1427 | 8 | RLQNEIED | 89.59 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1445 | 1470 | 26 | KQRNFDKILAEWKQKYEESQSELESS | 77.73 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1478 | 1499 | 22 | STELFKLKNAYEESLEHLETFK | 81.27 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1504 | 1518 | 15 | NLQEEISDLTEQLGS | 78.1 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1540 | 1572 | 33 | LQSALEEAEASLEQEEGKILRAQLEFNQIKAEM | 79.82 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1596 | 1606 | 11 | SLQTSLDAETR | 77.26 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1620 | 1639 | 20 | GDLNEMEIQLSHANRLAAEA | 75.97 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1641 | 1659 | 19 | KQVKSLQSLLKDTQIQLDD | 79.62 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1667 | 1697 | 31 | LKENIAIVERRNNLLQAELEELRAVVEQTER | 80.28 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1702 | 1711 | 10 | AEQELIETSE | 77.69 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1713 | 1726 | 14 | VQLLHSQNTSLINQ | 86.57 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1736 | 1744 | 9 | QLQTEVEEA | 78.15 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1755 | 1770 | 16 | AKKAITDAAMMAEELK | 74.25 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1799 | 1807 | 9 | EAEQIALKG | 76.37 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1811 | 1833 | 23 | QLQKLEARVRELENELEAEQKRN | 74.65 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1848 | 1856 | 9 | KELTYQTEE | 80.27 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1870 | 1879 | 10 | KLQLKVKAYK | 75.18 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1887 | 1897 | 11 | EQANTNLSKFR | 80.91 |
| DP02522 | Q9BE39 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain; cardiac muscle beta isoform) (MyHC-beta) | Bos taurus (Bovine) | 807 | 1935 | 1910 | 1920 | 11 | ADIAESQVNKL | 77.26 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 20 | 41 | 22 | NAAASASAAAASAAASAACASP | 76.68 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 48 | 66 | 19 | GAAASSASAAAASAAAAPN | 77.72 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 134 | 146 | 13 | GMLVWSPNQNLSE | 82.92 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 148 | 159 | 12 | KLDEYIAIAKEK | 91.86 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 164 | 182 | 19 | MEQALGMLFWHKHNIEKSL | 76.59 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 199 | 238 | 40 | DKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKK | 78.81 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 328 | 340 | 13 | SANATAATTVLRQ | 76.18 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 351 | 363 | 13 | QIQNIKQTNSALK | 82.17 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 369 | 402 | 34 | GIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYG | 78.7 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 485 | 404 | 443 | 40 | DFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAE | 85.73 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 307 | 20 | 41 | 22 | NAAASASAAAASAAASAACASP | 76.68 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 307 | 48 | 66 | 19 | GAAASSASAAAASAAAAPN | 77.72 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 307 | 134 | 146 | 13 | GMLVWSPNQNLSE | 82.92 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 307 | 148 | 159 | 12 | KLDEYIAIAKEK | 91.86 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 307 | 164 | 182 | 19 | MEQALGMLFWHKHNIEKSL | 76.59 |
| DP02523 | Q9UKL0 | REST corepressor 1 (Protein CoREST) | Homo sapiens (Human) | 1 | 307 | 199 | 238 | 40 | DKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKK | 78.81 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1842 | 1568 | 1578 | 11 | QLAVYEEFARN | 89.72 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1842 | 1599 | 1627 | 29 | MKQAWATDDVAQIYDKCITELEQHLHAIP | 81.39 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1842 | 1636 | 1651 | 16 | AQALRSLLEVVVLSRN | 78.01 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1842 | 1655 | 1675 | 21 | AIAALGLLQKAVEGLLDATSG | 77.99 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1842 | 1678 | 1702 | 25 | ADLLLRYRECHLLVLKALQDGRAYG | 78.57 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1842 | 1711 | 1717 | 7 | TRCLIEC | 82.94 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1842 | 1719 | 1798 | 80 | DEYKYNVEAVELLIRNHLVNMQQYDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHS | 80.47 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1842 | 1813 | 1822 | 10 | VRSNYEAMID | 82.74 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1832 | 1568 | 1578 | 11 | QLAVYEEFARN | 89.72 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1832 | 1599 | 1627 | 29 | MKQAWATDDVAQIYDKCITELEQHLHAIP | 81.39 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1832 | 1636 | 1651 | 16 | AQALRSLLEVVVLSRN | 78.01 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1832 | 1655 | 1675 | 21 | AIAALGLLQKAVEGLLDATSG | 77.99 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1832 | 1678 | 1702 | 25 | ADLLLRYRECHLLVLKALQDGRAYG | 78.57 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1832 | 1711 | 1717 | 7 | TRCLIEC | 82.94 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1832 | 1719 | 1798 | 80 | DEYKYNVEAVELLIRNHLVNMQQYDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHS | 80.47 |
| DP02524 | A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | Homo sapiens (Human) | 1565 | 1832 | 1813 | 1822 | 10 | VRSNYEAMID | 82.74 |
| DP02525 | P9WGI1 | RNA polymerase sigma factor SigA (Sigma-A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 224 | 141 | 150 | 10 | ADLNLDDLED | 83.61 |
| DP02525 | P9WGI1 | RNA polymerase sigma factor SigA (Sigma-A) | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 1 | 224 | 200 | 206 | 7 | GDFVWDE | 81.13 |
| DP02526 | C4R4Y0 | DNA-directed RNA polymerase subunit (EC 2.7.7.6) | Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) | 1454 | 1743 | 1481 | 1500 | 20 | NNAQYDDEFNHDDVADVMFS | 84.15 |
| DP02526 | C4R4Y0 | DNA-directed RNA polymerase subunit (EC 2.7.7.6) | Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) | 1454 | 1743 | 1514 | 1526 | 13 | GLTEYAGIQSPYQ | 79.98 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1446 | 1733 | 1449 | 1464 | 16 | SLVKYMPEQKITEIED | 85.66 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1446 | 1733 | 1487 | 1496 | 10 | KDELMFSPLV | 79.77 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1446 | 1733 | 1505 | 1527 | 23 | AGGFTAYGGADYGEATSPFGAYG | 85.12 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1446 | 1733 | 1552 | 1564 | 13 | TSPAYSPTSPSYS | 73.91 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1446 | 1733 | 1657 | 1669 | 13 | TSPAYSPTSPSYS | 73.91 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1455 | 1733 | 1455 | 1464 | 10 | PEQKITEIED | 79.26 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1455 | 1733 | 1487 | 1496 | 10 | KDELMFSPLV | 79.77 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1455 | 1733 | 1505 | 1527 | 23 | AGGFTAYGGADYGEATSPFGAYG | 85.12 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1455 | 1733 | 1552 | 1564 | 13 | TSPAYSPTSPSYS | 73.91 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1455 | 1733 | 1657 | 1669 | 13 | TSPAYSPTSPSYS | 73.91 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1456 | 1733 | 1458 | 1464 | 7 | KITEIED | 80.27 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1456 | 1733 | 1487 | 1496 | 10 | KDELMFSPLV | 79.77 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1456 | 1733 | 1505 | 1527 | 23 | AGGFTAYGGADYGEATSPFGAYG | 85.12 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1456 | 1733 | 1552 | 1564 | 13 | TSPAYSPTSPSYS | 73.91 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1456 | 1733 | 1657 | 1669 | 13 | TSPAYSPTSPSYS | 73.91 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1549 | 1716 | 1552 | 1564 | 13 | TSPAYSPTSPSYS | 73.91 |
| DP02527 | P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)" | 1549 | 1716 | 1657 | 1669 | 13 | TSPAYSPTSPSYS | 73.91 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 926 | 936 | 11 | AGFVEICVAVC | 77.84 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 944 | 956 | 13 | SSQLYYFMTLTLA | 81.22 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 969 | 989 | 21 | TQVTITGTNLNAGSNVVVMFG | 94.36 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 999 | 1016 | 18 | SPSYIICNTTSSEEVLDM | 76.96 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 1029 | 1071 | 43 | QDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQ | 82.66 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 1078 | 1095 | 18 | GKEHINICEVLNATEMTC | 77.52 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 1115 | 1148 | 34 | EEFGFILDNVQSLLILNKTNFTYYPNPVFEAFSP | 86.2 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 1157 | 1169 | 13 | GTPIILKGKNLIP | 80.45 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 1174 | 1185 | 12 | GNVKLNYTVLVG | 85.84 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 1194 | 1207 | 14 | SDVQLLCESPNLIG | 77.93 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 920 | 1229 | 1216 | 1224 | 9 | GGMEYSPGM | 84.36 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 1004 | 1229 | 1004 | 1016 | 13 | ICNTTSSEEVLDM | 75.59 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 1004 | 1229 | 1029 | 1071 | 43 | QDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQ | 82.66 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 1004 | 1229 | 1078 | 1095 | 18 | GKEHINICEVLNATEMTC | 77.52 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 1004 | 1229 | 1115 | 1148 | 34 | EEFGFILDNVQSLLILNKTNFTYYPNPVFEAFSP | 86.2 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 1004 | 1229 | 1157 | 1169 | 13 | GTPIILKGKNLIP | 80.45 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 1004 | 1229 | 1174 | 1185 | 12 | GNVKLNYTVLVG | 85.84 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 1004 | 1229 | 1194 | 1207 | 14 | SDVQLLCESPNLIG | 77.93 |
| DP02528 | Q80UG2 | Plexin-A4 | Mus musculus (Mouse) | 1004 | 1229 | 1216 | 1224 | 9 | GGMEYSPGM | 84.36 |
| DP02529 | Q92558 | Wiskott-Aldrich syndrome protein family member 1 | Homo sapiens | 185 | 494 | 216 | 243 | 28 | DDANLLHKHIEVANGPASHFETRPQTYV | 77.47 |
| DP02529 | Q92558 | Wiskott-Aldrich syndrome protein family member 1 | Homo sapiens | 185 | 494 | 246 | 267 | 22 | MDGSYSLSALPFSQMSELLTRA | 76.07 |
| DP02529 | Q92558 | Wiskott-Aldrich syndrome protein family member 1 | Homo sapiens | 185 | 494 | 300 | 306 | 7 | ATGLIEN | 81.13 |
| DP02529 | Q92558 | Wiskott-Aldrich syndrome protein family member 1 | Homo sapiens | 185 | 494 | 334 | 344 | 11 | ALSTSSLRASM | 79.93 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 2 | 15 | 14 | GIELLCLFFLFLGR | 86.26 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 32 | 51 | 20 | EDCLLIGPQCAWCAQENFTH | 87.47 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 69 | 87 | 19 | GCQLNFIENPVSQVEILKN | 83.45 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 97 | 114 | 18 | NSSDIVQIAPQSLILKLR | 87.85 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 117 | 126 | 10 | GAQTLQVHVR | 74.52 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 132 | 145 | 14 | PVDLYYLMDLSASM | 79.93 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 147 | 155 | 9 | DDLNTIKEL | 84.69 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 166 | 180 | 15 | LTSNFRLGFGSFVEK | 87.78 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 184 | 194 | 11 | PFVKTTPEEIA | 77.2 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 199 | 238 | 40 | SIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDT | 84.7 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 242 | 251 | 10 | GFDAIMQAAV | 75.99 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 255 | 289 | 35 | KIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPN | 80.32 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 291 | 346 | 56 | GLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIP | 81.38 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 356 | 382 | 27 | DSGNILQLIISAYEELRSEVELEVLGD | 83.55 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 384 | 404 | 21 | EGLNLSFTAICNNGTLFQHQK | 83.72 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 413 | 424 | 12 | DTASFSVTVNIP | 85.79 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 430 | 437 | 8 | SRHIIIKP | 80.48 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 441 | 449 | 9 | GDALELLVS | 84.99 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 525 | 544 | 20 | HLSPYGNIYGPYCQCDNFSC | 79.97 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 569 | 578 | 10 | WTGEYCNCTT | 80.94 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 651 | 663 | 13 | LAGATISEEEDFS | 86.26 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 676 | 687 | 12 | NECLITFLITTD | 82.16 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 692 | 698 | 7 | TIIHSIN | 84.42 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 707 | 738 | 32 | NIPMIMLGVSLAILLIGVVLLCIWKLLVSFHD | 81.71 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 741 | 749 | 9 | EVAKFEAER | 79.93 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 1 | 788 | 765 | 775 | 11 | STSTFKNVTYK | 84.31 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 492 | 788 | 525 | 544 | 20 | HLSPYGNIYGPYCQCDNFSC | 79.97 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 492 | 788 | 569 | 578 | 10 | WTGEYCNCTT | 80.94 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 492 | 788 | 651 | 663 | 13 | LAGATISEEEDFS | 86.26 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 492 | 788 | 676 | 687 | 12 | NECLITFLITTD | 82.16 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 492 | 788 | 692 | 698 | 7 | TIIHSIN | 84.42 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 492 | 788 | 707 | 738 | 32 | NIPMIMLGVSLAILLIGVVLLCIWKLLVSFHD | 81.71 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 492 | 788 | 741 | 749 | 9 | EVAKFEAER | 79.93 |
| DP02530 | P18564 | Integrin beta-6 | Homo sapiens (Human) | 492 | 788 | 765 | 775 | 11 | STSTFKNVTYK | 84.31 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 268 | 274 | 7 | DTLMISR | 80.27 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 290 | 306 | 17 | PEVKFNWYVDGVEVHNA | 78.06 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 311 | 339 | 29 | REEQYNSTYRVVSVLTVLHQDWLNGKEYK | 78.53 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 364 | 371 | 8 | EPQVYTLP | 83.7 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 380 | 386 | 7 | NQVSLTC | 80.12 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 388 | 403 | 16 | VKGFYPSDIAVEWESN | 80 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 406 | 413 | 8 | PENNYKTT | 79.93 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 419 | 431 | 13 | SDGSFFLYSKLTV | 79.96 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 438 | 446 | 9 | QGNVFSCSV | 77.15 |
| DP02531 | S6B291 | IgG H chain | Homo sapiens | 240 | 465 | 451 | 460 | 10 | LHNHYTQKSL | 86.62 |
| DP02533 | P56696 | Potassium voltage-gated channel subfamily KQT member 4 | Homo sapiens | 550 | 593 | 559 | 571 | 13 | KDVIEQYSAGHLD | 81.89 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 30 | 62 | 34 | 42 | 9 | GVVNIAGIP | 82.39 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 74 | 348 | 80 | 94 | 15 | DLNGYITGQVGLIGT | 82.99 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 74 | 348 | 98 | 107 | 10 | PFSLFQELEA | 82.84 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 74 | 348 | 122 | 128 | 7 | NDIVIPE | 84.62 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 74 | 348 | 147 | 161 | 15 | ADARIQEGSIQVLSD | 83.05 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 74 | 348 | 172 | 185 | 14 | SQELSNVLNELGIE | 79.17 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 74 | 348 | 193 | 205 | 13 | LRAVFADGVLFEP | 86.11 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 74 | 348 | 208 | 238 | 31 | LELDIDEYRSDIQAAAGRAFNLSVNADYPTA | 82.07 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 74 | 348 | 257 | 263 | 7 | LQAAIED | 78.5 |
| DP02536 | P15825 | 50S ribosomal protein L10 (Acidic ribosomal protein P0 homolog) (HMal10) (L10E) | Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui) | 74 | 348 | 281 | 287 | 7 | LASQIDD | 80.6 |
| DP02539 | Q16611 | Bcl-2 homologous antagonist/killer | Homo sapiens | 64 | 98 | 76 | 83 | 8 | RQLAIIGD | 92.81 |
| DP02541 | P0ACN7 | HTH-type transcriptional repressor CytR | Escherichia coli (strain K12) | 1 | 67 | 49 | 55 | 7 | REVGYLP | 80.27 |
| DP02545 | P07948 | Tyrosine-protein kinase Lyn (EC 2.7.10.2) (Lck/Yes-related novel protein tyrosine kinase) (V-yes-1 Yamaguchi sarcoma viral related oncogene homolog) (p53Lyn) (p56Lyn) | Homo sapiens (Human) | 1 | 62 | 27 | 35 | 9 | TERTIYVRD | 80.49 |
| DP02547 | Q9Y6G9 | Cytoplasmic dynein 1 light intermediate chain 1 | Homo sapiens | 388 | 523 | 415 | 424 | 10 | SNVASVSPIP | 79.93 |
| DP02547 | Q9Y6G9 | Cytoplasmic dynein 1 light intermediate chain 1 | Homo sapiens | 388 | 523 | 443 | 454 | 12 | VLANFFNSLLSK | 81.63 |
| DP02548 | P0AES9 | Acid stress chaperone HdeA | Escherichia coli (strain K12) | 22 | 110 | 34 | 64 | 31 | VNSWTCEDFLAVDESFQPTAVGFAEALNNKD | 79.25 |
| DP02548 | P0AES9 | Acid stress chaperone HdeA | Escherichia coli (strain K12) | 22 | 110 | 68 | 89 | 22 | DAVLDVQGIATVTPAIVQACTQ | 77.39 |
| DP02548 | P0AES9 | Acid stress chaperone HdeA | Escherichia coli (strain K12) | 22 | 110 | 91 | 97 | 7 | KQANFKD | 87.96 |
| DP02551 | Q8NBP7 | Proprotein convertase subtilisin/kexin type 9 | Homo sapiens | 31 | 60 | 36 | 47 | 12 | GDYEELVLALRS | 75.78 |
| DP02551 | Q8NBP7 | Proprotein convertase subtilisin/kexin type 9 | Homo sapiens | 31 | 53 | 36 | 47 | 12 | GDYEELVLALRS | 75.78 |
| DP02552 | P43629 | Killer cell immunoglobulin-like receptor 3DL1 | Homo sapiens | 361 | 444 | 394 | 412 | 19 | EEVTYAQLDHCVFTQRKIT | 87.78 |
| DP02552 | P43629 | Killer cell immunoglobulin-like receptor 3DL1 | Homo sapiens | 361 | 444 | 423 | 433 | 11 | TDTILYTELPN | 78.44 |
| DP02554 | Q6P5W5 | Zinc transporter ZIP4 | Homo sapiens | 424 | 498 | 449 | 457 | 9 | GVSLQLAPS | 74.58 |
| DP02554 | Q6P5W5 | Zinc transporter ZIP4 | Homo sapiens | 424 | 498 | 472 | 483 | 12 | DLVAEESPELLN | 76.59 |
| DP02555 | Q15109 | Advanced glycosylation end product-specific receptor | Homo sapiens | 364 | 404 | 386 | 394 | 9 | AELNQSEEP | 74.58 |
| DP02561 | P60880 | Synaptosomal-associated protein 25 | Homo sapiens | 83 | 141 | 125 | 136 | 12 | EQMAISGGFIRR | 81.3 |
| DP02561 | P60880 | Synaptosomal-associated protein 25 | Homo sapiens | 111 | 141 | 125 | 136 | 12 | EQMAISGGFIRR | 81.3 |
| DP02568 | P04616 | Protein Rev (ART/TRS) (Anti-repression transactivator) (Regulator of expression of viral proteins) | Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1) | 66 | 116 | 99 | 111 | 13 | SPQILVESPTVLE | 74.14 |
| DP02576 | P56777 | Photosystem II CP47 reaction center protein | Arabidopsis thaliana | 480 | 508 | 488 | 499 | 12 | AQVEFGAFQKLG | 86.04 |
| DP02577 | P23321 | Oxygen-evolving enhancer protein 1-1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (Manganese-stabilizing protein 1) (MSP-1) (OEC 33 kDa subunit) | Arabidopsis thaliana (Mouse-ear cress) | 240 | 281 | 255 | 261 | 7 | NAVALPA | 79.93 |
| DP02577 | P23321 | Oxygen-evolving enhancer protein 1-1; chloroplastic (OEE1) (33 kDa subunit of oxygen evolving system of photosystem II) (33 kDa thylakoid membrane protein) (Manganese-stabilizing protein 1) (MSP-1) (OEC 33 kDa subunit) | Arabidopsis thaliana (Mouse-ear cress) | 240 | 281 | 269 | 276 | 8 | ELVKENVK | 76 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 25 | 42 | 18 | GGCLFDEPYSTCGYSQSE | 78.78 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 44 | 55 | 12 | DDFNWEQVNTLT | 80.16 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 66 | 75 | 10 | GSFMLVNASG | 75.25 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 82 | 92 | 11 | AHLLLPQLKEN | 73.91 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 97 | 108 | 12 | IDFHYFVSSKSN | 81.72 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 112 | 121 | 10 | GLLNVYVKVN | 81.17 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 126 | 134 | 9 | GNPIWNISG | 92.08 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 143 | 174 | 32 | AELAISTFWPNFYQVIFEVITSGHQGYLAIDE | 87.35 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 187 | 213 | 27 | HFLRIQNVEVNAGQFATFQCSAIGRTV | 84.05 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 215 | 225 | 11 | GDRLWLQGIDV | 79.72 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 238 | 252 | 15 | SRRFIASFNVVNTTK | 83.77 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 254 | 263 | 10 | DAGKYRCMIR | 75.25 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 266 | 278 | 13 | GGVGISNYAELVV | 81.53 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 292 | 314 | 23 | SVGATYLWIQLNANSINGDGPIV | 83.23 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 316 | 328 | 13 | REVEYCTASGSWN | 83.48 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 333 | 344 | 12 | VDSTSYKIGHLD | 79.26 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 347 | 357 | 11 | TEYEISVLLTR | 77.74 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 386 | 423 | 38 | LEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQV | 80.67 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 431 | 437 | 7 | EEVSWDT | 79.93 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 442 | 463 | 22 | PQHTITNLSPYTNVSVKLILMN | 78.87 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 470 | 478 | 9 | SQELIVQTD | 83.95 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 491 | 536 | 46 | QGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQS | 80.5 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 544 | 567 | 24 | NETHFLFFGLYPGTTYSFTIRAST | 86.71 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 575 | 585 | 11 | ATNQFTTKISA | 77.62 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 590 | 596 | 7 | AYELETP | 80.6 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 617 | 627 | 11 | PVSVYQIVVEE | 77.87 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 635 | 691 | 57 | KTTEILKCYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTIGDNKTYNGYWNTP | 80.94 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 696 | 707 | 12 | KSYRIYFQAASR | 79.35 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 21 | 742 | 710 | 722 | 13 | GETKIDCVQVATK | 79.73 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 589 | 742 | 590 | 596 | 7 | AYELETP | 80.6 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 589 | 742 | 617 | 627 | 11 | PVSVYQIVVEE | 77.87 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 589 | 742 | 635 | 691 | 57 | KTTEILKCYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTIGDNKTYNGYWNTP | 80.94 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 589 | 742 | 696 | 707 | 12 | KSYRIYFQAASR | 79.35 |
| DP02580 | P28827 | Receptor-type tyrosine-protein phosphatase mu | Homo sapiens | 589 | 742 | 710 | 722 | 13 | GETKIDCVQVATK | 79.73 |
| DP02583 | F1RAX4 | Receptor for retinol uptake stra6 (Stimulated by retinoic acid gene 6 protein homolog) | Danio rerio (Zebrafish) (Brachydanio rerio) | 575 | 597 | 577 | 592 | 16 | SAQRIRDAEEGIQLVQ | 75.88 |
| DP02584 | F1QGH7 | Catenin beta-1 (Beta-catenin) | Danio rerio (Zebrafish) (Brachydanio rerio) | 1 | 126 | 7 | 13 | 7 | LMELEMA | 76.92 |
| DP02584 | F1QGH7 | Catenin beta-1 (Beta-catenin) | Danio rerio (Zebrafish) (Brachydanio rerio) | 1 | 126 | 21 | 48 | 28 | AVSHWQQQSYLDSGIHSGATTTAPSLSG | 85.2 |
| DP02584 | F1QGH7 | Catenin beta-1 (Beta-catenin) | Danio rerio (Zebrafish) (Brachydanio rerio) | 1 | 126 | 59 | 88 | 30 | NQVLYEWEQGFNQSFNQEQVADIDGQYAMT | 77.94 |
| DP02584 | F1QGH7 | Catenin beta-1 (Beta-catenin) | Danio rerio (Zebrafish) (Brachydanio rerio) | 680 | 780 | 687 | 693 | 7 | MTWNETG | 80.27 |
| DP02584 | F1QGH7 | Catenin beta-1 (Beta-catenin) | Danio rerio (Zebrafish) (Brachydanio rerio) | 680 | 780 | 758 | 764 | 7 | TQDLIDG | 87.29 |
| DP02584 | F1QGH7 | Catenin beta-1 (Beta-catenin) | Danio rerio (Zebrafish) (Brachydanio rerio) | 680 | 780 | 768 | 775 | 8 | GDSNQLAW | 79.89 |
| DP02588 | P47273 | Uncharacterized protein MG027 | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) | 78 | 99 | 82 | 94 | 13 | NQLEIQTKYNKIS | 84.77 |
| DP02589 | Q05080 | Cytokinesis protein 2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 276 | 300 | 281 | 295 | 15 | GDMNSSANWAQMSSI | 77.28 |
| DP02590 | P47523 | Uncharacterized protein MG281 | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) | 37 | 74 | 38 | 51 | 14 | NLVNQSGYALVASG | 81.39 |
| DP02590 | P47523 | Uncharacterized protein MG281 | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) | 37 | 74 | 56 | 65 | 10 | LGFKLFSTQS | 80.37 |
| DP02590 | P47523 | Uncharacterized protein MG281 | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) | 469 | 556 | 469 | 498 | 30 | AEQNGVTFDENIKRITASGKYSVQFQKLEN | 80.03 |
| DP02590 | P47523 | Uncharacterized protein MG281 | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) | 469 | 556 | 513 | 551 | 39 | GLVTVIGEEKFETVDITGVSSDTNEVKSLAKELKTNALG | 77.15 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 1 | 80 | 45 | 51 | 7 | PEEEILG | 74.39 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 1 | 80 | 69 | 75 | 7 | HPVKIGD | 80.36 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 233 | 241 | 9 | AAEATEWQK | 77.26 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 279 | 295 | 17 | QAELLEKRLQEIEELER | 78.67 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 297 | 309 | 13 | AERKIIEENITSA | 80.09 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 333 | 339 | 7 | AAEAETA | 75.87 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 355 | 361 | 7 | EKENIEK | 79.26 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 366 | 380 | 15 | VDQELANIDPTWIES | 80.27 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 383 | 389 | 7 | TNGHIEN | 78.6 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 410 | 417 | 8 | NPEEYNLD | 77.42 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 421 | 437 | 17 | AESDYTYSSSYEQFNGE | 83.97 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 449 | 462 | 14 | QFPEFSTSLFSGSL | 85.31 |
| DP02591 | P78362 | SRSF protein kinase 2 | Homo sapiens | 231 | 511 | 492 | 499 | 8 | TVSASSTG | 75.92 |
| DP02592 | Q9H8Y8 | Golgi reassembly-stacking protein 2 | Homo sapiens | 209 | 452 | 229 | 239 | 11 | DGFTEVQLSSV | 77.87 |
| DP02592 | Q9H8Y8 | Golgi reassembly-stacking protein 2 | Homo sapiens | 209 | 452 | 253 | 263 | 11 | EQSLTGLSISS | 81.88 |
| DP02592 | Q9H8Y8 | Golgi reassembly-stacking protein 2 | Homo sapiens | 209 | 452 | 269 | 276 | 8 | SSVLSTGV | 79.6 |
| DP02592 | Q9H8Y8 | Golgi reassembly-stacking protein 2 | Homo sapiens | 209 | 452 | 287 | 293 | 7 | NQSLTSV | 86.96 |
| DP02592 | Q9H8Y8 | Golgi reassembly-stacking protein 2 | Homo sapiens | 209 | 452 | 317 | 328 | 12 | NLNLNLPAPHIM | 75.25 |
| DP02592 | Q9H8Y8 | Golgi reassembly-stacking protein 2 | Homo sapiens | 209 | 452 | 360 | 367 | 8 | LPSEFLPS | 78.26 |
| DP02592 | Q9H8Y8 | Golgi reassembly-stacking protein 2 | Homo sapiens | 209 | 452 | 380 | 388 | 9 | SGELLSSLP | 79.56 |
| DP02592 | Q9H8Y8 | Golgi reassembly-stacking protein 2 | Homo sapiens | 209 | 452 | 404 | 412 | 9 | ADAASSLTV | 78.97 |
| DP02593 | Q9ESJ0 | Exportin-4 | Mus musculus | 507 | 530 | 514 | 525 | 12 | HQQQFLASPGSS | 80.43 |
| DP02596 | Q04866 | Chain length determinant protein | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 206 | 249 | 208 | 233 | 26 | DEAKITQPQIQQTQDVTQDTMFLLGS | 78.76 |
| DP02596 | Q04866 | Chain length determinant protein | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 206 | 249 | 236 | 244 | 9 | LKSMIQNEA | 80.16 |
| DP02597 | O49195 | Vegetative storage protein 1 | Arabidopsis thaliana | 16 | 48 | 25 | 43 | 19 | VPGLIELLESNTIFGNEAE | 78.96 |
| DP02599 | Q86VN1 | Vacuolar protein-sorting-associated protein 36 | Homo sapiens | 149 | 169 | 152 | 161 | 10 | RAVGIVGIER | 85.89 |
| DP02602 | P70280 | Vesicle-associated membrane protein 7 | Mus musculus | 164 | 188 | 167 | 179 | 13 | SSVTFKTTSRNLA | 77.39 |
| DP02605 | P02533 | Keratin; type I cytoskeletal 14 (Cytokeratin-14) (CK-14) (Keratin-14) (K14) | Homo sapiens (Human) | 295 | 331 | 301 | 326 | 26 | DAEEWFFTKTEELNREVATNSELVQS | 80.61 |
| DP02607 | Q9UNA0 | A disintegrin and metalloproteinase with thrombospondin motifs 5 | Homo sapiens | 557 | 628 | 558 | 578 | 21 | KKKYYSTSSHGNWGSWGSWGQ | 76.09 |
| DP02607 | Q9UNA0 | A disintegrin and metalloproteinase with thrombospondin motifs 5 | Homo sapiens | 557 | 628 | 585 | 593 | 9 | GGVQFAYRH | 93.42 |
| DP02607 | Q9UNA0 | A disintegrin and metalloproteinase with thrombospondin motifs 5 | Homo sapiens | 557 | 628 | 608 | 616 | 9 | GKRAIYRSC | 79.49 |
| DP02608 | Q8IUQ4 | E3 ubiquitin-protein ligase SIAH1 | Homo sapiens | 90 | 124 | 91 | 101 | 11 | ANSVLFPCKYA | 83.4 |
| DP02608 | Q8IUQ4 | E3 ubiquitin-protein ligase SIAH1 | Homo sapiens | 90 | 124 | 103 | 109 | 7 | SGCEITL | 80.84 |
| DP02609 | Q96PY5 | Formin-like protein 2 (Formin homology 2 domain-containing protein 2) | Homo sapiens (Human) | 150 | 204 | 156 | 162 | 7 | STVESSV | 74.58 |
| DP02614 | Q3MIT2 | Putative tRNA pseudouridine synthase Pus10 | Homo sapiens | 76 | 106 | 76 | 85 | 10 | LEDSIDNLSQ | 77.53 |
| DP02615 | O75817 | Ribonuclease P protein subunit p20 | Homo sapiens | 1 | 28 | 10 | 23 | 14 | AVEAELDPVEYTLR | 79.12 |
| DP02619 | Q0WYX8 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | Gallus gallus (Chicken) | 736 | 920 | 745 | 758 | 14 | NTCRFEDEKICGFV | 78.48 |
| DP02619 | Q0WYX8 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | Gallus gallus (Chicken) | 736 | 920 | 761 | 776 | 16 | KMDNFDWTRQNALTQN | 75.21 |
| DP02619 | Q0WYX8 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | Gallus gallus (Chicken) | 736 | 920 | 793 | 802 | 10 | PEGYYMFIEA | 86.92 |
| DP02619 | Q0WYX8 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | Gallus gallus (Chicken) | 736 | 920 | 811 | 848 | 38 | KARLISPLYNITAKYYCVSFYYHMYGKHIGSLNLLVRV | 83.79 |
| DP02619 | Q0WYX8 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | Gallus gallus (Chicken) | 736 | 920 | 855 | 863 | 9 | DTQVWSLSG | 81.12 |
| DP02619 | Q0WYX8 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | Gallus gallus (Chicken) | 736 | 920 | 869 | 875 | 7 | WQQAHVP | 81.65 |
| DP02619 | Q0WYX8 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | Gallus gallus (Chicken) | 736 | 920 | 880 | 889 | 10 | GPFQIIFEGV | 80.13 |
| DP02619 | Q0WYX8 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | Gallus gallus (Chicken) | 736 | 920 | 891 | 906 | 16 | GTSYEGDIAIDDVTLK | 80.31 |
| DP02620 | Q14194 | Dihydropyrimidinase-related protein 1 | Homo sapiens | 497 | 572 | 535 | 548 | 14 | HQSNFSLSGAQIDD | 81.82 |
| DP02623 | P42003 | Protein mothers against dpp | Drosophila melanogaster (Fruit fly) | 215 | 256 | 239 | 245 | 7 | GGQLLDA | 76.49 |
| DP02626 | Q9QUG2 | DNA polymerase kappa | Mus musculus | 546 | 616 | 588 | 597 | 10 | GQQALQILEP | 79.3 |
| DP02626 | Q9QUG2 | DNA polymerase kappa | Mus musculus | 546 | 616 | 603 | 611 | 9 | KLSESFETS | 75.62 |
| DP02632 | P31321 | cAMP-dependent protein kinase type I-beta regulatory subunit | Homo sapiens (Human) | 59 | 81 | 62 | 74 | 13 | NRQILARQKSNSQ | 77.26 |
| DP02633 | P22605 | Retinoic acid receptor beta | Mus musculus | 454 | 481 | 454 | 462 | 9 | SSGNIAEHS | 85.28 |
| DP02635 | Q9ERE3 | Serine/threonine-protein kinase Sgk3 (EC 2.7.11.1) (Cytokine-independent survival kinase) (Serum/glucocorticoid-regulated kinase 3) (Serum/glucocorticoid-regulated kinase-like) | Mus musculus (Mouse) | 126 | 160 | 143 | 149 | 7 | TSRNINL | 85.28 |
| DP02641 | Q8GY88 | Shikimate kinase 2; chloroplastic | Arabidopsis thaliana | 55 | 81 | 65 | 76 | 12 | SALLETGSLLHS | 77.26 |
| DP02642 | P53780 | Cystathionine beta-lyase; chloroplastic | Arabidopsis thaliana | 57 | 84 | 68 | 79 | 12 | TVNNTTDSLNTM | 78.93 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 103 | 113 | 11 | KKVTIFFGTQT | 78.17 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 134 | 145 | 12 | TRFKIVDLDDYA | 87.29 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 147 | 153 | 7 | DDDEYEE | 74.1 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 158 | 169 | 12 | EDVAFFFLATYG | 90.75 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 176 | 187 | 12 | NAARFYKWFTEG | 80.8 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 191 | 216 | 26 | GEWLKNLKYGVFGLGNRQYEHFNKVA | 82.97 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 219 | 237 | 19 | VDDILVEQGAQRLVQVGLG | 75.92 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 239 | 263 | 25 | DDQCIEDDFTAWREALWPELDTILR | 77.63 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 268 | 287 | 20 | TAVATPYTAAVLEYRVSIHD | 78.34 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 73 | 303 | 289 | 298 | 10 | EDAKFNDINM | 81.54 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 263 | 303 | 268 | 287 | 20 | TAVATPYTAAVLEYRVSIHD | 78.34 |
| DP02644 | Q9SUM3 | NADPH--cytochrome P450 reductase 2 | Arabidopsis thaliana | 263 | 303 | 289 | 298 | 10 | EDAKFNDINM | 81.54 |
| DP02652 | Q96FQ6 | Protein S100-A16 | Homo sapiens | 51 | 71 | 59 | 66 | 8 | ADKLIQNL | 86.91 |
| DP02653 | P61765 | Syntaxin-binding protein 1 (N-Sec1) (Protein unc-18 homolog 1) (Unc18-1) (Protein unc-18 homolog A) (Unc-18A) (p67) (rbSec1) | Rattus norvegicus (Rat) | 295 | 358 | 336 | 353 | 18 | QYQKELSKYSTHLHLAED | 84.06 |
| DP02656 | P08294 | Extracellular superoxide dismutase Cu-Zn | Homo sapiens | 19 | 54 | 31 | 49 | 19 | SAEWIRDMYAKVTEIWQEV | 79.79 |
| DP02657 | O88483 | Pyruvate dehydrogenase acetyl-transferring-phosphatase 1; mitochondrial | Rattus norvegicus | 445 | 475 | 459 | 465 | 7 | HGLLTER | 75.59 |
| DP02660 | Q9SKB2 | Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1 | Arabidopsis thaliana | 225 | 270 | 225 | 235 | 11 | VMSSIKLQTSP | 79.93 |
| DP02660 | Q9SKB2 | Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1 | Arabidopsis thaliana | 225 | 270 | 237 | 246 | 10 | QTRHILAETP | 77.26 |
| DP02669 | Q57530 | 6b protein | Rhizobium radiobacter | 164 | 184 | 169 | 179 | 11 | NEGIENEEEEE | 79.93 |
| DP02673 | P11926 | Ornithine decarboxylase (ODC) (EC 4.1.1.17) | Homo sapiens (Human) | 422 | 461 | 439 | 446 | 8 | VSCAWESG | 77.26 |
| DP02679 | Q8R464 | Cell adhesion molecule 4 | Mus musculus | 25 | 120 | 26 | 44 | 19 | EVQTENVTVAEGGVAEITC | 77.8 |
| DP02679 | Q8R464 | Cell adhesion molecule 4 | Mus musculus | 25 | 120 | 49 | 69 | 21 | YDGSIVVIQNPARQTLFFNGT | 83.52 |
| DP02679 | Q8R464 | Cell adhesion molecule 4 | Mus musculus | 25 | 120 | 73 | 82 | 10 | KDERFQLEEF | 82.58 |
| DP02679 | Q8R464 | Cell adhesion molecule 4 | Mus musculus | 25 | 120 | 99 | 110 | 12 | EGGYFCQLYTED | 78.79 |
| DP02683 | Q9DBG5 | Perilipin-3 | Mus musculus | 289 | 320 | 301 | 311 | 11 | LHQMWLSWNQK | 77.26 |
| DP02690 | F4JL28 | Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS) | Arabidopsis thaliana (Mouse-ear cress) | 197 | 234 | 203 | 210 | 8 | SQNGFTSS | 79.43 |
| DP02690 | F4JL28 | Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS) | Arabidopsis thaliana (Mouse-ear cress) | 197 | 234 | 218 | 229 | 12 | RLSLFSHLLYRC | 81.74 |
| DP02690 | F4JL28 | Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS) | Arabidopsis thaliana (Mouse-ear cress) | 200 | 234 | 203 | 210 | 8 | SQNGFTSS | 79.43 |
| DP02690 | F4JL28 | Chromatin remodeling protein EBS (Protein EARLY BOLTING IN SHORT DAYS) | Arabidopsis thaliana (Mouse-ear cress) | 200 | 234 | 218 | 229 | 12 | RLSLFSHLLYRC | 81.74 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 1 | 15 | 15 | MAFLDNPTIILAHIR | 80.16 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 50 | 58 | 9 | SGSEIQGSN | 80.27 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 60 | 81 | 22 | ETQGYVYAQSVDITSSWDFGIR | 78.61 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 97 | 111 | 15 | RQNQIKCKNIQWKER | 75.88 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 117 | 125 | 9 | AQELKSLFE | 79.26 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 137 | 148 | 12 | GKQSILSVRLEQ | 78.15 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 153 | 164 | 12 | LNNPFNEYSKFD | 81.66 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 168 | 182 | 15 | HVGTTATKKIDVYLP | 77.79 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 193 | 217 | 25 | MTVVTMASARVQDLIGLICWQYTSE | 82.35 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 224 | 237 | 14 | NDNVSAYCLHIAED | 88.25 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 256 | 270 | 15 | KFGFSTLALVEKYSS | 82.61 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 276 | 284 | 9 | KESLFVRIN | 95.21 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 288 | 308 | 21 | GFSLIQVDNTKVTMKEILLKA | 87.9 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 337 | 357 | 21 | LDSTLESQSAWEFCLVRENSS | 78.34 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 359 | 412 | 54 | ADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEID | 77.23 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 421 | 441 | 21 | TKFWIKQKPISIDSDLLCACD | 78.36 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 449 | 489 | 41 | SHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESR | 82.01 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 494 | 506 | 13 | RADYFAQKQRKLN | 74.25 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 1 | 522 | 509 | 517 | 9 | TSFSFQKEK | 86.29 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 248 | 522 | 256 | 270 | 15 | KFGFSTLALVEKYSS | 82.61 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 248 | 522 | 276 | 284 | 9 | KESLFVRIN | 95.21 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 248 | 522 | 288 | 308 | 21 | GFSLIQVDNTKVTMKEILLKA | 87.9 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 248 | 522 | 337 | 357 | 21 | LDSTLESQSAWEFCLVRENSS | 78.34 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 248 | 522 | 359 | 412 | 54 | ADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEID | 77.23 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 248 | 522 | 421 | 441 | 21 | TKFWIKQKPISIDSDLLCACD | 78.36 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 248 | 522 | 449 | 489 | 41 | SHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESR | 82.01 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 248 | 522 | 494 | 506 | 13 | RADYFAQKQRKLN | 74.25 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 248 | 522 | 509 | 517 | 9 | TSFSFQKEK | 86.29 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 360 | 522 | 361 | 412 | 52 | GVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEID | 76.92 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 360 | 522 | 421 | 441 | 21 | TKFWIKQKPISIDSDLLCACD | 78.36 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 360 | 522 | 449 | 489 | 41 | SHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESR | 82.01 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 360 | 522 | 494 | 506 | 13 | RADYFAQKQRKLN | 74.25 |
| DP02693 | Q9BPZ7 | Target of rapamycin complex 2 subunit MAPKAP1 | Homo sapiens | 360 | 522 | 509 | 517 | 9 | TSFSFQKEK | 86.29 |
| DP02700 | P0A8S9 | Flagellar transcriptional regulator FlhD | Escherichia coli (strain K12) | 83 | 116 | 86 | 107 | 22 | DLQQIHTGIMLSTRLLNDVNQP | 78.2 |
| DP02703 | O00411 | DNA-directed RNA polymerase; mitochondrial | Homo sapiens | 105 | 217 | 121 | 127 | 7 | RWAKILE | 75.92 |
| DP02703 | O00411 | DNA-directed RNA polymerase; mitochondrial | Homo sapiens | 1086 | 1108 | 1094 | 1103 | 10 | GIQSITYTHN | 87.76 |
| DP02704 | P41214 | Eukaryotic translation initiation factor 2D | Homo sapiens | 348 | 373 | 351 | 359 | 9 | RITSFVIPE | 77.07 |
| DP02709 | P04035 | 3-hydroxy-3-methylglutaryl-coenzyme A reductase | Homo sapiens | 861 | 888 | 870 | 878 | 9 | NRSKINLQD | 80.6 |
| DP02711 | Q9V6K1 | Tripeptidyl-peptidase 2 | Drosophila melanogaster | 1027 | 1098 | 1033 | 1055 | 23 | LTLDFYENYNQCIVGGRKYVSSP | 85.59 |
| DP02711 | Q9V6K1 | Tripeptidyl-peptidase 2 | Drosophila melanogaster | 1027 | 1098 | 1060 | 1074 | 15 | TRVLYIAPITQERLT | 83.43 |
| DP02711 | Q9V6K1 | Tripeptidyl-peptidase 2 | Drosophila melanogaster | 1027 | 1098 | 1080 | 1093 | 14 | AQCAWLSGNLVFPQ | 77.5 |
| DP02712 | Q9H3P2 | Negative elongation factor A | Homo sapiens | 189 | 528 | 255 | 263 | 9 | KLLDISELD | 79.93 |
| DP02712 | Q9H3P2 | Negative elongation factor A | Homo sapiens | 189 | 528 | 290 | 298 | 9 | ETVVENATP | 74.58 |
| DP02712 | Q9H3P2 | Negative elongation factor A | Homo sapiens | 189 | 528 | 333 | 339 | 7 | PASSYIP | 85.86 |
| DP02712 | Q9H3P2 | Negative elongation factor A | Homo sapiens | 189 | 528 | 430 | 448 | 19 | NLSLTREQMFAAQEMFKTA | 78.08 |
| DP02712 | Q9H3P2 | Negative elongation factor A | Homo sapiens | 189 | 528 | 455 | 464 | 10 | EKALILGFMA | 82.88 |
| DP02712 | Q9H3P2 | Negative elongation factor A | Homo sapiens | 189 | 528 | 475 | 484 | 10 | GDVIQIKLSE | 76.35 |
| DP02712 | Q9H3P2 | Negative elongation factor A | Homo sapiens | 189 | 528 | 495 | 522 | 28 | QGSTTMLVDTVFEMNYATGQWTRFKKYK | 79.46 |
| DP02713 | P18615 | Negative elongation factor E (NELF-E) (RNA-binding protein RD) | Homo sapiens (Human) | 139 | 363 | 166 | 174 | 9 | FDWGYEERS | 86.62 |
| DP02713 | P18615 | Negative elongation factor E (NELF-E) (RNA-binding protein RD) | Homo sapiens (Human) | 139 | 363 | 261 | 269 | 9 | GNTLYVYGE | 83.35 |
| DP02713 | P18615 | Negative elongation factor E (NELF-E) (RNA-binding protein RD) | Homo sapiens (Human) | 139 | 363 | 276 | 289 | 14 | LRGAFSPFGNIIDL | 80.67 |
| DP02713 | P18615 | Negative elongation factor E (NELF-E) (RNA-binding protein RD) | Homo sapiens (Human) | 139 | 363 | 295 | 304 | 10 | RNCAFVTYEK | 93.58 |
| DP02713 | P18615 | Negative elongation factor E (NELF-E) (RNA-binding protein RD) | Homo sapiens (Human) | 139 | 363 | 310 | 330 | 21 | QAVAELNGTQVESVQLKVNIA | 85.91 |
| DP02713 | P18615 | Negative elongation factor E (NELF-E) (RNA-binding protein RD) | Homo sapiens (Human) | 139 | 363 | 336 | 352 | 17 | LDAATGKSVWGSLAVQN | 74.96 |
| DP02722 | P33334 | Pre-mRNA-splicing factor 8 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 2087 | 2147 | 2098 | 2104 | 7 | MAELEAA | 79.93 |
| DP02722 | P33334 | Pre-mRNA-splicing factor 8 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 2087 | 2147 | 2114 | 2142 | 29 | AAGASTVMKTKTINAQGEEIVVVASADYE | 80.27 |
| DP02726 | Q42521 | Glutamate decarboxylase 1 | Arabidopsis thaliana | 1 | 57 | 5 | 27 | 23 | HAVSESDVSVHSTFASRYVRTSL | 81.85 |
| DP02726 | Q42521 | Glutamate decarboxylase 1 | Arabidopsis thaliana | 1 | 57 | 39 | 52 | 14 | KEAAYQIINDELML | 80.1 |
| DP02726 | Q42521 | Glutamate decarboxylase 1 | Arabidopsis thaliana | 449 | 502 | 451 | 473 | 23 | VIHKISLGQEKSESNSDNLMVTV | 79.09 |
| DP02726 | Q42521 | Glutamate decarboxylase 1 | Arabidopsis thaliana | 449 | 502 | 481 | 495 | 15 | QRDIITGWKKFVADR | 75.23 |
| DP02726 | Q42521 | Glutamate decarboxylase 1 | Arabidopsis thaliana | 449 | 470 | 451 | 465 | 15 | VIHKISLGQEKSESN | 81.27 |
| DP02726 | Q42521 | Glutamate decarboxylase 1 | Arabidopsis thaliana | 471 | 502 | 481 | 495 | 15 | QRDIITGWKKFVADR | 75.23 |
| DP02730 | Q6P1M3 | LLGL scribble cell polarity complex component 2 | Homo sapiens | 631 | 708 | 632 | 638 | 7 | DQLALEG | 75.39 |
| DP02730 | Q6P1M3 | LLGL scribble cell polarity complex component 2 | Homo sapiens | 631 | 708 | 687 | 693 | 7 | GLQNMEL | 76.92 |
| DP02730 | Q6P1M3 | LLGL scribble cell polarity complex component 2 | Homo sapiens | 631 | 708 | 696 | 703 | 8 | VQRKIEAR | 80.27 |
| DP02735 | P07355 | Annexin A2 (Annexin II) (Annexin-2) (Calpactin I heavy chain) (Calpactin-1 heavy chain) (Chromobindin-8) (Lipocortin II) (Placental anticoagulant protein IV) (PAP-IV) (Protein I) (p36) | Homo sapiens (Human) | 2 | 33 | 3 | 15 | 13 | TVHEILCKLSLEG | 76 |
| DP02736 | Q04049 | DNA polymerase eta | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 510 | 632 | 510 | 529 | 20 | DLQKTVVDMFGNQVHTFKSS | 76.04 |
| DP02736 | Q04049 | DNA polymerase eta | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 510 | 632 | 551 | 579 | 29 | ECCKYQVTFTDQKALQEHADYHLALKLSE | 87.63 |
| DP02736 | Q04049 | DNA polymerase eta | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 510 | 632 | 583 | 601 | 19 | GAEESSKNLSFGEKRLLFS | 78.95 |
| DP02736 | Q04049 | DNA polymerase eta | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 510 | 632 | 616 | 627 | 12 | KQVTSSKNILSF | 81.88 |
| DP02741 | P09951 | Synapsin-1 | Rattus norvegicus | 2 | 111 | 9 | 24 | 16 | SDSNFMANLPNGYMTD | 93.31 |
| DP02741 | P09951 | Synapsin-1 | Rattus norvegicus | 2 | 111 | 46 | 56 | 11 | SAAASAERAST | 73.91 |
| DP02741 | P09951 | Synapsin-1 | Rattus norvegicus | 2 | 111 | 73 | 99 | 27 | GGGFFSSLSNAVKQTTAAAAATFSEQV | 78.25 |
| DP02742 | P06756 | Integrin alpha-V | Homo sapiens | 868 | 897 | 883 | 892 | 10 | RDHLITKRDL | 81.67 |
| DP02744 | Q92574 | Hamartin | Homo sapiens | 939 | 992 | 941 | 967 | 27 | LQAAESRYEAQKRITQVFELEILDLYG | 81.12 |
| DP02746 | Q14565 | Meiotic recombination protein DMC1/LIM15 homolog | Homo sapiens (Human) | 1 | 82 | 17 | 29 | 13 | EESLFQDIDLLQK | 83.92 |
| DP02746 | Q14565 | Meiotic recombination protein DMC1/LIM15 homolog | Homo sapiens (Human) | 1 | 82 | 41 | 56 | 16 | KSVGICTIKGIQMTTR | 81.9 |
| DP02756 | P21447 | ATP-dependent translocase ABCB1 | Mus musculus | 627 | 686 | 627 | 637 | 11 | AGNEIELGNEA | 76.8 |
| DP02756 | P21447 | ATP-dependent translocase ABCB1 | Mus musculus | 627 | 683 | 627 | 637 | 11 | AGNEIELGNEA | 76.8 |
| DP02761 | P25299 | "mRNA 3-end-processing protein RNA15" | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 127 | 232 | 131 | 146 | 16 | DFQNSGNANFLSQKFP | 80.14 |
| DP02761 | P25299 | "mRNA 3-end-processing protein RNA15" | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 127 | 232 | 152 | 160 | 9 | IDVNINMTT | 83.05 |
| DP02761 | P25299 | "mRNA 3-end-processing protein RNA15" | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 127 | 232 | 162 | 170 | 9 | AMMISSELA | 75.25 |
| DP02761 | P25299 | "mRNA 3-end-processing protein RNA15" | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 127 | 232 | 176 | 190 | 15 | VQLKFLQKFQEWTRA | 83.1 |
| DP02761 | P25299 | "mRNA 3-end-processing protein RNA15" | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 127 | 232 | 194 | 219 | 26 | DAVSLLELCPQLSFVTAELLLTNGIC | 77.01 |
| DP02761 | P25299 | "mRNA 3-end-processing protein RNA15" | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 127 | 232 | 221 | 227 | 7 | VDDLIPL | 79.93 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 3 | 11 | 9 | ALPLLAATT | 76.03 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 23 | 32 | 10 | LPLLLFLLPA | 78.36 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 34 | 41 | 8 | AVQGWETE | 75.96 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 49 | 62 | 14 | EECHFYAGGQVYPG | 81.92 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 90 | 123 | 34 | GTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFV | 83.24 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 125 | 162 | 38 | PTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINT | 81.13 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 187 | 194 | 8 | DYGVYLED | 81.19 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 199 | 207 | 9 | LRGLFIIDD | 79.67 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 210 | 217 | 8 | ILRQITLN | 78.8 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 271 | 231 | 239 | 9 | LVQAFQYTD | 89.97 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 75 | 3 | 11 | 9 | ALPLLAATT | 76.03 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 75 | 23 | 32 | 10 | LPLLLFLLPA | 78.36 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 75 | 34 | 41 | 8 | AVQGWETE | 75.96 |
| DP02764 | Q13162 | Peroxiredoxin-4 | Homo sapiens | 1 | 75 | 49 | 62 | 14 | EECHFYAGGQVYPG | 81.92 |
| DP02768 | P09950 | 5-aminolevulinate synthase; mitochondrial | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 83 | 113 | 88 | 104 | 17 | KSYRYFNNINRLAKEFP | 95.34 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 26 | 1 | 21 | 21 | MFVFLVLLPLVSSQCVNLTTR | 80.39 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 144 | 164 | 153 | 159 | 7 | MESEFRV | 80.36 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 319 | 541 | 322 | 356 | 35 | PTESIVRFPNITNLCPFGEVFNATRFASVYAWNRK | 77.99 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 319 | 541 | 362 | 381 | 20 | VADYSVLYNSASFSTFKCYG | 81.19 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 319 | 541 | 388 | 404 | 17 | NDLCFTNVYADSFVIRG | 79.15 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 319 | 541 | 414 | 425 | 12 | QTGKIADYNYKL | 89.16 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 319 | 541 | 430 | 442 | 13 | TGCVIAWNSNNLD | 80.29 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 319 | 541 | 445 | 460 | 16 | VGGNYNYLYRLFRKSN | 84.72 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 319 | 541 | 468 | 477 | 10 | ISTEIYQAGS | 76.22 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 319 | 541 | 482 | 520 | 39 | GVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHA | 78.84 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 437 | 508 | 445 | 460 | 16 | VGGNYNYLYRLFRKSN | 84.72 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 437 | 508 | 468 | 477 | 10 | ISTEIYQAGS | 76.22 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 437 | 508 | 482 | 503 | 22 | GVEGFNCYFPLQSYGFQPTNGV | 80.15 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 455 | 490 | 468 | 477 | 10 | ISTEIYQAGS | 76.22 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 828 | 853 | 829 | 848 | 20 | ADAGFIKQYGDCLGDIAARD | 75.42 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 829 | 852 | 829 | 847 | 19 | ADAGFIKQYGDCLGDIAAR | 75.32 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1147 | 1208 | 1151 | 1160 | 10 | ELDKYFKNHT | 80.47 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1147 | 1208 | 1168 | 1203 | 36 | DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL | 83.84 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1148 | 1273 | 1151 | 1160 | 10 | ELDKYFKNHT | 80.47 |
| DP02772 | P0DTC2 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1148 | 1273 | 1168 | 1239 | 72 | DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTS | 86.4 |
| DP02782 | Q9NPI8 | Fanconi anemia group F protein | Homo sapiens | 156 | 357 | 165 | 175 | 11 | TQAELLLERLQ | 80.27 |
| DP02782 | Q9NPI8 | Fanconi anemia group F protein | Homo sapiens | 156 | 357 | 186 | 212 | 27 | ARFLSSLWERLPQNNFLKVIAVALLQP | 80.96 |
| DP02782 | Q9NPI8 | Fanconi anemia group F protein | Homo sapiens | 156 | 357 | 233 | 254 | 22 | GSQVLVHWLLGNSEVFAAFCRA | 83.28 |
| DP02782 | Q9NPI8 | Fanconi anemia group F protein | Homo sapiens | 156 | 357 | 257 | 266 | 10 | AGLLTLVTSR | 78.16 |
| DP02782 | Q9NPI8 | Fanconi anemia group F protein | Homo sapiens | 156 | 357 | 271 | 280 | 10 | SPVYLGLLTD | 76.62 |
| DP02782 | Q9NPI8 | Fanconi anemia group F protein | Homo sapiens | 156 | 357 | 290 | 316 | 27 | QKGIWVGTESQDVPWEELHNRFQSLCQ | 75.13 |
| DP02782 | Q9NPI8 | Fanconi anemia group F protein | Homo sapiens | 156 | 357 | 323 | 332 | 10 | DKVLTALETC | 75.65 |
| DP02782 | Q9NPI8 | Fanconi anemia group F protein | Homo sapiens | 156 | 357 | 343 | 352 | 10 | GLSIWTDLLL | 79 |
| DP02787 | P45523 | FKBP-type peptidyl-prolyl cis-trans isomerase FkpA | Escherichia coli (strain K12) | 15 | 114 | 15 | 28 | 14 | AVALHAPITFAAEA | 79.14 |
| DP02787 | P45523 | FKBP-type peptidyl-prolyl cis-trans isomerase FkpA | Escherichia coli (strain K12) | 15 | 114 | 46 | 64 | 19 | QKSAYALGASLGRYMENSL | 77.64 |
| DP02787 | P45523 | FKBP-type peptidyl-prolyl cis-trans isomerase FkpA | Escherichia coli (strain K12) | 15 | 114 | 76 | 88 | 13 | KDQLIAGVQDAFA | 92.2 |
| DP02787 | P45523 | FKBP-type peptidyl-prolyl cis-trans isomerase FkpA | Escherichia coli (strain K12) | 15 | 114 | 94 | 109 | 16 | SDQEIEQTLQAFEARV | 78.55 |
| DP02790 | Q8BTI9 | Phosphatidylinositol 4;5-bisphosphate 3-kinase catalytic subunit beta isoform | Mus musculus | 402 | 431 | 410 | 423 | 14 | STKTINPSKYQTIR | 82.66 |
| DP02791 | O08908 | Phosphatidylinositol 3-kinase regulatory subunit beta (PI3-kinase regulatory subunit beta) (PI3K regulatory subunit beta) (PtdIns-3-kinase regulatory subunit beta) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta) (PI3-kinase subunit p85-beta) (PtdIns-3-kinase regulatory subunit p85-beta) | Mus musculus (Mouse) | 576 | 607 | 581 | 602 | 22 | RQRKINEWLGIKNETEDQYSLM | 77.12 |
| DP02795 | Q9NV23 | S-acyl fatty acid synthase thioesterase; medium chain (EC 3.1.2.14) (Augmented in rheumatoid arthritis 1) (AURA1) (Oleoyl-ACP hydrolase) (Thioesterase 2) (TE2) (Thioesterase II) (Thioesterase domain-containing protein 1) | Homo sapiens (Human) | 1 | 24 | 11 | 19 | 9 | RNENIFNCL | 83.95 |
| DP02796 | Q56026 | Cell invasion protein SipD (Salmonella invasion protein D) | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) | 110 | 132 | 113 | 121 | 9 | TSALFSASP | 76.96 |
| DP02799 | P34257 | Transposable element Tc3 transposase | Caenorhabditis elegans | 104 | 135 | 124 | 130 | 7 | KRLEFAK | 76.11 |
| DP02800 | P63028 | Translationally-controlled tumor protein (TCTP) (21 kDa polypeptide) (p21) (p23) | Mus musculus (Mouse) | 39 | 66 | 39 | 56 | 18 | TEGAIDDSLIGGNASAEG | 81.81 |
| DP02801 | P05452 | Tetranectin | Homo sapiens | 1 | 49 | 1 | 22 | 22 | MELWGAYLLLCLFSLLTQVTTE | 81.77 |
| DP02801 | P05452 | Tetranectin | Homo sapiens | 1 | 49 | 37 | 44 | 8 | DVVNTKMF | 77.68 |
| DP02803 | Q96Q11 | CCA tRNA nucleotidyltransferase 1; mitochondrial | Homo sapiens | 384 | 434 | 395 | 418 | 24 | KVGISSGKEIGALLQQLREQWKKS | 75.32 |
| DP02805 | Q91WA6 | Sharpin | Mus musculus | 301 | 341 | 305 | 312 | 8 | GQSLQNSK | 76.51 |
| DP02806 | P0CY08 | Mating-type protein ALPHA2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 103 | 132 | 112 | 127 | 16 | DGLVFNVVTQDMINKS | 77.36 |
| DP02808 | P53927 | Ribosome biogenesis protein 15 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 1 | 87 | 29 | 36 | 8 | ELALETSS | 78.85 |
| DP02808 | P53927 | Ribosome biogenesis protein 15 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 1 | 80 | 29 | 36 | 8 | ELALETSS | 78.85 |
| DP02815 | P62330 | ADP-ribosylation factor 6 | Homo sapiens | 34 | 56 | 36 | 51 | 16 | GQSVTTIPTVGFNVET | 77.84 |
| DP02817 | Q64373 | Bcl-2-like protein 1 | Mus musculus | 28 | 81 | 28 | 35 | 8 | SDVEENRT | 79.93 |
| DP02817 | Q64373 | Bcl-2-like protein 1 | Mus musculus | 28 | 81 | 47 | 60 | 14 | TPSAINGNPSWHLA | 84.95 |
| DP02820 | Q62264 | Thyroid hormone-inducible hepatic protein | Mus musculus | 1 | 150 | 10 | 34 | 25 | KNCLLTVMDRYSAVVRNMEQVVMIP | 80.36 |
| DP02820 | Q62264 | Thyroid hormone-inducible hepatic protein | Mus musculus | 1 | 150 | 53 | 70 | 18 | APDLYTYFTMLKSICVEV | 78.84 |
| DP02820 | Q62264 | Thyroid hormone-inducible hepatic protein | Mus musculus | 1 | 150 | 84 | 132 | 49 | VAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLT | 76.27 |
| DP02820 | Q62264 | Thyroid hormone-inducible hepatic protein | Mus musculus | 1 | 150 | 138 | 145 | 8 | VTRKYQEM | 76.25 |
| DP02820 | Q62264 | Thyroid hormone-inducible hepatic protein | Mus musculus | 77 | 104 | 84 | 99 | 16 | VAGNETSEAENDAAET | 73.91 |
| DP02822 | Q8IVH8 | Mitogen-activated protein kinase kinase kinase kinase 3 | Homo sapiens | 315 | 380 | 327 | 339 | 13 | TRSEITFGQVKFD | 88.53 |
| DP02822 | Q8IVH8 | Mitogen-activated protein kinase kinase kinase kinase 3 | Homo sapiens | 315 | 380 | 355 | 375 | 21 | SDGFLDSSEEIYYTARSNLDL | 83.26 |
| DP02826 | P40344 | Autophagy-related protein 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 84 | 162 | 103 | 113 | 11 | DDVLEYIGSET | 93.83 |
| DP02826 | P40344 | Autophagy-related protein 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 84 | 162 | 132 | 142 | 11 | IDELIQDMEIK | 85.5 |
| DP02826 | P40344 | Autophagy-related protein 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 84 | 162 | 149 | 155 | 7 | DTEEFNA | 84.62 |
| DP02826 | P40344 | Autophagy-related protein 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 84 | 128 | 103 | 113 | 11 | DDVLEYIGSET | 93.83 |
| DP02826 | P40344 | Autophagy-related protein 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 142 | 162 | 149 | 155 | 7 | DTEEFNA | 84.62 |
| DP02831 | Q13164 | Mitogen-activated protein kinase 7 (MAP kinase 7) (MAPK 7) (EC 2.7.11.24) (Big MAP kinase 1) (BMK-1) (Extracellular signal-regulated kinase 5) (ERK-5) | Homo sapiens (Human) | 1 | 46 | 33 | 41 | 9 | AAKNLALLK | 76.03 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 409 | 426 | 18 | QQRKFQYGNYCKYYGYRN | 81.87 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 455 | 466 | 12 | GHLTLSIACKWG | 79.54 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 483 | 497 | 15 | ARQNIRHYLSEELRL | 79.46 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 545 | 564 | 20 | DTSVFPNNVVFVTGNYVLDR | 84.21 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 575 | 593 | 19 | YDVVLCLSLTKWVHLNWGD | 79.23 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 599 | 605 | 7 | MFRRIYR | 75.06 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 611 | 617 | 7 | GILVLEP | 79.65 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 629 | 642 | 14 | LTETIYKNYYRIQL | 85.71 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 645 | 651 | 7 | EQFSSYL | 78.55 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 653 | 667 | 15 | SPDVGFSSYELVATP | 76.14 |
| DP02832 | Q7L2J0 | 7SK snRNA methylphosphate capping enzyme | Homo sapiens | 400 | 689 | 676 | 684 | 9 | RPVYLFHKA | 79.56 |
| DP02833 | Q9Y4F1 | FERM; ARHGEF and pleckstrin domain-containing protein 1 | Homo sapiens | 862 | 909 | 885 | 897 | 13 | ADQESEDDLSASR | 75.59 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1 | 142 | 1 | 21 | 21 | MDIKSFLYQFCAKSQIEPKFD | 78.17 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1 | 142 | 29 | 37 | 9 | NRQRFLCEV | 73.91 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1 | 142 | 40 | 52 | 13 | EPNTYIGVGNSTN | 76.54 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1 | 142 | 63 | 77 | 15 | DFVNYLVRVGKLNTN | 83.86 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1 | 104 | 1 | 21 | 21 | MDIKSFLYQFCAKSQIEPKFD | 78.17 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1 | 104 | 29 | 37 | 9 | NRQRFLCEV | 73.91 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1 | 104 | 40 | 52 | 13 | EPNTYIGVGNSTN | 76.54 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1 | 104 | 63 | 77 | 15 | DFVNYLVRVGKLNTN | 83.86 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 81 | 164 | 133 | 144 | 12 | GGNRYSVIDRIQ | 78.43 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 81 | 164 | 151 | 159 | 9 | EAEAFDVNA | 82.61 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1159 | 1293 | 1197 | 1248 | 52 | NGRTFGGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGGYRN | 78.53 |
| DP02836 | P24785 | Dosage compensation regulator | Drosophila melanogaster | 1159 | 1293 | 1268 | 1274 | 7 | GDSFESN | 75.35 |
| DP02838 | P20807 | Calpain-3 | Homo sapiens | 269 | 320 | 283 | 290 | 8 | MGELIARM | 91.64 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 330 | 553 | 337 | 348 | 12 | IQKNIVDDLFSV | 85.09 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 330 | 553 | 363 | 373 | 11 | TLENLSIMDFV | 76.56 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 330 | 553 | 384 | 398 | 15 | EGYLSNQSNNGSAQN | 74.52 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 330 | 553 | 429 | 439 | 11 | TKVEYVSYNSV | 81.21 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 330 | 553 | 459 | 469 | 11 | KANAEVDSLPS | 75.59 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 330 | 553 | 471 | 484 | 14 | NVQESEDDKAFEEN | 76.73 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 330 | 553 | 491 | 500 | 10 | GSVEYIRIMS | 83.44 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 330 | 553 | 510 | 525 | 16 | HTSKYYSGRKNFKKFQ | 82.19 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 330 | 553 | 533 | 542 | 10 | PLQAFLSLSE | 81.47 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 474 | 531 | 477 | 484 | 8 | DDKAFEEN | 78.85 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 474 | 531 | 491 | 500 | 10 | GSVEYIRIMS | 83.44 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 474 | 531 | 510 | 525 | 16 | HTSKYYSGRKNFKKFQ | 82.19 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 477 | 526 | 477 | 484 | 8 | DDKAFEEN | 78.85 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 477 | 526 | 491 | 500 | 10 | GSVEYIRIMS | 83.44 |
| DP02839 | O43070 | DNA repair and telomere maintenance protein nbs1 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 477 | 526 | 510 | 521 | 12 | HTSKYYSGRKNF | 82.83 |
| DP02847 | P47110 | DNA polymerase delta subunit 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 117 | 350 | 119 | 125 | 7 | ESSKIIE | 77.11 |
| DP02847 | P47110 | DNA polymerase delta subunit 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 117 | 350 | 165 | 172 | 8 | STALLAKM | 75.92 |
| DP02847 | P47110 | DNA polymerase delta subunit 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 117 | 350 | 191 | 202 | 12 | KEENLQKINKQN | 89.97 |
| DP02847 | P47110 | DNA polymerase delta subunit 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 117 | 350 | 211 | 220 | 10 | ELNNLFVEDD | 82.71 |
| DP02847 | P47110 | DNA polymerase delta subunit 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 117 | 350 | 251 | 258 | 8 | EDLLETTA | 78.68 |
| DP02847 | P47110 | DNA polymerase delta subunit 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 117 | 350 | 288 | 302 | 15 | PSSFIDEDGYIVTKR | 86.09 |
| DP02847 | P47110 | DNA polymerase delta subunit 3 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 117 | 350 | 339 | 345 | 7 | GTLESFF | 85.48 |
| DP02848 | P15436 | DNA polymerase delta catalytic subunit | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 1007 | 1051 | 1031 | 1042 | 12 | SGELYIKALYDV | 85.23 |
| DP02850 | O60239 | SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK) | Homo sapiens (Human) | 266 | 452 | 295 | 326 | 32 | ISVASEAFEDDSCSNFVSEDDSETQSVSSFSS | 80.54 |
| DP02850 | O60239 | SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK) | Homo sapiens (Human) | 266 | 452 | 354 | 363 | 10 | SLSEFGMMFP | 85.28 |
| DP02850 | O60239 | SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK) | Homo sapiens (Human) | 266 | 452 | 387 | 395 | 9 | AEGAENKTS | 74.8 |
| DP02850 | O60239 | SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK) | Homo sapiens (Human) | 266 | 452 | 424 | 437 | 14 | GQALENRMKQLSLQ | 76.59 |
| DP02853 | Q99P68 | Sclerostin | Mus musculus (Mouse) | 1 | 51 | 6 | 42 | 37 | APCLICLLVHAAFCAVEGQGWQAFRNDATEVIPGLGE | 80.74 |
| DP02854 | Q9BYF1 | Angiotensin-converting enzyme 2 (EC 3.4.17.23) (Angiotensin-converting enzyme homolog) (ACEH) (Angiotensin-converting enzyme-related carboxypeptidase) (ACE-related carboxypeptidase) (EC 3.4.17.-) (Metalloprotease MPROT15) Cleaved into: Processed angiotensin-converting enzyme 2 | Homo sapiens (Human) | 769 | 805 | 777 | 787 | 11 | GENPYASIDIS | 76.65 |
| DP02854 | Q9BYF1 | Angiotensin-converting enzyme 2 (EC 3.4.17.23) (Angiotensin-converting enzyme homolog) (ACEH) (Angiotensin-converting enzyme-related carboxypeptidase) (ACE-related carboxypeptidase) (EC 3.4.17.-) (Metalloprotease MPROT15) Cleaved into: Processed angiotensin-converting enzyme 2 | Homo sapiens (Human) | 769 | 805 | 794 | 800 | 7 | GFQNTDD | 85.71 |
| DP02855 | P11166 | Solute carrier family 2; facilitated glucose transporter member 1 | Homo sapiens | 456 | 492 | 456 | 468 | 13 | KGRTFDEIASGFR | 82.66 |
| DP02860 | P55211 | Caspase-9 | Homo sapiens | 289 | 334 | 296 | 303 | 8 | FEVASTSP | 80.27 |
| DP02860 | P55211 | Caspase-9 | Homo sapiens | 289 | 334 | 322 | 329 | 8 | GLRTFDQL | 82.19 |
| DP02862 | P08670 | Vimentin | Homo sapiens (Human) | 99 | 144 | 106 | 139 | 34 | ELQELNDRFANYIDKVRFLEQQNKILLAELEQLK | 81.04 |
| DP02863 | P62558 | Protein SopB (Plasmid partition protein B) | Escherichia coli (strain K12) | 272 | 323 | 285 | 291 | 7 | ATVLYKG | 97.32 |
| DP02863 | P62558 | Protein SopB (Plasmid partition protein B) | Escherichia coli (strain K12) | 272 | 323 | 293 | 299 | 7 | KMVLNLD | 79.41 |
| DP02863 | P62558 | Protein SopB (Plasmid partition protein B) | Escherichia coli (strain K12) | 272 | 323 | 307 | 318 | 12 | CIEKIEAILKEL | 78.6 |
| DP02863 | P62558 | Protein SopB (Plasmid partition protein B) | Escherichia coli (strain K12) | 275 | 323 | 285 | 291 | 7 | ATVLYKG | 97.32 |
| DP02863 | P62558 | Protein SopB (Plasmid partition protein B) | Escherichia coli (strain K12) | 275 | 323 | 293 | 299 | 7 | KMVLNLD | 79.41 |
| DP02863 | P62558 | Protein SopB (Plasmid partition protein B) | Escherichia coli (strain K12) | 275 | 323 | 307 | 318 | 12 | CIEKIEAILKEL | 78.6 |
| DP02869 | Q16630 | Cleavage and polyadenylation specificity factor subunit 6 | Homo sapiens | 13 | 80 | 14 | 25 | 12 | VGEEFNQEAEYG | 85.37 |
| DP02869 | Q16630 | Cleavage and polyadenylation specificity factor subunit 6 | Homo sapiens | 13 | 80 | 29 | 39 | 11 | QIDLYDDVISP | 82.61 |
| DP02869 | Q16630 | Cleavage and polyadenylation specificity factor subunit 6 | Homo sapiens | 481 | 551 | 517 | 523 | 7 | HDDYYRE | 80.6 |
| DP02871 | Q5D1E7 | Endoribonuclease ZC3H12A | Mus musculus | 296 | 339 | 310 | 322 | 13 | KKCTYGIKCRFFH | 76.02 |
| DP02871 | Q5D1E7 | Endoribonuclease ZC3H12A | Mus musculus | 301 | 326 | 310 | 321 | 12 | KKCTYGIKCRFF | 76.14 |
| DP02878 | Q8XAD5 | Uncharacterized protein | Escherichia coli O157:H7 | 1 | 63 | 8 | 34 | 27 | MVSEFETIEQENSYNEWLRAKVATSLA | 82.15 |
| DP02878 | Q8XAD5 | Uncharacterized protein | Escherichia coli O157:H7 | 5 | 49 | 8 | 34 | 27 | MVSEFETIEQENSYNEWLRAKVATSLA | 82.15 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1 | 260 | 1 | 13 | 13 | MFIFLLFLTLTSG | 81.94 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1 | 260 | 26 | 96 | 71 | QAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSN | 80.17 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1 | 260 | 99 | 108 | 10 | RGWVFGSTMN | 77.79 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1 | 260 | 111 | 142 | 32 | SQSVIIINNSTNVVIRACNFELCDNPFFAVSK | 79.37 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1 | 260 | 148 | 208 | 61 | THTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRD | 81.07 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1 | 260 | 211 | 221 | 11 | SGFNTLKPIFK | 77.53 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1 | 260 | 224 | 255 | 32 | LGINITNFRAILTAFSPAQDIWGTSAAAYFVG | 84.93 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 810 | 830 | 811 | 825 | 15 | ADAGFMKQYGECLGD | 80.27 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1059 | 1196 | 1059 | 1122 | 64 | TAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDP | 81.08 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1059 | 1196 | 1133 | 1142 | 10 | ELDKYFKNHT | 80.47 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1059 | 1196 | 1150 | 1191 | 42 | DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQY | 83.72 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1105 | 1193 | 1108 | 1122 | 15 | CDVVIGIINNTVYDP | 83.01 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1105 | 1193 | 1133 | 1142 | 10 | ELDKYFKNHT | 80.47 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1105 | 1193 | 1150 | 1188 | 39 | DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKY | 83.9 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1120 | 1196 | 1133 | 1142 | 10 | ELDKYFKNHT | 80.47 |
| DP02879 | P59594 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Severe acute respiratory syndrome coronavirus (SARS-CoV) | 1120 | 1196 | 1150 | 1191 | 42 | DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQY | 83.72 |
| DP02880 | K9N5Q8 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) | 1207 | 1294 | 1207 | 1218 | 12 | PQVTYQNISTNL | 88.43 |
| DP02880 | K9N5Q8 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) | 1207 | 1294 | 1222 | 1232 | 11 | LLGNSTGIDFQ | 76.25 |
| DP02880 | K9N5Q8 | "Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2" | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) | 1207 | 1294 | 1234 | 1289 | 56 | ELDEFFKNVSTSIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNY | 82.08 |
| DP02888 | Q70627 | Protein Nef | Human immunodeficiency virus type 1 group M subtype B (isolate LW123) | 149 | 180 | 158 | 166 | 9 | KGENTSLLH | 75.7 |
| DP02889 | P03407 | Protein Nef | Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) | 45 | 71 | 45 | 66 | 22 | GAITSSNTAATNADCAWLEAQE | 77.79 |
| DP02889 | P03407 | Protein Nef | Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) | 45 | 69 | 45 | 64 | 20 | GAITSSNTAATNADCAWLEA | 78.14 |
| DP02889 | P03407 | Protein Nef | Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) | 150 | 176 | 163 | 170 | 8 | GENNSLLH | 79.93 |
| DP02889 | P03407 | Protein Nef | Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) | 155 | 181 | 163 | 170 | 8 | GENNSLLH | 79.93 |
| DP02889 | P03407 | Protein Nef | Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) | 155 | 179 | 163 | 170 | 8 | GENNSLLH | 79.93 |
| DP02889 | P03407 | Protein Nef | Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) | 157 | 179 | 163 | 170 | 8 | GENNSLLH | 79.93 |
| DP02892 | Q3UND0 | Src kinase-associated phosphoprotein 2 (Pyk2/RAFTK-associated protein) (SKAP55 homolog) (SKAP-HOM) (Src family-associated phosphoprotein 2) (Src kinase-associated phosphoprotein 55-related protein) (Src-associated adapter protein with PH and SH3 domains) | Mus musculus (Mouse) | 65 | 105 | 83 | 93 | 11 | ADTISLASERY | 76.16 |
| DP02894 | Q9BZZ5-2 | Isoform 2 of Apoptosis inhibitor 5 | Homo sapiens | 455 | 504 | 491 | 499 | 9 | NLGNFNYER | 85.47 |
| DP02897 | Q90VU7 | "Protein Nef (3ORF) (Negative factor) (F-protein) Cleaved into: C-terminal core protein" | Human immunodeficiency virus 1 | 27 | 56 | 39 | 51 | 13 | KHGAITSSNTAAN | 76.41 |
| DP02900 | P0A968 | Cold shock-like protein CspD (CSP-D) | Escherichia coli (strain K12) | 1 | 74 | 4 | 18 | 15 | GTVKWFNNAKGFGFI | 91.59 |
| DP02900 | P0A968 | Cold shock-like protein CspD (CSP-D) | Escherichia coli (strain K12) | 1 | 74 | 23 | 35 | 13 | GGEDIFAHYSTIQ | 86 |
| DP02900 | P0A968 | Cold shock-like protein CspD (CSP-D) | Escherichia coli (strain K12) | 1 | 74 | 46 | 54 | 9 | QSVQFDVHQ | 80.27 |
| DP02900 | P0A968 | Cold shock-like protein CspD (CSP-D) | Escherichia coli (strain K12) | 1 | 74 | 60 | 66 | 7 | HASVIVP | 91.97 |
| DP02901 | J7QA90 | DUF1778 domain-containing protein (Hypothetical protein) (Toxin-antitoxin system antitoxin component) (Toxin-antitoxin system protein) (Toxin-antitoxin system; antitoxin component) (Toxin-antitoxin system; antitoxin component; ribbon-helix-helix fold protein) (Uncharacterized protein conserved in bacteria;Protein of uncharacterized function (DUF1778)) (Ybl13) | Escherichia coli | 44 | 88 | 44 | 50 | 7 | AAEVIEQ | 87.15 |
| DP02901 | J7QA90 | DUF1778 domain-containing protein (Hypothetical protein) (Toxin-antitoxin system antitoxin component) (Toxin-antitoxin system protein) (Toxin-antitoxin system; antitoxin component) (Toxin-antitoxin system; antitoxin component; ribbon-helix-helix fold protein) (Uncharacterized protein conserved in bacteria;Protein of uncharacterized function (DUF1778)) (Ybl13) | Escherichia coli | 44 | 88 | 52 | 70 | 19 | RRVILNEESWTRVMDALSN | 77.66 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 2 | 10 | 9 | KEQEFSYRE | 86.18 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 20 | 29 | 10 | GLENSFLSSP | 82.07 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 33 | 55 | 23 | KTPLFFEGNSNETSGYDQTKNFT | 77.11 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 62 | 99 | 38 | SLGNLSELNVATDLLESLDLRSMYMHGYGHLDSSFSSQ | 81.03 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 110 | 118 | 9 | STSVFKRIN | 78.82 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 126 | 143 | 18 | PSLTYSAGTMNSTSSSTA | 75.2 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 150 | 169 | 20 | IVADYETFNPDQNLAELSFD | 84.18 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 179 | 187 | 9 | VEVAEFSRA | 82.39 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 191 | 202 | 12 | SPLEYTVQHPYQ | 75.39 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 204 | 210 | 7 | HNELSTN | 75.92 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 236 | 243 | 8 | HLSASSTV | 76.92 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 305 | 313 | 9 | DDSDISTES | 74.14 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 329 | 348 | 20 | SGSSYASTLRKVYDFSELSL | 77.73 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 355 | 365 | 11 | YDELYLQSSRN | 81.51 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 369 | 393 | 25 | EISTIINDSLQQENMDEDISATSIP | 80.94 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 402 | 425 | 24 | GSVTYHEVPRYNLTSASVGYSISS | 83.03 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 452 | 432 | 447 | 16 | SSSTIDNLSAILSSED | 78.32 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 2 | 10 | 9 | KEQEFSYRE | 86.18 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 20 | 29 | 10 | GLENSFLSSP | 82.07 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 33 | 55 | 23 | KTPLFFEGNSNETSGYDQTKNFT | 77.11 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 62 | 99 | 38 | SLGNLSELNVATDLLESLDLRSMYMHGYGHLDSSFSSQ | 81.03 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 110 | 118 | 9 | STSVFKRIN | 78.82 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 126 | 143 | 18 | PSLTYSAGTMNSTSSSTA | 75.2 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 150 | 169 | 20 | IVADYETFNPDQNLAELSFD | 84.18 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 179 | 187 | 9 | VEVAEFSRA | 82.39 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 191 | 202 | 12 | SPLEYTVQHPYQ | 75.39 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 204 | 210 | 7 | HNELSTN | 75.92 |
| DP02903 | P78953 | Division mal foutue 1 protein | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | 1 | 308 | 236 | 243 | 8 | HLSASSTV | 76.92 |
| DP02910 | P28023 | Dynactin subunit 1 | Rattus norvegicus | 108 | 191 | 175 | 181 | 7 | AGELSSS | 77.26 |
| DP02913 | P04004 | Vitronectin | Homo sapiens | 1 | 130 | 5 | 24 | 20 | RPLLILALLAWVALADQESC | 79.38 |
| DP02913 | P04004 | Vitronectin | Homo sapiens | 1 | 130 | 42 | 48 | 7 | ELCSYYQ | 95.32 |
| DP02913 | P04004 | Vitronectin | Homo sapiens | 1 | 130 | 65 | 80 | 16 | GDVFTMPEDEYTVYDD | 82.88 |
| DP02913 | P04004 | Vitronectin | Homo sapiens | 1 | 130 | 84 | 92 | 9 | KNNATVHEQ | 75.47 |
| DP02913 | P04004 | Vitronectin | Homo sapiens | 1 | 71 | 5 | 24 | 20 | RPLLILALLAWVALADQESC | 79.38 |
| DP02913 | P04004 | Vitronectin | Homo sapiens | 1 | 71 | 42 | 48 | 7 | ELCSYYQ | 95.32 |
| DP02913 | P04004 | Vitronectin | Homo sapiens | 22 | 58 | 42 | 48 | 7 | ELCSYYQ | 95.32 |
| DP02913 | P04004 | Vitronectin | Homo sapiens | 48 | 130 | 65 | 80 | 16 | GDVFTMPEDEYTVYDD | 82.88 |
| DP02913 | P04004 | Vitronectin | Homo sapiens | 48 | 130 | 84 | 92 | 9 | KNNATVHEQ | 75.47 |
| DP02915 | P48443 | Retinoic acid receptor RXR-gamma | Homo sapiens | 2 | 127 | 4 | 12 | 9 | NYSHFMKFP | 82.61 |
| DP02915 | P48443 | Retinoic acid receptor RXR-gamma | Homo sapiens | 2 | 127 | 30 | 36 | 7 | SAALSTG | 74.2 |
| DP02915 | P48443 | Retinoic acid receptor RXR-gamma | Homo sapiens | 2 | 127 | 70 | 76 | 7 | YRVITSA | 80.27 |
| DP02915 | P48443 | Retinoic acid receptor RXR-gamma | Homo sapiens | 2 | 127 | 98 | 109 | 12 | SQLNVVNSVSSS | 86.29 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 10 | 185 | 29 | 45 | 17 | KANLFDWDDAETASLSH | 81.35 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 10 | 185 | 47 | 60 | 14 | PQSKIKIQSIDKFD | 77.97 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 10 | 185 | 70 | 77 | 8 | KLVIKLSE | 74.92 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 10 | 185 | 87 | 118 | 32 | PLVEYVTEKEYNEVPVEEFGDALLRGMGWESD | 77.36 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 10 | 185 | 152 | 174 | 23 | LNKAINVEEASFMPVVKIDKITG | 78.67 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 10 | 150 | 29 | 45 | 17 | KANLFDWDDAETASLSH | 81.35 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 10 | 150 | 47 | 60 | 14 | PQSKIKIQSIDKFD | 77.97 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 10 | 150 | 70 | 77 | 8 | KLVIKLSE | 74.92 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 10 | 150 | 87 | 118 | 32 | PLVEYVTEKEYNEVPVEEFGDALLRGMGWESD | 77.36 |
| DP02917 | Q02521 | Pre-mRNA-splicing factor SPP2 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | 100 | 150 | 101 | 118 | 18 | PVEEFGDALLRGMGWESD | 74.88 |
| DP02919 | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506; chloroplastic | Arabidopsis thaliana | 40 | 112 | 80 | 86 | 7 | SENEYEG | 85.95 |
| DP02920 | Q05753 | Ankyrin repeat domain-containing protein; chloroplastic | Arabidopsis thaliana | 37 | 231 | 37 | 48 | 12 | SLSYSSQTSILP | 80.27 |
| DP02920 | Q05753 | Ankyrin repeat domain-containing protein; chloroplastic | Arabidopsis thaliana | 37 | 231 | 51 | 69 | 19 | GDDFIVGDCLVYEDGVFED | 81.48 |
| DP02920 | Q05753 | Ankyrin repeat domain-containing protein; chloroplastic | Arabidopsis thaliana | 37 | 231 | 74 | 82 | 9 | KEVTQVAKQ | 74.36 |
| DP02920 | Q05753 | Ankyrin repeat domain-containing protein; chloroplastic | Arabidopsis thaliana | 37 | 231 | 96 | 106 | 11 | DESEIEPENLV | 80.6 |
| DP02920 | Q05753 | Ankyrin repeat domain-containing protein; chloroplastic | Arabidopsis thaliana | 37 | 231 | 112 | 119 | 8 | DIQAEVNL | 77.72 |
| DP02920 | Q05753 | Ankyrin repeat domain-containing protein; chloroplastic | Arabidopsis thaliana | 37 | 231 | 128 | 134 | 7 | AQEMEFG | 76.97 |
| DP02920 | Q05753 | Ankyrin repeat domain-containing protein; chloroplastic | Arabidopsis thaliana | 37 | 231 | 151 | 171 | 21 | DLNDFLTYKEAKLAQLRPVIL | 89.52 |
| DP02920 | Q05753 | Ankyrin repeat domain-containing protein; chloroplastic | Arabidopsis thaliana | 37 | 231 | 204 | 210 | 7 | RWAVYGK | 73.91 |
| DP02920 | Q05753 | Ankyrin repeat domain-containing protein; chloroplastic | Arabidopsis thaliana | 37 | 231 | 214 | 225 | 12 | HVAKFFNSDKYD | 87.37 |
| DP02922 | P01215 | Glycoprotein hormones alpha chain | Homo sapiens | 33 | 57 | 37 | 44 | 8 | QENPFFSQ | 75.42 |
| DP02924 | P0C6X7 | Replicase polyprotein 1ab | Human SARS coronavirus | 129 | 179 | 132 | 144 | 13 | GGHSYGIDLKSYD | 74.5 |
| DP02924 | P0C6X7 | Replicase polyprotein 1ab | Human SARS coronavirus | 129 | 179 | 157 | 164 | 8 | YEQNWNTK | 80.81 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 148 | 13 | 26 | 14 | HVQLSLPVLQVRDV | 80.94 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 148 | 36 | 42 | 7 | EEVLSEA | 79.93 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 148 | 64 | 74 | 11 | LEQPYVFIKRS | 85.56 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 148 | 84 | 99 | 16 | VMVELVAELEGIQYGR | 76.46 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 148 | 110 | 124 | 15 | HVGEIPVAYRKVLLR | 80.25 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 148 | 132 | 143 | 12 | GGHSYGADLKSF | 75.59 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 147 | 13 | 26 | 14 | HVQLSLPVLQVRDV | 80.94 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 147 | 36 | 42 | 7 | EEVLSEA | 79.93 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 147 | 64 | 74 | 11 | LEQPYVFIKRS | 85.56 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 147 | 84 | 99 | 16 | VMVELVAELEGIQYGR | 76.46 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 147 | 110 | 124 | 15 | HVGEIPVAYRKVLLR | 80.25 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 147 | 132 | 142 | 11 | GGHSYGADLKS | 75.43 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 127 | 13 | 26 | 14 | HVQLSLPVLQVRDV | 80.94 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 127 | 36 | 42 | 7 | EEVLSEA | 79.93 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 127 | 64 | 74 | 11 | LEQPYVFIKRS | 85.56 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 127 | 84 | 99 | 16 | VMVELVAELEGIQYGR | 76.46 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 127 | 110 | 122 | 13 | HVGEIPVAYRKVL | 80.19 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 3943 | 4020 | 3943 | 3979 | 37 | AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKK | 78.79 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 3943 | 4020 | 4005 | 4015 | 11 | ADQAMTQMYKQ | 78.47 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 3948 | 4020 | 3950 | 3979 | 30 | SLPSYAAFATAQEAYEQAVANGDSEVVLKK | 79.39 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 3948 | 4020 | 4005 | 4015 | 11 | ADQAMTQMYKQ | 78.47 |
| DP02925 | P0DTD1 | "Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) Cleaved into: Host translation inhibitor nsp1 (Leader protein) (Non-structural protein 1) (nsp1); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL2-PRO) (Papain-like protease) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.69) (Main protease) (Mpro) (Non-structural protein 5) (nsp5) (SARS coronavirus main proteinase); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Non-structural protein 12) (nsp12); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Non-structural protein 13) (nsp13); Proofreading exoribonuclease (ExoN) (EC 3.1.13.-) (Guanine-N7 methyltransferase) (Non-structural protein 14) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (Non-structural protein 15) (nsp15); 2-O-methyltransferase (EC 2.1.1.-) (Non-structural protein 16) (nsp16)" | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 3995 | 4020 | 4005 | 4015 | 11 | ADQAMTQMYKQ | 78.47 |
| DP02928 | A0A220GHA5 | AcrIIA5 | Streptococcus phage D4276 | 1 | 22 | 4 | 12 | 9 | GKSRYNSYR | 79.04 |
| DP02929 | P0A2N1 | MAPK phosphothreonine lyase | Salmonella enteritidis | 1 | 26 | 8 | 21 | 14 | LNLNIPPLNIVAAY | 86 |
| DP02936 | A0A3S5Y0Q5 | Virulence associated protein VapG | Rhodococcus hoagii (strain 103S) (Rhodococcus equi) | 27 | 66 | 30 | 39 | 10 | MVSTTAASSV | 78.6 |
| DP02936 | A0A3S5Y0Q5 | Virulence associated protein VapG | Rhodococcus hoagii (strain 103S) (Rhodococcus equi) | 27 | 66 | 41 | 58 | 18 | HAANTYDFAEAKSGSSIP | 83.07 |
| DP02946 | Q2VL32 | Aip56 | Photobacterium damsela subsp. piscicida (Pasteurella piscicida) | 278 | 314 | 279 | 285 | 7 | SEGISSF | 78.93 |
| DP02946 | Q2VL32 | Aip56 | Photobacterium damsela subsp. piscicida (Pasteurella piscicida) | 278 | 314 | 297 | 306 | 10 | GGGAFFLPSA | 81.71 |
| DP02949 | O25555 | Uncharacterized protein | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) | 96 | 125 | 100 | 115 | 16 | ETDLIVEDFSSYSNER | 79.37 |
| DP02950 | P0C079 | Antitoxin RelB | Escherichia coli (strain K12) | 43 | 79 | 47 | 53 | 7 | KQTLLSD | 75.92 |
| DP02950 | P0C079 | Antitoxin RelB | Escherichia coli (strain K12) | 43 | 79 | 57 | 65 | 9 | ELVEIVKER | 96.32 |
| DP02950 | P0C079 | Antitoxin RelB | Escherichia coli (strain K12) | 43 | 65 | 47 | 53 | 7 | KQTLLSD | 75.92 |
| DP02950 | P0C079 | Antitoxin RelB | Escherichia coli (strain K12) | 47 | 79 | 47 | 53 | 7 | KQTLLSD | 75.92 |
| DP02950 | P0C079 | Antitoxin RelB | Escherichia coli (strain K12) | 47 | 79 | 57 | 65 | 9 | ELVEIVKER | 96.32 |
| DP02950 | P0C079 | Antitoxin RelB | Escherichia coli (strain K12) | 52 | 79 | 57 | 65 | 9 | ELVEIVKER | 96.32 |
| DP02957 | P47992 | Lymphotactin (ATAC) (C motif chemokine 1) (Cytokine SCM-1) (Lymphotaxin) (SCM-1-alpha) (Small-inducible cytokine C1) (XC chemokine ligand 1) | Homo sapiens (Human) | 82 | 114 | 102 | 109 | 8 | TQQSTNTA | 79.89 |
| DP02957 | P47992 | Lymphotactin (ATAC) (C motif chemokine 1) (Cytokine SCM-1) (Lymphotaxin) (SCM-1-alpha) (Small-inducible cytokine C1) (XC chemokine ligand 1) | Homo sapiens (Human) | 90 | 114 | 102 | 109 | 8 | TQQSTNTA | 79.89 |
| DP02960 | P00880 | Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit) (EC 4.1.1.39) | Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans) | 410 | 472 | 417 | 425 | 9 | NRVALEACV | 74.32 |
| DP02960 | P00880 | Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit) (EC 4.1.1.39) | Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans) | 410 | 472 | 452 | 467 | 16 | LAAALDLWKEIKFEFE | 78.01 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 172 | 355 | 208 | 218 | 11 | GAGGYTLQAAV | 74.43 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 172 | 355 | 226 | 245 | 20 | KIPSISELLNDYSLAQLFDD | 76.84 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 172 | 355 | 267 | 279 | 13 | SQFHVNSSGNNMS | 79.5 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 172 | 355 | 319 | 325 | 7 | AAAVTNK | 79.93 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 172 | 355 | 328 | 349 | 22 | NSSCFGATTFQVGNNTLQGSLG | 76.53 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 172 | 250 | 208 | 218 | 11 | GAGGYTLQAAV | 74.43 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 172 | 250 | 226 | 245 | 20 | KIPSISELLNDYSLAQLFDD | 76.84 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 173 | 355 | 208 | 218 | 11 | GAGGYTLQAAV | 74.43 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 173 | 355 | 226 | 245 | 20 | KIPSISELLNDYSLAQLFDD | 76.84 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 173 | 355 | 267 | 279 | 13 | SQFHVNSSGNNMS | 79.5 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 173 | 355 | 319 | 325 | 7 | AAAVTNK | 79.93 |
| DP02964 | M0Y2D5 | NAC domain-containing protein | Hordeum vulgare subsp. vulgare (Domesticated barley) | 173 | 355 | 328 | 349 | 22 | NSSCFGATTFQVGNNTLQGSLG | 76.53 |
| DP02965 | F6IAY2 | NAC transcription factor | Hordeum vulgare subsp. vulgare (Domesticated barley) | 177 | 346 | 195 | 209 | 15 | RVSSFGFISDHFLDA | 80.38 |
| DP02965 | F6IAY2 | NAC transcription factor | Hordeum vulgare subsp. vulgare (Domesticated barley) | 177 | 346 | 224 | 239 | 16 | VDQVIDFNSNSAYATG | 80.16 |
| DP02965 | F6IAY2 | NAC transcription factor | Hordeum vulgare subsp. vulgare (Domesticated barley) | 177 | 346 | 260 | 269 | 10 | YSSPYFSLPA | 74.45 |
| DP02965 | F6IAY2 | NAC transcription factor | Hordeum vulgare subsp. vulgare (Domesticated barley) | 177 | 346 | 311 | 318 | 8 | GCAEISSA | 87.29 |
| DP02965 | F6IAY2 | NAC transcription factor | Hordeum vulgare subsp. vulgare (Domesticated barley) | 177 | 346 | 324 | 341 | 18 | HNQDFLDHLDEYPALNLA | 74.67 |
| DP02965 | F6IAY2 | NAC transcription factor | Hordeum vulgare subsp. vulgare (Domesticated barley) | 250 | 346 | 260 | 269 | 10 | YSSPYFSLPA | 74.45 |
| DP02965 | F6IAY2 | NAC transcription factor | Hordeum vulgare subsp. vulgare (Domesticated barley) | 250 | 346 | 311 | 318 | 8 | GCAEISSA | 87.29 |
| DP02965 | F6IAY2 | NAC transcription factor | Hordeum vulgare subsp. vulgare (Domesticated barley) | 250 | 346 | 324 | 341 | 18 | HNQDFLDHLDEYPALNLA | 74.67 |
| DP02982 | O01479 | Tropomodulin (Tmod-like protein) (cTmd1) (Uncoordinated protein 94) | Caenorhabditis elegans | 196 | 221 | 198 | 214 | 17 | TGTTFNGIMQSYVPRIV | 86.13 |
| DP02985 | P0A6Y8 | Chaperone protein DnaK (HSP70) (Heat shock 70 kDa protein) (Heat shock protein 70) | Escherichia coli (strain K12) | 606 | 638 | 607 | 621 | 15 | AQQQTAGADASANNA | 77.26 |
| DP02985 | P0A6Y8 | Chaperone protein DnaK (HSP70) (Heat shock 70 kDa protein) (Heat shock protein 70) | Escherichia coli (strain K12) | 606 | 638 | 627 | 633 | 7 | VDAEFEE | 82.13 |
| DP02987 | Q22942 | Choline kinase A2 (EC 2.7.1.32) (Ethanolamine kinase) (EC 2.7.1.82) | Caenorhabditis elegans | 1 | 31 | 14 | 26 | 13 | DELASAANMSLVA | 75.1 |
| DP02987 | Q22942 | Choline kinase A2 (EC 2.7.1.32) (Ethanolamine kinase) (EC 2.7.1.82) | Caenorhabditis elegans | 265 | 296 | 267 | 278 | 12 | SSGNIRMPSLSD | 77.26 |
| DP02987 | Q22942 | Choline kinase A2 (EC 2.7.1.32) (Ethanolamine kinase) (EC 2.7.1.82) | Caenorhabditis elegans | 265 | 296 | 280 | 291 | 12 | TQALGNSLSAFN | 85.23 |
| DP02989 | Q03611 | Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) | Caenorhabditis elegans | 1 | 105 | 34 | 45 | 12 | AATKFSILTKFL | 81.74 |
| DP02989 | Q03611 | Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) | Caenorhabditis elegans | 1 | 105 | 49 | 66 | 18 | NQVHTTTAQQNEFMQKYM | 88.46 |
| DP02989 | Q03611 | Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) | Caenorhabditis elegans | 1 | 103 | 34 | 45 | 12 | AATKFSILTKFL | 81.74 |
| DP02989 | Q03611 | Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) | Caenorhabditis elegans | 1 | 103 | 49 | 66 | 18 | NQVHTTTAQQNEFMQKYM | 88.46 |
| DP02989 | Q03611 | Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) | Caenorhabditis elegans | 620 | 733 | 633 | 661 | 29 | TVEEIAEHLNNAVKVLQTRMARLIVEHSS | 78.87 |
| DP02989 | Q03611 | Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) | Caenorhabditis elegans | 620 | 733 | 691 | 697 | 7 | HGVSIDG | 86.96 |
| DP02989 | Q03611 | Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) | Caenorhabditis elegans | 621 | 733 | 633 | 661 | 29 | TVEEIAEHLNNAVKVLQTRMARLIVEHSS | 78.87 |
| DP02989 | Q03611 | Cyclic nucleotide-gated cation channel (Abnormal chemotaxis protein 4) | Caenorhabditis elegans | 621 | 733 | 691 | 697 | 7 | HGVSIDG | 86.96 |
| DP02990 | Q9U489 | Protein lin-41 (Abnormal cell lineage protein 41) | Caenorhabditis elegans | 730 | 757 | 738 | 744 | 7 | TSQALLP | 74.53 |
| DP03003 | P0DTC3 | ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 41 | 3 | 21 | 19 | LFMRIFTIGTVTLKQGEIK | 83.05 |
| DP03003 | P0DTC3 | ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 1 | 39 | 3 | 21 | 19 | LFMRIFTIGTVTLKQGEIK | 83.05 |
| DP03003 | P0DTC3 | ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 239 | 275 | 243 | 250 | 8 | HVQIHTID | 84.16 |
| DP03003 | P0DTC3 | ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) | 239 | 275 | 254 | 265 | 12 | GVVNPVMEPIYD | 78.71 |
| DP03005 | Q53TN4 | Plasma membrane ascorbate-dependent reductase CYBRD1 (EC 7.2.1.3) (Cytochrome b reductase 1) (Duodenal cytochrome b) (Ferric-chelate reductase 3) | Homo sapiens (Human) | 231 | 286 | 260 | 268 | 9 | SDSELNSEV | 74.95 |
| DP03018 | P10565 | Binary larvicide subunit BinB (63 kDa toxin crystal protein) (Binary paracrystalline larvicide subunit BinB) (Larvicidal toxin 51.4 kDa protein) | Lysinibacillus sphaericus (Bacillus sphaericus) | 1 | 34 | 17 | 26 | 10 | KFTNYPLNTT | 86.62 |
| DP03019 | P30996 | Botulinum neurotoxin type F (BoNT/F) (Bontoxilysin-F) Cleaved into: Botulinum neurotoxin F light chain (LC) (EC 3.4.24.69); Botulinum neurotoxin F heavy chain (HC) | Clostridium botulinum | 416 | 439 | 421 | 432 | 12 | LVEKIVKFCKSV | 83.44 |
| DP03021 | F2WK69 | Toxin CdiA | Escherichia coli O157:H7 | 88 | 164 | 89 | 95 | 7 | NQSLTFD | 85.09 |
| DP03021 | F2WK69 | Toxin CdiA | Escherichia coli O157:H7 | 88 | 164 | 107 | 120 | 14 | NCQDIIDKWEKISD | 79.96 |
| DP03021 | F2WK69 | Toxin CdiA | Escherichia coli O157:H7 | 88 | 164 | 122 | 131 | 10 | QSAEIDQKLK | 79.93 |
| DP03021 | F2WK69 | Toxin CdiA | Escherichia coli O157:H7 | 88 | 164 | 136 | 142 | 7 | EAQVIDK | 78.64 |
| DP03022 | I1WVY3 | tRNA nuclease CdiA-2 (tRNase CdiA-2) (EC 3.1.-.-) (CdiA-Bp1026b) (Toxin CdiA-2) (Toxin CdiA-II) | Burkholderia pseudomallei (strain 1026b) | 2948 | 2987 | 2955 | 2970 | 16 | PSNAILSNSNSDNNST | 80.31 |
| DP03026 | A0A384E149 | Catalytic domain of botulinum neurotoxin X | Clostridium botulinum | 414 | 439 | 415 | 423 | 9 | ALRAFIKIC | 89.15 |
| DP03026 | A0A384E149 | Catalytic domain of botulinum neurotoxin X | Clostridium botulinum | 414 | 439 | 426 | 434 | 9 | NGLLYNAIY | 84.36 |
| DP03034 | Q48245 | Vacuolating cytotoxin autotransporter Cleaved into: Vacuolating cytotoxin; Vacuolating cytotoxin translocator | Helicobacter pylori (Campylobacter pylori) | 333 | 367 | 352 | 362 | 11 | SQNNSNTQVIN | 79.39 |
| DP03092 | O00308 | NEDD4-like E3 ubiquitin-protein ligase WWP2 | Homo sapiens | 662 | 702 | 667 | 685 | 19 | GLELYFIQDMEILGKVTTH | 85.65 |
| DP03092 | O00308 | NEDD4-like E3 ubiquitin-protein ligase WWP2 | Homo sapiens | 662 | 702 | 690 | 697 | 8 | GGESIRVT | 75.25 |
| DP03100 | Q14258 | E3 ubiquitin/ISG15 ligase TRIM25 | Homo sapiens | 361 | 433 | 417 | 428 | 12 | QAGLEAAAKATS | 75.59 |
| DP03121 | P11686 | Pulmonary surfactant-associated protein C | Homo sapiens | 59 | 89 | 66 | 74 | 9 | EMVLEMSIG | 78.26 |
| DP03121 | P11686 | Pulmonary surfactant-associated protein C | Homo sapiens | 59 | 89 | 78 | 84 | 7 | AQQRLAL | 75.92 |
| DP03240 | P0A8Q6 | ATP-dependent Clp protease adapter protein ClpS | Escherichia coli (strain K12) | 1 | 22 | 5 | 16 | 12 | NDWLDFDQLAEE | 80.27 |
| DP03254 | P52848 | Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 | Homo sapiens | 558 | 578 | 566 | 573 | 8 | LAQKYFQI | 87.42 |
| DP03294 | P02760 | Protein AMBP | Homo sapiens | 206 | 229 | 218 | 224 | 7 | GQLVTEV | 83.85 |
| DP03299 | P00734 | Prothrombin | Homo sapiens | 187 | 211 | 188 | 196 | 9 | QDQVTVAMT | 75.55 |
| DP03310 | Q3U4G3 | Xyloside xylosyltransferase 1 | Mus musculus | 43 | 87 | 44 | 51 | 8 | GRETFSSA | 80.27 |
| DP03311 | P00740 | Coagulation factor IX | Homo sapiens | 47 | 93 | 51 | 61 | 11 | KLEEFVQGNLE | 83.89 |
| DP03311 | P00740 | Coagulation factor IX | Homo sapiens | 47 | 93 | 74 | 82 | 9 | AREVFENTE | 81.49 |
| DP03312 | P10619 | Lysosomal protective protein | Homo sapiens | 288 | 327 | 300 | 308 | 9 | DLGNIFTRL | 83.95 |
| DP03312 | P10619 | Lysosomal protective protein | Homo sapiens | 288 | 327 | 314 | 322 | 9 | WHQALLRSG | 76.14 |
| DP03335 | P42573 | Cell death protein 3 | Caenorhabditis elegans | 370 | 406 | 388 | 397 | 10 | DGPLFNFLGC | 82.27 |
| DP03338 | Q9A8N4 | PopZ | Caulobacter vibrioides (strain ATCC 19089 / CB15) | 1 | 133 | 9 | 22 | 14 | TMEEILASIRRIIS | 80.17 |
| DP03338 | Q9A8N4 | PopZ | Caulobacter vibrioides (strain ATCC 19089 / CB15) | 1 | 133 | 45 | 58 | 14 | EPVSFDDEVLELTD | 78.55 |
| DP03338 | Q9A8N4 | PopZ | Caulobacter vibrioides (strain ATCC 19089 / CB15) | 1 | 133 | 74 | 80 | 7 | DIDVYSP | 80.22 |
| DP03338 | Q9A8N4 | PopZ | Caulobacter vibrioides (strain ATCC 19089 / CB15) | 1 | 133 | 101 | 128 | 28 | DEVAEQLVGVSAASAAASAFGSLSSALL | 76.73 |
| DP03345 | O00214 | Galectin-8 | Homo sapiens | 154 | 175 | 162 | 170 | 9 | ASSLELTEI | 78.6 |
| DP03347 | P10824 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | Rattus norvegicus | 2 | 32 | 2 | 9 | 8 | GCTLSAED | 73.83 |
| DP03350 | P03316 | Structural polyprotein | Sindbis virus | 1 | 113 | 2 | 10 | 9 | NRGFFNMLG | 87.18 |
| DP03350 | P03316 | Structural polyprotein | Sindbis virus | 1 | 113 | 38 | 57 | 20 | LASQIQQLTTAVSALVIGQA | 81.59 |
| DP03353 | P05546 | Heparin cofactor 2 | Homo sapiens | 20 | 79 | 42 | 52 | 11 | WEQLNNKNLSM | 74 |
| DP03353 | P05546 | Heparin cofactor 2 | Homo sapiens | 20 | 79 | 66 | 72 | 7 | TNDWIPE | 75.68 |
| DP03353 | P05546 | Heparin cofactor 2 | Homo sapiens | 91 | 113 | 91 | 101 | 11 | DYIDIVDSLSV | 81.57 |
| DP03354 | P63144 | Voltage-gated potassium channel subunit beta-1 | Rattus norvegicus | 1 | 62 | 1 | 7 | 7 | MQVSIAC | 96.32 |
| DP03354 | P63144 | Voltage-gated potassium channel subunit beta-1 | Rattus norvegicus | 1 | 62 | 31 | 57 | 27 | NVVNAARAKFRTVAIIARSLGTFTPQH | 81.22 |
| DP03356 | A0A1L8HX71 | XPA_C domain-containing protein | Xenopus laevis | 1 | 84 | 12 | 26 | 15 | EEEKILSAAVRAKIE | 77.86 |
| DP03356 | A0A1L8HX71 | XPA_C domain-containing protein | Xenopus laevis | 1 | 84 | 64 | 74 | 11 | GGGFFIEEEEA | 78.63 |
| DP03356 | A0A1L8HX71 | XPA_C domain-containing protein | Xenopus laevis | 181 | 265 | 182 | 195 | 14 | SLEVWGSEEALEEA | 79.74 |
| DP03356 | A0A1L8HX71 | XPA_C domain-containing protein | Xenopus laevis | 181 | 265 | 251 | 260 | 10 | KTCITCGYEM | 79.43 |
| DP03357 | Q5SHN5 | Elongation factor G | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) | 40 | 67 | 43 | 57 | 15 | GEVHEGAATMDFMEQ | 74.31 |
| DP03359 | P9WJD9 | ESX-1 secretion-associated protein EspB | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 86 | 126 | 99 | 107 | 9 | TVQAESAGA | 76.22 |
| DP03359 | P9WJD9 | ESX-1 secretion-associated protein EspB | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 290 | 460 | 292 | 300 | 9 | EQGLIPGFL | 85.95 |
| DP03359 | P9WJD9 | ESX-1 secretion-associated protein EspB | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 290 | 460 | 336 | 342 | 7 | AAQLTSA | 84.42 |
| DP03359 | P9WJD9 | ESX-1 secretion-associated protein EspB | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 290 | 460 | 346 | 362 | 17 | AAALSGDVAVKAASLGG | 79.93 |
| DP03359 | P9WJD9 | ESX-1 secretion-associated protein EspB | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 290 | 460 | 373 | 383 | 11 | LGSAIGGAESV | 85.28 |
| DP03359 | P9WJD9 | ESX-1 secretion-associated protein EspB | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 290 | 460 | 387 | 394 | 8 | GAGDIAGL | 75.92 |
| DP03359 | P9WJD9 | ESX-1 secretion-associated protein EspB | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 290 | 460 | 432 | 450 | 19 | EDEALYTEDRAWTEAVIGN | 78.88 |